Psyllid ID: psy2787


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-
MSANFAELNAFQENYTEPCRKPLPPERRGYGTFSVNNICSCQFSSSSLLILFFSSSSSSSGDFGMMRYSQNDCYVMTERKPLPCPWCPMESLKHNQFSQASDAWMFGVTIWEMFTFGAEPWVGLNGMQILQKIDREGERLPRPEACPVEVYALMRQCWSKNPAERPKFSTLKDCLYRLTPAVMKATQNCHEIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMDPMRRKQPDDISRPL
ccccccccccHHHHHHccccccccHHHHHHHHHHcccccHHHHccccccccccccccEEEccccccccccccEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHcHHHHHHHHcccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccc
cccHHccccHHHHHHcccccccccHHHHHHHHHHHcccHHHHHHHHHcEEEEccccEEEEccccccccccccccccccccccccccccHHHHHHccccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHcccccccccccccHHHHHHHHHHccccHHHcccHHHHHHHHHHHccccHHHHHHcccccccccccccccccEEEEcccccHHcccccccccccccccccccEEHcccccHHHccccc
MSANFAELNAFqenytepcrkplpperrgygtfsvnnicscqfssssLLILFFsssssssgdfgmmrysqndcyvmterkplpcpwcpmeslkhnqfsqasdawMFGVTIWEMFtfgaepwvglngMQILQKIDregerlprpeacpvEVYALMRQCwsknpaerpkfstlkdCLYRLTPAVMKATQncheideegklyidagdqiviiegdpechwwkgqnlstfnigmfprnimdpmrrkqpddisrpl
msanfaelnafqenytepcrkplPPERRGYGTFSVNNICSCQFSSSSLLILFFSSSSSSSGDFGMMRYSQNDCYVMTERKPLPCPWCPMESLKHNQFSQASDAWMFGVTIWEMFTFGAEPWVGLNGMQILQKIDREGERLPRPEACPVEVYALMRQCWSknpaerpkfstLKDCLYRLTPAVMKATQNCHEIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNimdpmrrkqpddisrpl
MSANFAELNAFQENYTEPCRKPLPPERRGYGTFSVNNICSCQfssssllilffsssssssGDFGMMRYSQNDCYVMTERKPLPCPWCPMESLKHNQFSQASDAWMFGVTIWEMFTFGAEPWVGLNGMQILQKIDREGERLPRPEACPVEVYALMRQCWSKNPAERPKFSTLKDCLYRLTPAVMKATQNCHEIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMDPMRRKQPDDISRPL
****************************GYGTFSVNNICSCQFSSSSLLILFFS********FGMMRYSQNDCYVMTERKPLPCPWCPMESLKHNQFSQASDAWMFGVTIWEMFTFGAEPWVGLNGMQILQKIDREGERLPRPEACPVEVYALMRQCWSKNPAERPKFSTLKDCLYRLTPAVMKATQNCHEIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRN*****************
MSANFAELNAFQENYTEPCRKPLPPERRGYGTFSVNNICSCQFSSSSLLILFFSSSSSSSGDFGMMRYSQNDCYVMTERKPLPCPWCPMESLKHNQFSQASDAWMFGVTIWEMFTFGAEPWVGLNGMQILQKIDREGERLPRPEACPVEVYALMRQCWSKNPAERPKFSTLKDCLYRLTPAVMK***************IDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIM***************
MSANFAELNAFQENYTEPCRKPLPPERRGYGTFSVNNICSCQFSSSSLLILFFSSSSSSSGDFGMMRYSQNDCYVMTERKPLPCPWCPMESLKHNQFSQASDAWMFGVTIWEMFTFGAEPWVGLNGMQILQKIDREGERLPRPEACPVEVYALMRQCWSKNPAERPKFSTLKDCLYRLTPAVMKATQNCHEIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMDPMRR**********
****FAELNAFQENYTEPCRKPLPPERRGYGTFSVNNICSCQFSSSSLLILFFSSSSSSSGDFGMMRYSQNDCYVMTERKPLPCPWCPMESLKHNQFSQASDAWMFGVTIWEMFTFGAEPWVGLNGMQILQKIDREGERLPRPEACPVEVYALMRQCWSKNPAERPKFSTLKDCLYRLTPAVMKATQNCHEIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMDPMRRKQ********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSANFAELNAFQENYTEPCRKPLPPERRGYGTFSVNNICSCQFSSSSLLILFFSSSSSSSGDFGMMRYSQNDCYVMTERKPLPCPWCPMESLKHNQFSQASDAWMFGVTIWEMFTFGAEPWVGLNGMQILQKIDREGERLPRPEACPVEVYALMRQCWSKNPAERPKFSTLKDCLYRLTPAVMKATQNCHEIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMDPMRRKQPDDISRPL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query251 2.2.26 [Sep-21-2011]
Q17R13 1039 Activated CDC42 kinase 1 yes N/A 0.868 0.209 0.471 3e-55
O54967 1055 Activated CDC42 kinase 1 yes N/A 0.792 0.188 0.504 4e-55
Q5U2X5 1040 Activated CDC42 kinase 1 yes N/A 0.792 0.191 0.514 5e-55
Q07912 1038 Activated CDC42 kinase 1 yes N/A 0.792 0.191 0.504 6e-55
Q99ML2 666 Non-receptor tyrosine-pro no N/A 0.717 0.270 0.416 9e-37
Q13470 666 Non-receptor tyrosine-pro no N/A 0.705 0.265 0.416 2e-36
Q10925 1237 Probable tyrosine-protein no N/A 0.673 0.136 0.418 1e-35
Q9I7F7 1337 Tyrosine-protein kinase P no N/A 0.725 0.136 0.382 4e-30
Q91738 1068 Focal adhesion kinase 1 O N/A N/A 0.498 0.117 0.396 2e-24
Q9H3Y6488 Tyrosine-protein kinase S no N/A 0.482 0.247 0.423 2e-24
>sp|Q17R13|ACK1_BOVIN Activated CDC42 kinase 1 OS=Bos taurus GN=TNK2 PE=1 SV=1 Back     alignment and function desciption
 Score =  214 bits (546), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 106/225 (47%), Positives = 136/225 (60%), Gaps = 7/225 (3%)

Query: 29  GYGTFSVNNICSCQFSSSSLLILFFSSSSSSSGDFGMMRY--SQNDCYVMTERKPLPCPW 86
           G G            ++ +LL+   +      GDFG+MR     +D YVM E + +P  W
Sbjct: 239 GMGYLEAKRFIHRDLAARNLLLA--TRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAW 296

Query: 87  CPMESLKHNQFSQASDAWMFGVTIWEMFTFGAEPWVGLNGMQILQKIDREGERLPRPEAC 146
           C  ESLK   FS ASD WMFGVT+WEMFT+G EPW+GLNG QIL KID+EGERLPRPE C
Sbjct: 297 CAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDC 356

Query: 147 PVEVYALMRQCWSKNPAERPKFSTLKDCLYRLTPAVMKATQNCHEIDEEGKLYIDAGDQI 206
           P ++Y +M QCW+  P +RP F  L+D L    P  M+A Q+  E D   KL+I   D I
Sbjct: 357 PQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQPTDMRALQDFEEPD---KLHIQMNDVI 413

Query: 207 VIIEGDPECHWWKGQNLSTFNIGMFPRNIMDPMRRKQPDDISRPL 251
            +IEG  E +WW+GQN  T  +G FPRN++  +      DIS+PL
Sbjct: 414 TVIEGRAENYWWRGQNTRTLCVGPFPRNVVTSVAGLSAQDISQPL 458




Non-receptor tyrosine-protein and serine/threonine-protein kinase that is implicated in cell spreading and migration, cell survival, cell growth and proliferation. Transduces extracellular signals to cytosolic and nuclear effectors. Phosphorylates AKT1, AR, MCF2, WASL and WWOX. Implicated in trafficking and clathrin-mediated endocytosis through binding to epidermal growth factor receptor (EGFR) and clathrin. Binds to both poly- and mono-ubiquitin and regulates ligand-induced degradation of EGFR, thereby contributing to the accumulation of EGFR at the limiting membrane of early endosomes. Downstream effector of CDC42 which mediates CDC42-dependent cell migration via phosphorylation of BCAR1. May be involved both in adult synaptic function and plasticity and in brain development. Activates AKT1 by phosphorylating it on 'Tyr-176'. Phosphorylates AR on 'Tyr-267' and 'Tyr-363' thereby promoting its recruitment to androgen-responsive enhancers (AREs). Phosphorylates WWOX on 'Tyr-287'. Phosphorylates MCF2, thereby enhancing its activity as a guanine nucleotide exchange factor (GEF) toward Rho family proteins. Contributes to the control of AXL receptor levels. Confers metastatic properties on cancer cells and promotes tumor growth by negatively regulating tumor suppressor such as WWOX and positively regulating pro-survival factors such as AKT1 and AR.
Bos taurus (taxid: 9913)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|O54967|ACK1_MOUSE Activated CDC42 kinase 1 OS=Mus musculus GN=Tnk2 PE=1 SV=2 Back     alignment and function description
>sp|Q5U2X5|ACK1_RAT Activated CDC42 kinase 1 OS=Rattus norvegicus GN=Tnk2 PE=2 SV=1 Back     alignment and function description
>sp|Q07912|ACK1_HUMAN Activated CDC42 kinase 1 OS=Homo sapiens GN=TNK2 PE=1 SV=3 Back     alignment and function description
>sp|Q99ML2|TNK1_MOUSE Non-receptor tyrosine-protein kinase TNK1 OS=Mus musculus GN=Tnk1 PE=1 SV=2 Back     alignment and function description
>sp|Q13470|TNK1_HUMAN Non-receptor tyrosine-protein kinase TNK1 OS=Homo sapiens GN=TNK1 PE=1 SV=3 Back     alignment and function description
>sp|Q10925|KIN25_CAEEL Probable tyrosine-protein kinase kin-25 OS=Caenorhabditis elegans GN=kin-25 PE=2 SV=2 Back     alignment and function description
>sp|Q9I7F7|PR2_DROME Tyrosine-protein kinase PR2 OS=Drosophila melanogaster GN=PR2 PE=1 SV=3 Back     alignment and function description
>sp|Q91738|FAK1_XENLA Focal adhesion kinase 1 OS=Xenopus laevis GN=ptk2 PE=2 SV=2 Back     alignment and function description
>sp|Q9H3Y6|SRMS_HUMAN Tyrosine-protein kinase Srms OS=Homo sapiens GN=SRMS PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query251
383854452 1255 PREDICTED: uncharacterized protein LOC10 0.792 0.158 0.598 2e-68
345480556 1308 PREDICTED: activated CDC42 kinase 1-like 0.792 0.152 0.598 2e-68
307207705 1463 Activated CDC42 kinase 1 [Harpegnathos s 0.749 0.128 0.626 5e-68
332030748 1498 Activated CDC42 kinase 1 [Acromyrmex ech 0.749 0.125 0.601 3e-65
380018959 1245 PREDICTED: uncharacterized protein LOC10 0.800 0.161 0.568 3e-65
328788715 1238 PREDICTED: hypothetical protein LOC41305 0.800 0.162 0.568 5e-65
322789077 622 hypothetical protein SINV_07793 [Solenop 0.792 0.319 0.588 5e-65
340726655 1251 PREDICTED: hypothetical protein LOC10064 0.792 0.159 0.568 3e-64
350418446 1251 PREDICTED: hypothetical protein LOC10074 0.792 0.159 0.563 4e-64
91089789 1000 PREDICTED: similar to protein kinase pro 0.792 0.199 0.568 7e-63
>gi|383854452|ref|XP_003702735.1| PREDICTED: uncharacterized protein LOC100875070 [Megachile rotundata] Back     alignment and taxonomy information
 Score =  265 bits (676), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 122/204 (59%), Positives = 149/204 (73%), Gaps = 5/204 (2%)

Query: 50  ILFFSSSSSSSGDFGMMRY--SQNDCYVMTERKPLPCPWCPMESLKHNQFSQASDAWMFG 107
           +L  +      GDFG+MR    Q DCYVMTE K +P PWC  ESLK  QFS ASD WMFG
Sbjct: 242 VLLSTVDKVKIGDFGLMRALPQQEDCYVMTEHKKVPFPWCAPESLKARQFSHASDVWMFG 301

Query: 108 VTIWEMFTFGAEPWVGLNGMQILQKIDREGERLPRPEACPVEVYALMRQCWSKNPAERPK 167
           VT+WEM TFG EPWVGLNG +IL+KIDREGERL  PEA P  +Y LM +CW++ P+ERP 
Sbjct: 302 VTLWEMLTFGEEPWVGLNGSEILRKIDREGERLHEPEATPPVMYQLMLRCWAREPSERPT 361

Query: 168 FSTLKDCLYRLTPAVMKATQNCHEIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFN 227
           F++L+  L  + PAVMKA  +  E D   K+ I+ GDQIVI++G PE +WWKGQN  TF 
Sbjct: 362 FASLRTSLTGMVPAVMKAVNHFEETD---KMTIEQGDQIVILDGRPENYWWKGQNQRTFQ 418

Query: 228 IGMFPRNIMDPMRRKQPDDISRPL 251
           IG+FPR ++DPMRRKQP+DIS+PL
Sbjct: 419 IGLFPRCLVDPMRRKQPEDISKPL 442




Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|345480556|ref|XP_001604712.2| PREDICTED: activated CDC42 kinase 1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307207705|gb|EFN85342.1| Activated CDC42 kinase 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332030748|gb|EGI70424.1| Activated CDC42 kinase 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|380018959|ref|XP_003693386.1| PREDICTED: uncharacterized protein LOC100866491 [Apis florea] Back     alignment and taxonomy information
>gi|328788715|ref|XP_396503.4| PREDICTED: hypothetical protein LOC413052 [Apis mellifera] Back     alignment and taxonomy information
>gi|322789077|gb|EFZ14520.1| hypothetical protein SINV_07793 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|340726655|ref|XP_003401670.1| PREDICTED: hypothetical protein LOC100647202 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350418446|ref|XP_003491859.1| PREDICTED: hypothetical protein LOC100747574 [Bombus impatiens] Back     alignment and taxonomy information
>gi|91089789|ref|XP_968303.1| PREDICTED: similar to protein kinase protein [Tribolium castaneum] gi|270013600|gb|EFA10048.1| hypothetical protein TcasGA2_TC012222 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query251
FB|FBgn0028484 1073 Ack "Activated Cdc42 kinase" [ 0.733 0.171 0.566 9.7e-55
UNIPROTKB|I3LH58 673 TNK2 "Uncharacterized protein" 0.749 0.279 0.544 3e-53
UNIPROTKB|F6PN06 828 BT.64988 "Uncharacterized prot 0.749 0.227 0.538 9.5e-53
UNIPROTKB|E2RFP7 1041 TNK2 "Uncharacterized protein" 0.749 0.180 0.544 2.7e-52
UNIPROTKB|D4A6C1 1008 Tnk2 "Activated CDC42 kinase 1 0.749 0.186 0.538 3e-52
UNIPROTKB|Q07912 1038 TNK2 "Activated CDC42 kinase 1 0.749 0.181 0.538 3.4e-52
UNIPROTKB|F1MSL0 1039 TNK2 "Activated CDC42 kinase 1 0.749 0.180 0.538 3.4e-52
UNIPROTKB|Q17R13 1039 TNK2 "Activated CDC42 kinase 1 0.749 0.180 0.538 3.4e-52
UNIPROTKB|C9J1X3 1040 TNK2 "Activated CDC42 kinase 1 0.749 0.180 0.538 3.4e-52
RGD|1305957 1040 Tnk2 "tyrosine kinase, non-rec 0.749 0.180 0.538 3.4e-52
FB|FBgn0028484 Ack "Activated Cdc42 kinase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 574 (207.1 bits), Expect = 9.7e-55, P = 9.7e-55
 Identities = 107/189 (56%), Positives = 139/189 (73%)

Query:    61 GDFGMMRY--SQNDCYVMTERKPLPCPWCPMESLKHNQFSQASDAWMFGVTIWEMFTFGA 118
             GDFG+MR    ++DCYVM+E K +P PWC  ESL+  QFS ASD WMFGVT+WEMF+FG 
Sbjct:   267 GDFGLMRALPQEDDCYVMSEHKKVPFPWCAPESLRFRQFSHASDTWMFGVTLWEMFSFGE 326

Query:   119 EPWVGLNGMQILQKIDREGERLPRPEACPVEVYALMRQCWSKNPAERPKFSTLKDCLYRL 178
             +PWVGLNG QIL+KIDREGERL +P+ACP +VYA+M QCW K PAERP F+ LK+ L  +
Sbjct:   327 DPWVGLNGSQILRKIDREGERLHQPDACPPDVYAMMLQCWDKTPAERPTFAALKEYLASM 386

Query:   179 TPAVMKATQNCHEIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMDP 238
             +P VM+A+++ HE   +G L I+ GD I II+G  E    KGQN  TF+IG+FPRN+++ 
Sbjct:   387 SPPVMRASRSHHE--SKG-LQIEPGDTIAIIDGRHELKLIKGQNQRTFDIGIFPRNLLEQ 443

Query:   239 MRRKQPDDI 247
              +     D+
Sbjct:   444 RKVGAAGDV 452




GO:0004715 "non-membrane spanning protein tyrosine kinase activity" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISS
GO:0042169 "SH2 domain binding" evidence=IDA
GO:0004713 "protein tyrosine kinase activity" evidence=IDA;NAS
GO:0006468 "protein phosphorylation" evidence=IDA;NAS
GO:0018108 "peptidyl-tyrosine phosphorylation" evidence=IDA
GO:0007391 "dorsal closure" evidence=IMP
GO:0005524 "ATP binding" evidence=IEA
GO:0043066 "negative regulation of apoptotic process" evidence=IGI
UNIPROTKB|I3LH58 TNK2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F6PN06 BT.64988 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RFP7 TNK2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|D4A6C1 Tnk2 "Activated CDC42 kinase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q07912 TNK2 "Activated CDC42 kinase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MSL0 TNK2 "Activated CDC42 kinase 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q17R13 TNK2 "Activated CDC42 kinase 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|C9J1X3 TNK2 "Activated CDC42 kinase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1305957 Tnk2 "tyrosine kinase, non-receptor, 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q07912ACK1_HUMAN2, ., 7, ., 1, 1, ., 10.50490.79280.1917yesN/A
Q5U2X5ACK1_RAT2, ., 7, ., 1, 1, ., 10.51470.79280.1913yesN/A
O54967ACK1_MOUSE2, ., 7, ., 1, 1, ., 10.50490.79280.1886yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
cd05040257 cd05040, PTKc_Ack_like, Catalytic domain of the Pr 6e-64
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 2e-47
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 3e-46
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 2e-45
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 5e-45
cd05056270 cd05056, PTKc_FAK, Catalytic domain of the Protein 4e-34
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 8e-32
cd05060257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 1e-31
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 1e-30
cd05049280 cd05049, PTKc_Trk, Catalytic domain of the Protein 2e-30
cd05050288 cd05050, PTKc_Musk, Catalytic domain of the Protei 1e-29
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 2e-29
cd05068261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 2e-29
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 2e-29
cd05052263 cd05052, PTKc_Abl, Catalytic domain of the Protein 3e-29
cd05092280 cd05092, PTKc_TrkA, Catalytic domain of the Protei 4e-29
cd05057279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 1e-28
cd05038284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 4e-28
cd05048283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 7e-28
cd05044269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 9e-28
cd05032277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 2e-27
cd05053293 cd05053, PTKc_FGFR, Catalytic domain of the Protei 2e-27
cd05051296 cd05051, PTKc_DDR, Catalytic domain of the Protein 3e-27
cd05035273 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li 5e-27
cd05067260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 3e-26
cd05094291 cd05094, PTKc_TrkC, Catalytic domain of the Protei 6e-26
cd05084252 cd05084, PTKc_Fes, Catalytic domain of the Protein 7e-26
cd05072261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 1e-25
cd05033266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 2e-25
cd05085250 cd05085, PTKc_Fer, Catalytic domain of the Protein 5e-25
cd05083254 cd05083, PTKc_Chk, Catalytic domain of the Protein 6e-25
cd05114256 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro 8e-25
cd05090283 cd05090, PTKc_Ror1, Catalytic domain of the Protei 1e-24
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 1e-24
cd05113256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 2e-24
cd05093288 cd05093, PTKc_TrkB, Catalytic domain of the Protei 2e-24
cd05116257 cd05116, PTKc_Syk, Catalytic domain of the Protein 3e-24
cd05109279 cd05109, PTKc_HER2, Catalytic domain of the Protei 4e-24
cd05043280 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Rece 4e-24
cd05036277 cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro 1e-23
cd05089297 cd05089, PTKc_Tie1, Catalytic domain of the Protei 1e-23
cd05099314 cd05099, PTKc_FGFR4, Catalytic domain of the Prote 1e-23
cd05074273 cd05074, PTKc_Tyro3, Catalytic domain of the Prote 1e-23
cd05047270 cd05047, PTKc_Tie, Catalytic domain of Tie Protein 2e-23
cd05081284 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) 2e-23
cd05063268 cd05063, PTKc_EphR_A2, Catalytic domain of the Pro 2e-23
cd05058262 cd05058, PTKc_Met_Ron, Catalytic domain of the Pro 2e-23
cd05111279 cd05111, PTK_HER3, Pseudokinase domain of the Prot 2e-23
cd05046275 cd05046, PTK_CCK4, Pseudokinase domain of the Prot 2e-23
cd05066267 cd05066, PTKc_EphR_A, Catalytic domain of the Prot 3e-23
cd05045290 cd05045, PTKc_RET, Catalytic domain of the Protein 5e-23
cd05088303 cd05088, PTKc_Tie2, Catalytic domain of the Protei 8e-23
cd05073260 cd05073, PTKc_Hck, Catalytic domain of the Protein 1e-22
cd05108316 cd05108, PTKc_EGFR, Catalytic domain of the Protei 1e-22
cd05061288 cd05061, PTKc_InsR, Catalytic domain of the Protei 1e-22
cd05070260 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro 2e-22
cd05062277 cd05062, PTKc_IGF-1R, Catalytic domain of the Prot 4e-22
cd05069260 cd05069, PTKc_Yes, Catalytic domain of the Protein 6e-22
cd05091283 cd05091, PTKc_Ror2, Catalytic domain of the Protei 7e-22
cd05098307 cd05098, PTKc_FGFR1, Catalytic domain of the Prote 9e-22
cd05101304 cd05101, PTKc_FGFR2, Catalytic domain of the Prote 9e-22
cd05100334 cd05100, PTKc_FGFR3, Catalytic domain of the Prote 1e-21
cd05064266 cd05064, PTKc_EphR_A10, Catalytic domain of the Pr 1e-21
cd05110303 cd05110, PTKc_HER4, Catalytic domain of the Protei 1e-21
cd05055302 cd05055, PTKc_PDGFR, Catalytic domain of the Prote 2e-21
cd05112256 cd05112, PTKc_Itk, Catalytic domain of the Protein 2e-21
cd05115257 cd05115, PTKc_Zap-70, Catalytic domain of the Prot 1e-20
cd05054337 cd05054, PTKc_VEGFR, Catalytic domain of the Prote 2e-20
cd05095296 cd05095, PTKc_DDR2, Catalytic domain of the Protei 2e-20
cd05082256 cd05082, PTKc_Csk, Catalytic domain of the Protein 2e-20
cd05075272 cd05075, PTKc_Axl, Catalytic domain of the Protein 4e-20
cd05104375 cd05104, PTKc_Kit, Catalytic domain of the Protein 5e-20
cd05080283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 8e-20
cd05079284 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma 8e-20
cd05065269 cd05065, PTKc_EphR_B, Catalytic domain of the Prot 1e-19
cd05071262 cd05071, PTKc_Src, Catalytic domain of the Protein 1e-19
cd05102338 cd05102, PTKc_VEGFR3, Catalytic domain of the Prot 6e-19
cd05105400 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the 6e-19
cd05097295 cd05097, PTKc_DDR_like, Catalytic domain of Discoi 7e-19
cd05096304 cd05096, PTKc_DDR1, Catalytic domain of the Protei 7e-19
cd05106374 cd05106, PTKc_CSF-1R, Catalytic domain of the Prot 8e-19
cd05107401 cd05107, PTKc_PDGFR_beta, Catalytic domain of the 1e-17
cd05103343 cd05103, PTKc_VEGFR2, Catalytic domain of the Prot 2e-17
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 3e-11
cd05037259 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) dom 6e-11
cd05087269 cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of t 4e-10
cd05042269 cd05042, PTKc_Aatyk, Catalytic domain of the Prote 1e-09
cd05078258 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 9e-09
pfam00069260 pfam00069, Pkinase, Protein kinase domain 1e-08
cd08222260 cd08222, STKc_Nek11, Catalytic domain of the Prote 1e-08
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 8e-08
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 1e-07
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 6e-07
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 1e-06
cd05076274 cd05076, PTK_Tyk2_rpt1, Pseudokinase (repeat 1) do 2e-06
cd1198162 cd11981, SH3_VAV3_1, First Src homology 3 domain o 3e-06
cd05086268 cd05086, PTKc_Aatyk2, Catalytic domain of the Prot 3e-06
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 2e-05
PHA02988283 PHA02988, PHA02988, hypothetical protein; Provisio 2e-05
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 3e-05
cd1183162 cd11831, SH3_VAV_1, First Src homology 3 domain of 3e-05
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 4e-05
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 4e-05
PTZ00267478 PTZ00267, PTZ00267, NIMA-related protein kinase; P 6e-05
smart0032656 smart00326, SH3, Src homology 3 domains 8e-05
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 2e-04
cd05582318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 2e-04
cd0017451 cd00174, SH3, Src Homology 3 domain superfamily 4e-04
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 4e-04
cd05077262 cd05077, PTK_Jak1_rpt1, Pseudokinase (repeat 1) do 4e-04
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 5e-04
cd1188655 cd11886, SH3_BOI, Src Homology 3 domain of fungal 5e-04
cd1197963 cd11979, SH3_VAV1_1, First Src homology 3 domain o 9e-04
cd1198060 cd11980, SH3_VAV2_1, First Src homology 3 domain o 0.001
cd08219255 cd08219, STKc_Nek3, Catalytic domain of the Protei 0.001
cd1200554 cd12005, SH3_Lck, Src homology 3 domain of Lck Pro 0.001
cd06619279 cd06619, PKc_MKK5, Catalytic domain of the dual-sp 0.001
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 0.001
cd05589324 cd05589, STKc_PKN, Catalytic domain of the Protein 0.001
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 0.001
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 0.002
pfam0001847 pfam00018, SH3_1, SH3 domain 0.002
cd06644292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 0.002
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 0.003
cd1184552 cd11845, SH3_Src_like, Src homology 3 domain of Sr 0.004
cd06617283 cd06617, PKc_MKK3_6, Catalytic domain of the dual- 0.004
cd1181954 cd11819, SH3_Cortactin_like, Src homology 3 domain 0.004
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
 Score =  199 bits (509), Expect = 6e-64
 Identities = 73/128 (57%), Positives = 89/128 (69%), Gaps = 2/128 (1%)

Query: 50  ILFFSSSSSSSGDFGMMRY--SQNDCYVMTERKPLPCPWCPMESLKHNQFSQASDAWMFG 107
           IL  S      GDFG+MR      D YVM E   +P  WC  ESL+   FS ASD WMFG
Sbjct: 128 ILLASDDKVKIGDFGLMRALPQNEDHYVMEEHLKVPFAWCAPESLRTRTFSHASDVWMFG 187

Query: 108 VTIWEMFTFGAEPWVGLNGMQILQKIDREGERLPRPEACPVEVYALMRQCWSKNPAERPK 167
           VT+WEMFT+G EPW GL+G QIL+KID+EGERL RPEACP ++Y +M QCW+ NPA+RP 
Sbjct: 188 VTLWEMFTYGEEPWAGLSGSQILKKIDKEGERLERPEACPQDIYNVMLQCWAHNPADRPT 247

Query: 168 FSTLKDCL 175
           F+ L++ L
Sbjct: 248 FAALREFL 255


Protein Tyrosine Kinase (PTK) family; Activated Cdc42-associated kinase (Ack) subfamily; catalytic (c) domain. Ack subfamily members include Ack1, thirty-eight-negative kinase 1 (Tnk1), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ack subfamily members are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal catalytic domain, an SH3 domain, a Cdc42-binding CRIB domain, and a proline-rich region. They are mainly expressed in brain and skeletal tissues and are involved in the regulation of cell adhesion and growth, receptor degradation, and axonal guidance. Ack1 is also associated with androgen-independent prostate cancer progression. Tnk1 regulates TNFalpha signaling and may play an important role in cell death. Length = 257

>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>gnl|CDD|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>gnl|CDD|133247 cd05116, PTKc_Syk, Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>gnl|CDD|133240 cd05109, PTKc_HER2, Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>gnl|CDD|133175 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|133220 cd05089, PTKc_Tie1, Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>gnl|CDD|133205 cd05074, PTKc_Tyro3, Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>gnl|CDD|88330 cd05047, PTKc_Tie, Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>gnl|CDD|173656 cd05111, PTK_HER3, Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|133219 cd05088, PTKc_Tie2, Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>gnl|CDD|173647 cd05091, PTKc_Ror2, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|133195 cd05064, PTKc_EphR_A10, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|133246 cd05115, PTKc_Zap-70, Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>gnl|CDD|173635 cd05054, PTKc_VEGFR, Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|173651 cd05095, PTKc_DDR2, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|173642 cd05075, PTKc_Axl, Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>gnl|CDD|133235 cd05104, PTKc_Kit, Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>gnl|CDD|133233 cd05102, PTKc_VEGFR3, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|173653 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133227 cd05096, PTKc_DDR1, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|133238 cd05107, PTKc_PDGFR_beta, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>gnl|CDD|133234 cd05103, PTKc_VEGFR2, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173627 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|173646 cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>gnl|CDD|133174 cd05042, PTKc_Aatyk, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>gnl|CDD|133209 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133207 cd05076, PTK_Tyk2_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|212914 cd11981, SH3_VAV3_1, First Src homology 3 domain of VAV3 protein Back     alignment and domain information
>gnl|CDD|133217 cd05086, PTKc_Aatyk2, Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|165291 PHA02988, PHA02988, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|212765 cd11831, SH3_VAV_1, First Src homology 3 domain of VAV proteins Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|214620 smart00326, SH3, Src homology 3 domains Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173643 cd05077, PTK_Jak1_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|212819 cd11886, SH3_BOI, Src Homology 3 domain of fungal BOI-like proteins Back     alignment and domain information
>gnl|CDD|212912 cd11979, SH3_VAV1_1, First Src homology 3 domain of VAV1 protein Back     alignment and domain information
>gnl|CDD|212913 cd11980, SH3_VAV2_1, First Src homology 3 domain of VAV2 protein Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|212938 cd12005, SH3_Lck, Src homology 3 domain of Lck Protein Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|215659 pfam00018, SH3_1, SH3 domain Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|212779 cd11845, SH3_Src_like, Src homology 3 domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>gnl|CDD|212753 cd11819, SH3_Cortactin_like, Src homology 3 domain of Cortactin and related proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 251
KOG0199|consensus 1039 100.0
KOG0197|consensus468 100.0
KOG0581|consensus364 100.0
KOG0192|consensus362 100.0
KOG0575|consensus 592 100.0
KOG0592|consensus 604 100.0
KOG0615|consensus475 100.0
KOG0198|consensus313 100.0
KOG0591|consensus375 100.0
KOG0583|consensus370 100.0
KOG0598|consensus357 100.0
KOG4721|consensus 904 100.0
KOG1095|consensus1025 100.0
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 100.0
KOG0578|consensus550 100.0
KOG1026|consensus774 100.0
KOG0588|consensus 786 100.0
KOG0033|consensus355 100.0
KOG4257|consensus 974 100.0
PHA02988283 hypothetical protein; Provisional 100.0
KOG0595|consensus429 100.0
KOG0616|consensus355 100.0
KOG0201|consensus 467 100.0
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 100.0
KOG0585|consensus 576 100.0
KOG0605|consensus550 100.0
KOG4278|consensus 1157 100.0
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 100.0
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 100.0
KOG0593|consensus396 100.0
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 100.0
KOG0599|consensus411 100.0
PTZ00283 496 serine/threonine protein kinase; Provisional 100.0
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 100.0
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 100.0
KOG0694|consensus694 100.0
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 100.0
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 100.0
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 100.0
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 100.0
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 100.0
KOG0193|consensus678 100.0
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 100.0
KOG0196|consensus996 100.0
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.98
KOG0194|consensus474 99.98
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.98
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.98
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.98
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.98
PTZ00267478 NIMA-related protein kinase; Provisional 99.98
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.98
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.98
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.98
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.98
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.98
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.98
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.98
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.98
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.98
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.98
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.98
KOG0589|consensus426 99.98
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.97
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.97
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.97
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.97
KOG0660|consensus359 99.97
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.97
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.97
KOG0597|consensus 808 99.97
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.97
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.97
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.97
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.97
KOG0663|consensus419 99.97
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.97
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.97
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.97
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.97
PTZ00263329 protein kinase A catalytic subunit; Provisional 99.97
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.97
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.97
KOG0600|consensus560 99.97
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.97
KOG0610|consensus459 99.97
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.97
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.97
KOG0661|consensus 538 99.97
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.97
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.97
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.97
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.97
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.97
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.97
KOG0200|consensus609 99.97
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.97
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.97
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.97
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.97
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.97
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.97
KOG0604|consensus400 99.97
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.97
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 99.97
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 99.97
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.97
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.97
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.97
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.97
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.97
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.97
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.97
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 99.97
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.97
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.97
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.97
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.97
KOG0582|consensus 516 99.97
KOG0611|consensus 668 99.97
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.97
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.97
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.97
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.97
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.97
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.97
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.97
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.97
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.97
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.97
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.97
PTZ00036440 glycogen synthase kinase; Provisional 99.97
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.97
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.97
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.97
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.97
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.97
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.97
KOG0580|consensus281 99.97
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.97
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.97
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.97
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.97
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.97
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.97
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.97
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.97
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.97
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.97
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.97
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.97
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.97
KOG4645|consensus1509 99.97
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.97
KOG0032|consensus382 99.97
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.97
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.97
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.97
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.97
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.97
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.97
KOG0659|consensus318 99.97
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.97
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.97
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.97
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.97
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.97
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.97
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 99.97
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.97
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.97
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.97
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.97
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.97
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.97
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 99.97
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.97
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.97
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.97
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.97
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.97
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.97
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.97
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.97
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.97
PHA02882294 putative serine/threonine kinase; Provisional 99.97
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.97
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.97
KOG4717|consensus 864 99.97
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.97
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.97
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.97
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.97
KOG0603|consensus612 99.97
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.97
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.97
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.97
KOG0594|consensus323 99.97
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.97
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.97
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 99.97
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.97
KOG0983|consensus391 99.97
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.96
KOG4279|consensus 1226 99.96
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.96
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.96
PHA03212391 serine/threonine kinase US3; Provisional 99.96
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.96
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.96
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.96
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.96
KOG1094|consensus807 99.96
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.96
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.96
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.96
KOG0612|consensus 1317 99.96
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.96
KOG0690|consensus516 99.96
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.96
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.96
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.96
PTZ00284467 protein kinase; Provisional 99.96
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.96
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.96
KOG0596|consensus677 99.96
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.96
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.96
KOG1187|consensus361 99.96
KOG0696|consensus683 99.96
KOG0658|consensus364 99.96
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.96
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.96
KOG1989|consensus 738 99.96
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.96
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.96
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.96
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.96
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.96
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.96
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.96
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.96
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.96
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.96
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.96
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.96
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.96
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.96
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.96
PHA03207392 serine/threonine kinase US3; Provisional 99.96
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.96
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.96
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.96
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.96
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.96
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.96
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.96
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.96
KOG1025|consensus 1177 99.96
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 99.96
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.96
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.96
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.96
KOG0579|consensus 1187 99.96
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.96
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.96
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.96
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.96
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.96
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.96
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.96
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.96
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.96
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.96
KOG1024|consensus563 99.96
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.96
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.96
KOG0614|consensus732 99.96
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.96
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.96
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.96
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.96
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.96
PHA03209357 serine/threonine kinase US3; Provisional 99.96
KOG1035|consensus 1351 99.96
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.96
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.96
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.96
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.95
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.95
PHA03210501 serine/threonine kinase US3; Provisional 99.95
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.95
KOG0577|consensus 948 99.95
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.95
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.95
KOG0584|consensus 632 99.95
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.95
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.95
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.95
PHA03211461 serine/threonine kinase US3; Provisional 99.95
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.95
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.95
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 99.95
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.95
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.95
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.95
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.95
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.95
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.95
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.95
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.95
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.95
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.95
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.95
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.95
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.95
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.95
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.95
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.95
KOG0667|consensus586 99.95
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.95
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.95
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.95
KOG0586|consensus 596 99.95
KOG2345|consensus302 99.95
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.95
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 99.95
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.95
KOG0574|consensus 502 99.95
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.95
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.95
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.95
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.95
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.95
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.95
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.95
KOG3653|consensus534 99.95
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.95
KOG0986|consensus591 99.95
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.95
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.95
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.95
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.95
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.95
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.95
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.95
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.95
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.95
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 99.95
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.95
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.94
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.94
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.94
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.94
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.94
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.94
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.94
PLN00181 793 protein SPA1-RELATED; Provisional 99.94
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.94
PLN00009294 cyclin-dependent kinase A; Provisional 99.94
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.94
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.94
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.94
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.94
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.94
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.94
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.94
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.94
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.94
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.94
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.94
KOG2052|consensus513 99.94
KOG1006|consensus361 99.93
KOG1027|consensus903 99.93
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.93
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.93
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.93
KOG0664|consensus449 99.93
KOG4250|consensus 732 99.93
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.93
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.93
KOG0665|consensus369 99.93
KOG0607|consensus463 99.93
cd05610669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.92
KOG0669|consensus376 99.92
KOG0666|consensus438 99.92
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.92
KOG4236|consensus888 99.92
KOG0608|consensus1034 99.91
KOG0587|consensus 953 99.91
PLN03224507 probable serine/threonine protein kinase; Provisio 99.91
KOG0671|consensus415 99.91
KOG0695|consensus593 99.91
KOG0662|consensus292 99.91
KOG0984|consensus282 99.9
KOG1345|consensus378 99.9
KOG0670|consensus752 99.87
KOG1151|consensus775 99.87
KOG0668|consensus338 99.86
KOG0590|consensus601 99.85
KOG0576|consensus 829 99.84
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.82
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.79
KOG1167|consensus418 99.78
KOG0606|consensus 1205 99.78
KOG4158|consensus598 99.77
KOG1023|consensus 484 99.77
KOG0195|consensus448 99.76
KOG1152|consensus772 99.74
KOG1033|consensus516 99.74
KOG1164|consensus322 99.71
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 99.71
KOG0603|consensus 612 99.7
COG0515384 SPS1 Serine/threonine protein kinase [General func 99.7
KOG1240|consensus 1431 99.69
KOG1163|consensus341 99.67
KOG1165|consensus449 99.66
PRK09188365 serine/threonine protein kinase; Provisional 99.53
KOG0590|consensus 601 99.48
PRK12274218 serine/threonine protein kinase; Provisional 99.48
KOG1290|consensus590 99.42
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.38
KOG1166|consensus974 99.2
KOG0606|consensus1205 99.18
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.15
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.12
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 99.05
KOG1266|consensus458 99.04
KOG0601|consensus524 99.03
KOG2137|consensus 700 99.01
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 98.99
PRK10345210 hypothetical protein; Provisional 98.94
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 98.92
smart00090237 RIO RIO-like kinase. 98.9
PRK09605535 bifunctional UGMP family protein/serine/threonine 98.89
PRK14879211 serine/threonine protein kinase; Provisional 98.86
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 98.85
COG4248 637 Uncharacterized protein with protein kinase and he 98.56
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 98.52
KOG0601|consensus524 98.5
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 98.34
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 98.34
TIGR01982437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 98.24
KOG1243|consensus 690 98.16
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 98.04
PRK15123268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 97.92
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 97.85
PF06293206 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; 97.83
KOG3087|consensus229 97.64
PRK04750537 ubiB putative ubiquinone biosynthesis protein UbiB 97.56
PF06176229 WaaY: Lipopolysaccharide core biosynthesis protein 97.32
KOG1290|consensus 590 97.19
COG0478304 RIO-like serine/threonine protein kinase fused to 96.98
PRK09902216 hypothetical protein; Provisional 96.77
KOG3741|consensus655 96.24
KOG1035|consensus 1351 96.16
KOG0576|consensus 829 95.88
KOG1826|consensus 2724 95.03
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 94.96
TIGR00938307 thrB_alt homoserine kinase, Neisseria type. Homose 94.57
PRK05231319 homoserine kinase; Provisional 94.29
COG1718268 RIO1 Serine/threonine protein kinase involved in c 93.47
cd05155235 APH_ChoK_like_1 Uncharacterized bacterial proteins 93.45
PRK10271188 thiK thiamine kinase; Provisional 93.17
cd05156302 ChoK_euk Choline Kinase (ChoK) in eukaryotes. The 93.02
cd05153296 HomoserineK_II Homoserine Kinase, type II. Homoser 92.93
cd05157235 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. 92.6
PF1460449 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 92.47
PF01636239 APH: Phosphotransferase enzyme family This family 92.45
cd05150244 APH Aminoglycoside 3'-phosphotransferase (APH). Th 92.44
KOG1093|consensus 725 92.3
TIGR02172226 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogou 92.09
TIGR02721256 ycfN_thiK thiamine kinase. Members of this family 91.96
PF01633211 Choline_kinase: Choline/ethanolamine kinase; Inter 91.93
TIGR02906313 spore_CotS spore coat protein, CotS family. Member 91.37
PF0001848 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho 91.36
COG0510269 ycfN Thiamine kinase and related kinases [Coenzyme 90.82
PF13095207 FTA2: Kinetochore Sim4 complex subunit FTA2 90.69
COG0661517 AarF Predicted unusual protein kinase [General fun 90.4
smart00587196 CHK ZnF_C4 abd HLH domain containing kinases domai 90.37
COG2334331 Putative homoserine kinase type II (protein kinase 90.11
TIGR02904309 spore_ysxE spore coat protein YsxE. Members of thi 89.78
PF07387308 Seadorna_VP7: Seadornavirus VP7; InterPro: IPR0099 89.7
PLN02236344 choline kinase 89.08
cd05152276 MPH2' Macrolide 2'-Phosphotransferase (MPH2'). MPH 88.94
PF05445434 Pox_ser-thr_kin: Poxvirus serine/threonine protein 88.65
PHA03111444 Ser/Thr kinase; Provisional 88.53
PF12260188 PIP49_C: Protein-kinase domain of FAM69; InterPro: 88.0
KOG1235|consensus538 87.61
smart0032658 SH3 Src homology 3 domains. Src homology 3 (SH3) d 86.19
PF0765355 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 85.81
cd0017454 SH3 Src homology 3 domains; SH3 domains bind to pr 85.73
PLN02421330 phosphotransferase, alcohol group as acceptor/kina 85.37
PRK06148 1013 hypothetical protein; Provisional 85.06
KOG2268|consensus465 84.75
PRK11768325 serine/threonine protein kinase; Provisional 83.08
COG3173321 Predicted aminoglycoside phosphotransferase [Gener 81.84
COG5072488 ALK1 Serine/threonine kinase of the haspin family 81.55
PF02958294 EcKinase: Ecdysteroid kinase; InterPro: IPR004119 80.29
>KOG0199|consensus Back     alignment and domain information
Probab=100.00  E-value=1.6e-45  Score=319.81  Aligned_cols=241  Identities=38%  Similarity=0.739  Sum_probs=209.2

Q ss_pred             CcccccchhHHHHHhcCC---------CCCCCchhhHHhhhhhhCCcccCCCCCCCceEEEccCCceEEccCCCCccc--
Q psy2787           1 MSANFAELNAFQENYTEP---------CRKPLPPERRGYGTFSVNNICSCQFSSSSLLILFFSSSSSSSGDFGMMRYS--   69 (251)
Q Consensus         1 ~~~e~~~l~~l~~~~~~~---------~~~~~~~~~~gl~~lH~~~iiHrdlkp~ni~il~~~~~~~kl~DFGla~~~--   69 (251)
                      |.+|+|++|+|++.+...         +..++.|+++|+.||.++++|||||-..|  +++.....+|||||||.+.+  
T Consensus       187 MV~ELaplGSLldrLrka~~~~llv~~Lcdya~QiA~aM~YLeskrlvHRDLAARN--lllasprtVKI~DFGLmRaLg~  264 (1039)
T KOG0199|consen  187 MVFELAPLGSLLDRLRKAKKAILLVSRLCDYAMQIAKAMQYLESKRLVHRDLAARN--LLLASPRTVKICDFGLMRALGE  264 (1039)
T ss_pred             HHhhhcccchHHHHHhhccccceeHHHHHHHHHHHHHHHHHHhhhhhhhhhhhhhh--heecccceeeeecccceeccCC
Confidence            789999999999988762         23456788899999999999999999999  99998999999999999984  


Q ss_pred             CCCceeecCCCCcCcccCCCcccCCCCCCchhHHHHHHHHHHHHHhCCCCCCCCCChhHHHHHHHhcCCCCCCCCCCcHH
Q psy2787          70 QNDCYVMTERKPLPCPWCPMESLKHNQFSQASDAWMFGVTIWEMFTFGAEPWVGLNGMQILQKIDREGERLPRPEACPVE  149 (251)
Q Consensus        70 ~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Di~S~G~il~el~~~g~~pf~~~~~~~~~~~i~~~~~~~~~~~~~~~~  149 (251)
                      ..+.|........++.|+|||.++...|+.++|||+|||++|||+++|+.||.|....+++++|. .+.+++.|+.|+++
T Consensus       265 ned~Yvm~p~rkvPfAWCaPEsLrh~kFShaSDvWmyGVTiWEMFtyGEePW~G~~g~qIL~~iD-~~erLpRPk~csed  343 (1039)
T KOG0199|consen  265 NEDMYVMAPQRKVPFAWCAPESLRHRKFSHASDVWMYGVTIWEMFTYGEEPWVGCRGIQILKNID-AGERLPRPKYCSED  343 (1039)
T ss_pred             CCcceEecCCCcCcccccCHhHhccccccccchhhhhhhhHHhhhccCCCCCCCCCHHHHHHhcc-ccccCCCCCCChHH
Confidence            45567788888889999999999999999999999999999999999999999999999999995 89999999999999


Q ss_pred             HHHHHHHHhccCCCCCCCHHHHHHHHH--hhcHHHHHhhhhccccccCCcccccCCCeEEEecCCCCCCcccccccceee
Q psy2787         150 VYALMRQCWSKNPAERPKFSTLKDCLY--RLTPAVMKATQNCHEIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFN  227 (251)
Q Consensus       150 ~~~li~~cl~~dP~~Rps~~~il~~l~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  227 (251)
                      +++++.+||+.+|++||||..|.+.+-  ...+.......   ...+.+.+.+..++.++++++.+..+||+|||.|+++
T Consensus       344 IY~imk~cWah~paDRptFsair~~~~l~eaqp~~a~~~~---d~~ep~aLh~~kgD~IvVIegs~a~y~WfgQn~Rn~k  420 (1039)
T KOG0199|consen  344 IYQIMKNCWAHNPADRPTFSAIREDLVLAEAQPAVARETY---DSIEPGALHLTKGDEIVVIEGSGAGYDWFGQNKRNQK  420 (1039)
T ss_pred             HHHHHHHhccCCccccccHHHHHHhHHHHhcCCceeeeec---cccCCCceeeccCCeEEEEecCCccceeeccccccce
Confidence            999999999999999999999975433  22232222222   4467789999999999999999999999999999999


Q ss_pred             eecccCcccccCcCCCCCCcC
Q psy2787         228 IGMFPRNIMDPMRRKQPDDIS  248 (251)
Q Consensus       228 ~~~~p~~~~~~~~~~~~~~~~  248 (251)
                      +|.||++++. +-..++-.++
T Consensus       421 vG~Fprsvvt-~a~lga~pa~  440 (1039)
T KOG0199|consen  421 VGTFPRSVVT-AATLGAVPAA  440 (1039)
T ss_pred             ecccCcceee-ecccCCCCcc
Confidence            9999999887 4444444443



>KOG0197|consensus Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>KOG0192|consensus Back     alignment and domain information
>KOG0575|consensus Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>KOG4721|consensus Back     alignment and domain information
>KOG1095|consensus Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>KOG1026|consensus Back     alignment and domain information
>KOG0588|consensus Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>KOG4257|consensus Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>KOG0595|consensus Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>KOG0193|consensus Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>KOG0589|consensus Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0660|consensus Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>KOG0663|consensus Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>KOG0600|consensus Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>KOG0661|consensus Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>KOG0200|consensus Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>KOG0582|consensus Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG4645|consensus Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>KOG4717|consensus Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>KOG0594|consensus Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>KOG0983|consensus Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>KOG1094|consensus Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>KOG0596|consensus Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>KOG1187|consensus Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>KOG0658|consensus Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG1989|consensus Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>KOG1025|consensus Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>KOG0579|consensus Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>KOG1024|consensus Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>KOG0577|consensus Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>KOG0584|consensus Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>KOG0667|consensus Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>KOG0586|consensus Back     alignment and domain information
>KOG2345|consensus Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>KOG0574|consensus Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>KOG3653|consensus Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>KOG2052|consensus Back     alignment and domain information
>KOG1006|consensus Back     alignment and domain information
>KOG1027|consensus Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>KOG0664|consensus Back     alignment and domain information
>KOG4250|consensus Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0665|consensus Back     alignment and domain information
>KOG0607|consensus Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>KOG0669|consensus Back     alignment and domain information
>KOG0666|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>KOG0608|consensus Back     alignment and domain information
>KOG0587|consensus Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0671|consensus Back     alignment and domain information
>KOG0695|consensus Back     alignment and domain information
>KOG0662|consensus Back     alignment and domain information
>KOG0984|consensus Back     alignment and domain information
>KOG1345|consensus Back     alignment and domain information
>KOG0670|consensus Back     alignment and domain information
>KOG1151|consensus Back     alignment and domain information
>KOG0668|consensus Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>KOG0576|consensus Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG1167|consensus Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>KOG4158|consensus Back     alignment and domain information
>KOG1023|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>KOG1152|consensus Back     alignment and domain information
>KOG1033|consensus Back     alignment and domain information
>KOG1164|consensus Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1163|consensus Back     alignment and domain information
>KOG1165|consensus Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1290|consensus Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>KOG1166|consensus Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>KOG1266|consensus Back     alignment and domain information
>KOG0601|consensus Back     alignment and domain information
>KOG2137|consensus Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only] Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0601|consensus Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>KOG1243|consensus Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>KOG3087|consensus Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY) Back     alignment and domain information
>KOG1290|consensus Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK09902 hypothetical protein; Provisional Back     alignment and domain information
>KOG3741|consensus Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>KOG0576|consensus Back     alignment and domain information
>KOG1826|consensus Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>TIGR00938 thrB_alt homoserine kinase, Neisseria type Back     alignment and domain information
>PRK05231 homoserine kinase; Provisional Back     alignment and domain information
>COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning] Back     alignment and domain information
>cd05155 APH_ChoK_like_1 Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members Back     alignment and domain information
>PRK10271 thiK thiamine kinase; Provisional Back     alignment and domain information
>cd05156 ChoK_euk Choline Kinase (ChoK) in eukaryotes Back     alignment and domain information
>cd05153 HomoserineK_II Homoserine Kinase, type II Back     alignment and domain information
>cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes Back     alignment and domain information
>PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A Back     alignment and domain information
>PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily Back     alignment and domain information
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH) Back     alignment and domain information
>KOG1093|consensus Back     alignment and domain information
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172 Back     alignment and domain information
>TIGR02721 ycfN_thiK thiamine kinase Back     alignment and domain information
>PF01633 Choline_kinase: Choline/ethanolamine kinase; InterPro: IPR002573 Choline kinase, (ATP:choline phosphotransferase, 2 Back     alignment and domain information
>TIGR02906 spore_CotS spore coat protein, CotS family Back     alignment and domain information
>PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>COG0510 ycfN Thiamine kinase and related kinases [Coenzyme transport and metabolism] Back     alignment and domain information
>PF13095 FTA2: Kinetochore Sim4 complex subunit FTA2 Back     alignment and domain information
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>smart00587 CHK ZnF_C4 abd HLH domain containing kinases domain Back     alignment and domain information
>COG2334 Putative homoserine kinase type II (protein kinase fold) [General function prediction only] Back     alignment and domain information
>TIGR02904 spore_ysxE spore coat protein YsxE Back     alignment and domain information
>PF07387 Seadorna_VP7: Seadornavirus VP7; InterPro: IPR009973 This family consists of several Seadornavirus specific VP7 proteins of around 305 residues in length Back     alignment and domain information
>PLN02236 choline kinase Back     alignment and domain information
>cd05152 MPH2' Macrolide 2'-Phosphotransferase (MPH2') Back     alignment and domain information
>PF05445 Pox_ser-thr_kin: Poxvirus serine/threonine protein kinase; InterPro: IPR008790 This family of proteins contain poxvirus serine/threonine protein kinases, which are essential for phosphorylation of virion proteins during virion assembly Back     alignment and domain information
>PHA03111 Ser/Thr kinase; Provisional Back     alignment and domain information
>PF12260 PIP49_C: Protein-kinase domain of FAM69; InterPro: IPR022049 Family with sequence similarity 69 has three members (A, B and C) Back     alignment and domain information
>KOG1235|consensus Back     alignment and domain information
>smart00326 SH3 Src homology 3 domains Back     alignment and domain information
>PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies Back     alignment and domain information
>PLN02421 phosphotransferase, alcohol group as acceptor/kinase Back     alignment and domain information
>PRK06148 hypothetical protein; Provisional Back     alignment and domain information
>KOG2268|consensus Back     alignment and domain information
>PRK11768 serine/threonine protein kinase; Provisional Back     alignment and domain information
>COG3173 Predicted aminoglycoside phosphotransferase [General function prediction only] Back     alignment and domain information
>COG5072 ALK1 Serine/threonine kinase of the haspin family [Cell division and chromosome partitioning] Back     alignment and domain information
>PF02958 EcKinase: Ecdysteroid kinase; InterPro: IPR004119 This family includes proteins of unknown function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
4hzs_A341 Crystal Structure Of Ack1 Kinase Domain With C-term 5e-54
1u46_A291 Crystal Structure Of The Unphosphorylated Kinase Do 6e-41
1u54_A291 Crystal Structures Of The Phosphorylated And Unphos 5e-40
3eqp_B276 Crystal Structure Of Ack1 With Compound T95 Length 5e-40
4hzr_A277 Crystal Structure Of Ack1 Kinase Domain Length = 27 1e-39
4id7_A273 Ack1 Kinase In Complex With The Inhibitor Cis-3-[8- 1e-39
4ewh_B275 Co-Crystal Structure Of Ack1 With Inhibitor Length 5e-39
2j0j_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 4e-24
2j0k_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 4e-24
3pxk_A282 Focal Adhesion Kinase Catalytic Domain In Complex W 6e-24
2etm_A281 Crystal Structure Of Focal Adhesion Kinase Domain C 6e-24
1mp8_A281 Crystal Structure Of Focal Adhesion Kinase (Fak) Le 7e-24
4ebw_A304 Structure Of Focal Adhesion Kinase Catalytic Domain 7e-24
2jkm_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 7e-24
2j0m_B276 Crystal Structure A Two-Chain Complex Between The F 7e-24
3bz3_A276 Crystal Structure Analysis Of Focal Adhesion Kinase 7e-24
2jkk_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 8e-24
2j0l_A276 Crystal Structure Of A The Active Conformation Of T 6e-23
2fo0_A495 Organization Of The Sh3-Sh2 Unit In Active And Inac 7e-23
1opk_A495 Structural Basis For The Auto-Inhibition Of C-Abl T 8e-23
1opl_A537 Structural Basis For The Auto-Inhibition Of C-Abl T 8e-23
2qoh_A288 Crystal Structure Of Abl Kinase Bound With Ppy-a Le 1e-22
2e2b_A293 Crystal Structure Of The C-Abl Kinase Domain In Com 1e-22
2hiw_A287 Crystal Structure Of Inactive Conformation Abl Kina 1e-22
1fpu_A293 Crystal Structure Of Abl Kinase Domain In Complex W 1e-22
2z60_A288 Crystal Structure Of The T315i Mutant Of Abl Kinase 1e-22
3oxz_A284 Crystal Structure Of Abl Kinase Domain Bound With A 1e-22
3pyy_A298 Discovery And Characterization Of A Cell-Permeable, 1e-22
3oy3_A284 Crystal Structure Of Abl T315i Mutant Kinase Domain 1e-22
2g1t_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 1e-22
4aoj_A329 Human Trka In Complex With The Inhibitor Az-23 Leng 1e-22
2hyy_A273 Human Abl Kinase Domain In Complex With Imatinib (S 2e-22
3qrj_A277 The Crystal Structure Of Human Abl1 Kinase Domain T 2e-22
3qri_A277 The Crystal Structure Of Human Abl1 Kinase Domain I 2e-22
2hz0_A270 Abl Kinase Domain In Complex With Nvp-Aeg082 Length 2e-22
2hzi_A277 Abl Kinase Domain In Complex With Pd180970 Length = 2e-22
4f0i_A300 Crystal Structure Of Apo Trka Length = 300 2e-22
4gt5_A306 Crystal Structure Of The Inactive Trka Kinase Domai 2e-22
3fzo_A277 Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosin 2e-22
4h1j_A293 Crystal Structure Of Pyk2 With The Pyrazole 13a Len 2e-22
3cc6_A281 Crystal Structure Of Kinase Domain Of Protein Tyros 2e-22
2f4j_A287 Structure Of The Kinase Domain Of An Imatinib-Resis 2e-22
2g2f_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 2e-22
3dk3_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 5e-22
1luf_A343 Crystal Structure Of The Musk Tyrosine Kinase: Insi 8e-22
3gvu_A292 The Crystal Structure Of Human Abl2 In Complex With 1e-21
2v7a_A286 Crystal Structure Of The T315i Abl Mutant In Comple 1e-21
2gqg_A278 X-Ray Crystal Structure Of Dasatinib (Bms-354825) B 1e-21
3dk7_A277 Crystal Structure Of Mutant Abl Kinase Domain In Co 2e-21
3dk6_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 2e-21
3v5q_A297 Discovery Of A Selective Trk Inhibitor With Efficac 3e-21
4asz_A299 Crystal Structure Of Apo Trkb Kinase Domain Length 3e-20
1mqb_A333 Crystal Structure Of Ephrin A2 (Epha2) Receptor Pro 4e-20
3bkb_A377 Crystal Structure Of Human Feline Sarcoma Viral Onc 4e-20
1qcf_A454 Crystal Structure Of Hck In Complex With A Src Fami 5e-20
2hk5_A270 Hck Kinase In Complex With Lck Targetted Inhibitor 5e-20
3mpm_A267 Lck Complexed With A Pyrazolopyrimidine Length = 26 7e-20
2og8_A265 Crystal Structure Of Aminoquinazoline 36 Bound To L 7e-20
2pl0_A289 Lck Bound To Imatinib Length = 289 9e-20
2ofv_A277 Crystal Structure Of Aminoquinazoline 1 Bound To Lc 9e-20
3bys_A277 Co-Crystal Structure Of Lck And Aminopyrimidine Ami 1e-19
2of2_A271 Crystal Structure Of Furanopyrimidine 8 Bound To Lc 1e-19
2gs7_A330 Crystal Structure Of The Inactive Egfr Kinase Domai 1e-19
4hjo_A337 Crystal Structure Of The Inactive Egfr Tyrosine Kin 1e-19
3lzb_A327 Egfr Kinase Domain Complexed With An Imidazo[2,1-B] 1e-19
2wqb_A324 Structure Of The Tie2 Kinase Domain In Complex With 2e-19
2oo8_X317 Synthesis, Structural Analysis, And Sar Studies Of 2e-19
3kul_A325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 2e-19
1fvr_A327 Tie2 Kinase Domain Length = 327 2e-19
4i20_A329 Crystal Structure Of Monomeric (v948r) Primary Onco 3e-19
4i1z_A329 Crystal Structure Of The Monomeric (v948r) Form Of 3e-19
3cd3_A377 Crystal Structure Of Phosphorylated Human Feline Sa 3e-19
3kul_B325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 4e-19
2pz5_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 6e-19
2q0b_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 6e-19
2pzp_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 6e-19
2pwl_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 6e-19
2psq_A370 Crystal Structure Of Unphosphorylated Unactivated W 6e-19
2pzr_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 6e-19
2py3_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 6e-19
3ri1_A313 Crystal Structure Of The Catalytic Domain Of Fgfr2 6e-19
3b2t_A311 Structure Of Phosphotransferase Length = 311 7e-19
1gjo_A316 The Fgfr2 Tyrosine Kinase Domain Length = 316 7e-19
2pvy_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 8e-19
3lvp_A336 Crystal Structure Of Bisphosphorylated Igf1-R Kinas 8e-19
2gs2_A330 Crystal Structure Of The Active Egfr Kinase Domain 8e-19
1m14_A333 Tyrosine Kinase Domain From Epidermal Growth Factor 8e-19
3kxz_A287 The Complex Crystal Structure Of Lck With A Probe M 8e-19
2eb2_A334 Crystal Structure Of Mutated Egfr Kinase Domain (G7 8e-19
2j5e_A327 Crystal Structure Of Egfr Kinase Domain In Complex 9e-19
2jiv_A328 Crystal Structure Of Egfr Kinase Domain T790m Mutat 9e-19
1xkk_A352 Egfr Kinase Domain Complexed With A Quinazoline Inh 9e-19
3vjo_A334 Crystal Structure Of The Wild-Type Egfr Kinase Doma 9e-19
3ug1_A334 Crystal Structure Of The Mutated Egfr Kinase Domain 9e-19
3qup_A323 Inhibitor Bound Structure Of The Kinase Domain Of T 9e-19
3bel_A315 X-Ray Structure Of Egfr In Complex With Oxime Inhib 9e-19
1jqh_A308 Igf-1 Receptor Kinase Domain Length = 308 9e-19
1qpe_A279 Structural Analysis Of The Lymphocyte-Specific Kina 9e-19
3lw0_A304 Igf-1rk In Complex With Ligand Msc1609119a-1 Length 9e-19
3o23_A305 Human Unphosphorylated Igf1-R Kinase Domain In Comp 9e-19
2rfd_A324 Crystal Structure Of The Complex Between The Egfr K 9e-19
2oj9_A307 Structure Of Igf-1r Kinase Domain Complexed With A 9e-19
2itn_A327 Crystal Structure Of Egfr Kinase Domain G719s Mutat 9e-19
2ofu_A273 X-Ray Crystal Structure Of 2-Aminopyrimidine Carbam 9e-19
3lck_A271 The Kinase Domain Of Human Lymphocyte Kinase (Lck), 9e-19
4g5j_A330 Crystal Structure Of Egfr Kinase In Complex With Bi 9e-19
3i81_A315 Crystal Structure Of Insulin-Like Growth Factor 1 R 9e-19
4i23_A329 Crystal Structure Of The Wild-type Egfr Kinase Doma 9e-19
3qqu_A301 Cocrystal Structure Of Unphosphorylated Igf With Py 9e-19
3kmm_A288 Structure Of Human Lck Kinase With A Small Molecule 9e-19
3pls_A298 Ron In Complex With Ligand Amp-Pnp Length = 298 9e-19
2zm1_A285 Crystal Structure Of Imidazo Pyrazin 1 Bound To The 9e-19
2j5f_A327 Crystal Structure Of Egfr Kinase Domain In Complex 9e-19
2jiu_A328 Crystal Structure Of Egfr Kinase Domain T790m Mutat 9e-19
4i24_A329 Structure Of T790m Egfr Kinase Domain Co-crystalliz 9e-19
3ika_A331 Crystal Structure Of Egfr 696-1022 T790m Mutant Cov 9e-19
2jit_A327 Crystal Structure Of Egfr Kinase Domain T790m Mutat 9e-19
3bym_A272 X-Ray Co-Crystal Structure Aminobenzimidazole Triaz 1e-18
4g5p_A330 Crystal Structure Of Egfr Kinase T790m In Complex W 1e-18
1m7n_A322 Crystal Structure Of Unactivated Apo Insulin-Like G 1e-18
1p4o_A322 Structure Of Apo Unactivated Igf-1r Kinase Domain A 1e-18
3eta_A317 Kinase Domain Of Insulin Receptor Complexed With A 1e-18
3tt0_A382 Co-Structure Of Fibroblast Growth Factor Receptor 1 1e-18
3gop_A361 Crystal Structure Of The Egf Receptor Juxtamembrane 1e-18
2rei_A318 Kinase Domain Of Human Ephrin Type-a Receptor 7 (ep 1e-18
1irk_A306 Crystal Structure Of The Tyrosine Kinase Domain Of 1e-18
4f63_A309 Crystal Structure Of Human Fibroblast Growth Factor 1e-18
3kxx_A317 Structure Of The Mutant Fibroblast Growth Factor Re 1e-18
3js2_A317 Crystal Structure Of Minimal Kinase Domain Of Fibro 1e-18
1fgk_A310 Crystal Structure Of The Tyrosine Kinase Domain Of 1e-18
3rhx_B306 Crystal Structure Of The Catalytic Domain Of Fgfr1 1e-18
3gql_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 1e-18
2y6m_A291 Crystal Structure Of Epha4 Kinase Domain Length = 2 1e-18
3c4f_A302 Fgfr Tyrosine Kinase Domain In Complex With 3-(3- M 1e-18
2hel_A306 Crystal Structure Of A Mutant Epha4 Kinase Domain ( 1e-18
2xyu_A285 Crystal Structure Of Epha4 Kinase Domain In Complex 1e-18
3ekk_A307 Insulin Receptor Kinase Complexed With An Inhibitor 1e-18
1p14_A306 Crystal Structure Of A Catalytic-Loop Mutant Of The 2e-18
2qok_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 2e-18
1qpd_A279 Structural Analysis Of The Lymphocyte-specific Kina 2e-18
2qon_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 2e-18
2qo7_A373 Human Epha3 Kinase And Juxtamembrane Region, Dephos 2e-18
3fxx_A371 Human Epha3 Kinase And Juxtamembrane Region Bound T 2e-18
2gsf_A373 The Human Epha3 Receptor Tyrosine Kinase And Juxtam 2e-18
2qoi_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 2e-18
2qof_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f 2e-18
2qod_A373 Human Epha3 Kinase And Juxtamembrane Region, Y602f 2e-18
2qoc_A344 Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp 2e-18
3w2o_A331 Egfr Kinase Domain T790m/l858r Mutant With Tak-285 2e-18
2eb3_A334 Crystal Structure Of Mutated Egfr Kinase Domain (L8 2e-18
2qoo_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 2e-18
4i21_A329 Crystal Structure Of L858r + T790m Egfr Kinase Doma 2e-18
2qob_A344 Human Epha3 Kinase Domain, Base Structure Length = 2e-18
2itt_A327 Crystal Structure Of Egfr Kinase Domain L858r Mutat 2e-18
3bbt_B328 Crystal Structure Of The Erbb4 Kinase In Complex Wi 2e-18
3dzq_A361 Human Epha3 Kinase Domain In Complex With Inhibitor 2e-18
2r4b_A321 Erbb4 Kinase Domain Complexed With A Thienopyrimidi 2e-18
2dq7_X283 Crystal Structure Of Fyn Kinase Domain Complexed Wi 2e-18
3d94_A301 Crystal Structure Of The Insulin-Like Growth Factor 3e-18
2qol_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596:y 3e-18
3pp0_A338 Crystal Structure Of The Kinase Domain Of Human Her 3e-18
3kex_A325 Crystal Structure Of The Catalytically Inactive Kin 4e-18
3lmg_A344 Crystal Structure Of The Erbb3 Kinase Domain In Com 4e-18
2pvf_A334 Crystal Structure Of Tyrosine Phosphorylated Activa 5e-18
3cly_A334 Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase 5e-18
2zm3_A308 Complex Structure Of Insulin-Like Growth Factor Rec 5e-18
2z8c_A303 Phosphorylated Insulin Receptor Tyrosine Kinase In 6e-18
1ir3_A306 Phosphorylated Insulin Receptor Tyrosine Kinase In 6e-18
1i44_A306 Crystallographic Studies Of An Activation Loop Muta 7e-18
3g0f_A336 Kit Kinase Domain Mutant D816h In Complex With Suni 8e-18
1rqq_A306 Crystal Structure Of The Insulin Receptor Kinase In 8e-18
3gqi_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 9e-18
2ivs_A314 Crystal Structure Of Non-Phosphorylated Ret Tyrosin 1e-17
3a4o_X286 Lyn Kinase Domain Length = 286 1e-17
3zzw_A289 Crystal Structure Of The Kinase Domain Of Ror2 Leng 1e-17
4gt4_A308 Structure Of Unliganded, Inactive Ror2 Kinase Domai 2e-17
1k3a_A299 Structure Of The Insulin-Like Growth Factor 1 Recep 2e-17
3oct_A265 Crystal Structure Of Bruton's Tyrosine Kinase Mutan 2e-17
2r2p_A295 Kinase Domain Of Human Ephrin Type-A Receptor 5 (Ep 2e-17
1k2p_A263 Crystal Structure Of Bruton's Tyrosine Kinase Domai 2e-17
3p08_A267 Crystal Structure Of The Human Btk Kinase Domain Le 3e-17
1t46_A313 Structural Basis For The Autoinhibition And Sti-571 3e-17
3pix_A274 Crystal Structure Of Btk Kinase Domain Complexed Wi 3e-17
3gen_A283 The 1.6 A Crystal Structure Of Human Bruton's Tyros 3e-17
3ocs_A271 Crystal Structure Of Bruton's Tyrosine Kinase In Co 3e-17
1t45_A331 Structural Basis For The Autoinhibition And Sti-571 3e-17
3sxr_A268 Crystal Structure Of Bmx Non-Receptor Tyrosine Kina 3e-17
3g0e_A336 Kit Kinase Domain In Complex With Sunitinib Length 3e-17
1pkg_A329 Structure Of A C-kit Kinase Product Complex Length 3e-17
2p0c_A313 Catalytic Domain Of The Proto-Oncogene Tyrosine-Pro 5e-17
2zv7_A279 Lyn Tyrosine Kinase Domain, Apo Form Length = 279 5e-17
1ad5_A438 Src Family Kinase Hck-Amp-Pnp Complex Length = 438 8e-17
1jpa_A312 Crystal Structure Of Unphosphorylated Ephb2 Recepto 1e-16
2hen_A286 Crystal Structure Of The Ephb2 Receptor Kinase Doma 1e-16
2ivt_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 1e-16
3geq_A286 Structural Basis For The Chemical Rescue Of Src Kin 1e-16
2oiq_A286 Crystal Structure Of Chicken C-Src Kinase Domain In 1e-16
3miy_A266 X-Ray Crystal Structure Of Itk Complexed With Sunit 1e-16
2ivv_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 1e-16
3oez_A286 Crystal Structure Of The L317i Mutant Of The Chicke 1e-16
3g6h_A286 Src Thr338ile Inhibited In The Dfg-Asp-Out Conforma 1e-16
3d7u_B277 Structural Basis For The Recognition Of C-Src By It 1e-16
3v5j_A266 Crystal Structure Of Interleukin-2 Inducible T-Cell 1e-16
2h8h_A535 Src Kinase In Complex With A Quinazoline Inhibitor 1e-16
1sm2_A264 Crystal Structure Of The Phosphorylated Interleukin 1e-16
3u4w_A275 Src In Complex With Dna-Templated Macrocyclic Inhib 1e-16
3svv_A286 Crystal Structure Of T338c C-Src Covalently Bound T 1e-16
2hwo_A286 Crystal Structure Of Src Kinase Domain In Complex W 1e-16
2qq7_A286 Crystal Structure Of Drug Resistant Src Kinase Doma 1e-16
1fmk_A452 Crystal Structure Of Human Tyrosine-Protein Kinase 1e-16
2ptk_A453 Chicken Src Tyrosine Kinase Length = 453 1e-16
1y57_A452 Structure Of Unphosphorylated C-Src In Complex With 1e-16
3qgw_A286 Crystal Structure Of Itk Kinase Bound To An Inhibit 2e-16
1ksw_A452 Structure Of Human C-Src Tyrosine Kinase (Thr338gly 2e-16
1yol_A283 Crystal Structure Of Src Kinase Domain In Complex W 2e-16
3t9t_A267 Crystal Structure Of Btk Mutant (F435t,K596r) Compl 2e-16
2bdf_A279 Src Kinase In Complex With Inhibitor Ap23451 Length 2e-16
4hct_A269 Crystal Structure Of Itk In Complex With Compound 5 2e-16
2rfn_A310 X-ray Structure Of C-met With Inhibitor. Length = 3 3e-16
3i5n_A309 Crystal Structure Of C-Met With Triazolopyridazine 3e-16
3q6u_A308 Structure Of The Apo Met Receptor Kinase In The Dua 3e-16
3f66_A298 Human C-Met Kinase In Complex With Quinoxaline Inhi 3e-16
2g15_A318 Structural Characterization Of Autoinhibited C-Met 3e-16
2wgj_A306 X-Ray Structure Of Pf-02341066 Bound To The Kinase 3e-16
3lq8_A302 Structure Of The Kinase Domain Of C-Met Bound To Xl 3e-16
4gg5_A319 Crystal Structure Of Cmet In Complex With Novel Inh 3e-16
2wd1_A292 Human C-Met Kinase In Complex With Azaindole Inhibi 3e-16
4aw5_A291 Complex Of The Ephb4 Kinase Domain With An Oxindole 3e-16
3hng_A360 Crystal Structure Of Vegfr1 In Complex With N-(4-ch 3e-16
3k54_A283 Structures Of Human Bruton's Tyrosine Kinase In Act 3e-16
2vwu_A302 Ephb4 Kinase Domain Inhibitor Complex Length = 302 3e-16
3srv_A277 Crystal Structure Of Spleen Tyrosine Kinase (Syk) I 5e-16
3bea_A333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A P 5e-16
2i1m_A333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An 6e-16
2ogv_A317 Crystal Structure Of The Autoinhibited Human C-Fms 6e-16
3lcd_A329 Inhibitor Bound To A Dfg-In Structure Of The Kinase 6e-16
2i0v_A335 C-Fms Tyrosine Kinase In Complex With A Quinolone I 6e-16
4fl3_A635 Structural And Biophysical Characterization Of The 7e-16
4fl2_A636 Structural And Biophysical Characterization Of The 7e-16
3lco_A324 Inhibitor Bound To A Dfg-Out Structure Of The Kinas 7e-16
4f4p_A273 Syk In Complex With Ligand Lasw836 Length = 273 7e-16
4dfl_A274 Crystal Structure Of Spleen Tyrosine Kinase Complex 7e-16
3srv_B277 Crystal Structure Of Spleen Tyrosine Kinase (Syk) I 7e-16
3emg_A291 Discovery And Sar Of Novel 4-Thiazolyl-2- Phenylami 7e-16
3tub_A293 Crystal Structure Of Syk Kinase Domain With 1-(5-(6 8e-16
3vf8_A299 Crystal Structure Of Spleen Tyrosine Kinase Syk Cat 8e-16
1xba_A291 Crystal Structure Of Apo Syk Tyrosine Kinase Domain 8e-16
4hvd_A314 Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h 9e-16
1yoj_A283 Crystal Structure Of Src Kinase Domain Length = 283 9e-16
3dqw_A286 C-Src Kinase Domain Thr338ile Mutant In Complex Wit 1e-15
1r0p_A312 Crystal Structure Of The Tyrosine Kinase Domain Of 1e-15
3a4p_A319 Human C-Met Kinase Domain Complexed With 6-Benzylox 1e-15
4fob_A353 Crystal Structure Of Human Anaplastic Lymphoma Kina 1e-15
4dce_A333 Crystal Structure Of Human Anaplastic Lymphoma Kina 1e-15
3cth_A314 Crystal Structure Of The Tyrosine Kinase Domain Of 1e-15
4fnz_A327 Crystal Structure Of Human Anaplastic Lymphoma Kina 1e-15
4fnw_A327 Crystal Structure Of The Apo F1174l Anaplastic Lymp 1e-15
3qti_A314 C-Met Kinase In Complex With Nvp-Bvu972 Length = 31 1e-15
3dkc_A317 Sgx Clone 5698a65kfg1h1 Length = 317 1e-15
3q6w_A307 Structure Of Dually-phosphorylated Met Receptor Kin 1e-15
3l9p_A367 Crystal Structure Of The Anaplastic Lymphoma Kinase 1e-15
3dkg_A317 Sgx Clone 5698a109kfg1h1 Length = 317 1e-15
3lct_A344 Crystal Structure Of The Anaplastic Lymphoma Kinase 1e-15
3c1x_A373 Crystal Structure Of The Tyrosine Kinase Domain Of 1e-15
3aox_A344 X-Ray Crystal Structure Of Human Anaplastic Lymphom 1e-15
2yhv_A342 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 2e-15
2yjs_A342 Structure Of C1156y Mutant Anaplastic Lymphoma Kina 2e-15
2yjr_A342 Structure Of F1174l Mutant Anaplastic Lymphoma Kina 2e-15
1yi6_A276 C-Term Tail Segment Of Human Tyrosine Kinase (258-5 2e-15
2yfx_A327 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 2e-15
2xb7_A315 Structure Of Human Anaplastic Lymphoma Kinase In Co 2e-15
2xp2_A327 Structure Of The Human Anaplastic Lymphoma Kinase I 2e-15
3lxk_A327 Structural And Thermodynamic Characterization Of Th 2e-15
1k9a_A450 Crystal Structure Analysis Of Full-Length Carboxyl- 4e-15
3cjf_A309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 5e-15
4fnx_A327 Crystal Structure Of The Apo R1275q Anaplastic Lymp 5e-15
3pjc_A315 Crystal Structure Of Jak3 Complexed With A Potent A 6e-15
1byg_A278 Kinase Domain Of Human C-Terminal Src Kinase (Csk) 6e-15
3ugc_A295 Structural Basis Of Jak2 Inhibition By The Type Ii 6e-15
3d7u_A263 Structural Basis For The Recognition Of C-Src By It 6e-15
4bbe_A298 Aminoalkylpyrimidine Inhibitor Complexes With Jak2 6e-15
3lxn_A318 Structural And Thermodynamic Characterization Of Th 7e-15
3q32_A301 Structure Of Janus Kinase 2 With A Pyrrolotriazine 8e-15
3lpb_A295 Crystal Structure Of Jak2 Complexed With A Potent 2 8e-15
3tjc_A298 Co-Crystal Structure Of Jak2 With Thienopyridine 8 8e-15
2xa4_A298 Inhibitors Of Jak2 Kinase Domain Length = 298 8e-15
3e62_A293 Fragment Based Discovery Of Jak-2 Inhibitors Length 8e-15
3jy9_A311 Janus Kinase 2 Inhibitors Length = 311 8e-15
3io7_A313 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Sel 8e-15
4hge_A300 Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 8e-15
2b7a_A293 The Structural Basis Of Janus Kinase 2 Inhibition B 9e-15
4e4m_A302 Jak2 Kinase (Jh1 Domain) In Complex With Compound 3 9e-15
3rvg_A303 Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido 9e-15
4e6d_A298 Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex W 9e-15
4aqc_A301 Triazolopyridine-Based Inhibitor Of Janus Kinase 2 9e-15
1u59_A287 Crystal Structure Of The Zap-70 Kinase Domain In Co 9e-15
2w1i_A326 Structure Determination Of Aurora Kinase In Complex 9e-15
2ozo_A613 Autoinhibited Intact Human Zap-70 Length = 613 1e-14
3nyx_A302 Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-T 1e-14
3nz0_A302 Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 3 1e-14
3d7t_A269 Structural Basis For The Recognition Of C-Src By It 1e-14
1y6a_A366 Crystal Structure Of Vegfr2 In Complex With A 2-Ani 1e-14
3vhk_A368 Crystal Structure Of The Vegfr2 Kinase Domain In Co 1e-14
3vid_A356 Crystal Structure Of Human Vegfr2 Kinase Domain Wit 2e-14
3vhe_A359 Crystal Structure Of Human Vegfr2 Kinase Domain Wit 2e-14
3cjg_A309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 2e-14
4agc_A353 Crystal Structure Of Vegfr2 (Juxtamembrane And Kina 2e-14
3vnt_A318 Crystal Structure Of The Kinase Domain Of Human Veg 2e-14
3ewh_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 2e-14
3u6j_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 2e-14
2xir_A316 Crystal Structure Of The Vegfr2 Kinase Domain In Co 2e-14
4e20_A290 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 2e-14
4e1z_A291 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 2e-14
1yvj_A290 Crystal Structure Of The Jak3 Kinase Domain In Comp 5e-14
3c7q_A316 Structure Of Vegfr2 Kinase Domain In Complex With B 1e-13
2oh4_A316 Crystal Structure Of Vegfr2 With A Benzimidazole-Ur 1e-13
1ywn_A316 Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]p 1e-13
2p2i_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 1e-13
2p2h_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 1e-13
1rjb_A344 Crystal Structure Of Flt3 Length = 344 1e-13
1vr2_A316 Human Vascular Endothelial Growth Factor Receptor 2 2e-13
4e4l_A302 Jak1 Kinase (Jh1 Domain) In Complex With Compound 3 5e-13
3eyg_A290 Crystal Structures Of Jak1 And Jak2 Inhibitor Compl 5e-13
3dtc_A271 Crystal Structure Of Mixed-Lineage Kinase Mlk1 Comp 2e-12
3p86_A309 Crystal Structure Of Ctr1 Kinase Domain Mutant D676 7e-11
3ppz_A309 Crystal Structure Of Ctr1 Kinase Domain In Complex 1e-10
3kmw_A271 Crystal Structure Of The IlkALPHA-Parvin Core Compl 2e-07
4fvp_A289 Crystal Structure Of The Jak2 Pseudokinase Domain ( 5e-07
4fvr_A289 Crystal Structure Of The Jak2 Pseudokinase Domain M 6e-07
3kmu_A271 Crystal Structure Of The IlkALPHA-Parvin Core Compl 1e-05
4gs6_A315 Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxoz 6e-05
2eva_A307 Structural Basis For The Interaction Of Tak1 Kinase 6e-05
4f0f_A287 Crystal Structure Of The Roco4 Kinase Domain Bound 1e-04
4f1m_A287 Crystal Structure Of The G1179s Roco4 Kinase Domain 1e-04
4f1o_A287 Crystal Structure Of The L1180t Mutant Roco4 Kinase 1e-04
>pdb|4HZS|A Chain A, Crystal Structure Of Ack1 Kinase Domain With C-terminal Sh3 Domain Length = 341 Back     alignment and structure

Iteration: 1

Score = 207 bits (527), Expect = 5e-54, Method: Compositional matrix adjust. Identities = 97/178 (54%), Positives = 120/178 (67%), Gaps = 5/178 (2%) Query: 61 GDFGMMRY--SQNDCYVMTERKPLPCPWCPMESLKHNQFSQASDAWMFGVTIWEMFTFGA 118 GDFG+MR +D YVM E + +P WC ESLK FS ASD WMFGVT+WEMFT+G Sbjct: 157 GDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQ 216 Query: 119 EPWVGLNGMQILQKIDREGERLPRPEACPVEVYALMRQCWSKNPAERPKFSTLKDCLYRL 178 EPW+GLNG QIL KID+EGERLPRPE CP ++Y +M QCW+ P +RP F L+D L Sbjct: 217 EPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEA 276 Query: 179 TPAVMKATQNCHEIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIM 236 P M+A Q+ E D KL+I D I +IEG E +WW+GQN T +G FPRN++ Sbjct: 277 QPTDMRALQDFEEPD---KLHIQMNDVITVIEGRAENYWWRGQNTRTLCVGPFPRNVV 331
>pdb|1U46|A Chain A, Crystal Structure Of The Unphosphorylated Kinase Domain Of The Tyrosine Kinase Ack1 Length = 291 Back     alignment and structure
>pdb|1U54|A Chain A, Crystal Structures Of The Phosphorylated And Unphosphorylated Kinase Domains Of The Cdc42-Associated Tyrosine Kinase Ack1 Bound To Amp-Pcp Length = 291 Back     alignment and structure
>pdb|3EQP|B Chain B, Crystal Structure Of Ack1 With Compound T95 Length = 276 Back     alignment and structure
>pdb|4HZR|A Chain A, Crystal Structure Of Ack1 Kinase Domain Length = 277 Back     alignment and structure
>pdb|4ID7|A Chain A, Ack1 Kinase In Complex With The Inhibitor Cis-3-[8-amino-1-(4- Phenoxyphenyl)imidazo[1,5-a]pyrazin-3-yl]cyclobutanol Length = 273 Back     alignment and structure
>pdb|4EWH|B Chain B, Co-Crystal Structure Of Ack1 With Inhibitor Length = 275 Back     alignment and structure
>pdb|2J0J|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains Length = 656 Back     alignment and structure
>pdb|2J0K|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains. Length = 656 Back     alignment and structure
>pdb|3PXK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Pyrrolo[2,3- D]thiazole Length = 282 Back     alignment and structure
>pdb|2ETM|A Chain A, Crystal Structure Of Focal Adhesion Kinase Domain Complexed With 7h-Pyrrolo [2,3-D] Pyrimidine Derivative Length = 281 Back     alignment and structure
>pdb|1MP8|A Chain A, Crystal Structure Of Focal Adhesion Kinase (Fak) Length = 281 Back     alignment and structure
>pdb|4EBW|A Chain A, Structure Of Focal Adhesion Kinase Catalytic Domain In Complex With Novel Allosteric Inhibitor Length = 304 Back     alignment and structure
>pdb|2JKM|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|2J0M|B Chain B, Crystal Structure A Two-Chain Complex Between The Ferm And Kinase Domains Of Focal Adhesion Kinase. Length = 276 Back     alignment and structure
>pdb|3BZ3|A Chain A, Crystal Structure Analysis Of Focal Adhesion Kinase With A Methanesulfonamide Diaminopyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|2JKK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|2J0L|A Chain A, Crystal Structure Of A The Active Conformation Of The Kinase Domain Of Focal Adhesion Kinase With A Phosphorylated Activation Loop Length = 276 Back     alignment and structure
>pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 Back     alignment and structure
>pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 Back     alignment and structure
>pdb|2QOH|A Chain A, Crystal Structure Of Abl Kinase Bound With Ppy-a Length = 288 Back     alignment and structure
>pdb|2E2B|A Chain A, Crystal Structure Of The C-Abl Kinase Domain In Complex With Inno-406 Length = 293 Back     alignment and structure
>pdb|2HIW|A Chain A, Crystal Structure Of Inactive Conformation Abl Kinase Catalytic Domain Complexed With Type Ii Inhibitor Length = 287 Back     alignment and structure
>pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase Domain In Complex With A Small Molecule Inhibitor Length = 293 Back     alignment and structure
>pdb|2Z60|A Chain A, Crystal Structure Of The T315i Mutant Of Abl Kinase Bound With Ppy-A Length = 288 Back     alignment and structure
>pdb|3OXZ|A Chain A, Crystal Structure Of Abl Kinase Domain Bound With A Dfg-Out Inhibitor Ap24534 Length = 284 Back     alignment and structure
>pdb|3PYY|A Chain A, Discovery And Characterization Of A Cell-Permeable, Small-Molecule C- Abl Kinase Activator That Binds To The Myristoyl Binding Site Length = 298 Back     alignment and structure
>pdb|3OY3|A Chain A, Crystal Structure Of Abl T315i Mutant Kinase Domain Bound With A Dfg- Out Inhibitor Ap24589 Length = 284 Back     alignment and structure
>pdb|2G1T|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|4AOJ|A Chain A, Human Trka In Complex With The Inhibitor Az-23 Length = 329 Back     alignment and structure
>pdb|2HYY|A Chain A, Human Abl Kinase Domain In Complex With Imatinib (Sti571, Glivec) Length = 273 Back     alignment and structure
>pdb|3QRJ|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain T315i Mutant In Complex With Dcc-2036 Length = 277 Back     alignment and structure
>pdb|3QRI|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain In Complex With Dcc- 2036 Length = 277 Back     alignment and structure
>pdb|2HZ0|A Chain A, Abl Kinase Domain In Complex With Nvp-Aeg082 Length = 270 Back     alignment and structure
>pdb|2HZI|A Chain A, Abl Kinase Domain In Complex With Pd180970 Length = 277 Back     alignment and structure
>pdb|4F0I|A Chain A, Crystal Structure Of Apo Trka Length = 300 Back     alignment and structure
>pdb|4GT5|A Chain A, Crystal Structure Of The Inactive Trka Kinase Domain Length = 306 Back     alignment and structure
>pdb|3FZO|A Chain A, Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosine Kinase Length = 277 Back     alignment and structure
>pdb|4H1J|A Chain A, Crystal Structure Of Pyk2 With The Pyrazole 13a Length = 293 Back     alignment and structure
>pdb|3CC6|A Chain A, Crystal Structure Of Kinase Domain Of Protein Tyrosine Kinase 2 Beta (ptk2b) Length = 281 Back     alignment and structure
>pdb|2F4J|A Chain A, Structure Of The Kinase Domain Of An Imatinib-Resistant Abl Mutant In Complex With The Aurora Kinase Inhibitor Vx-680 Length = 287 Back     alignment and structure
>pdb|2G2F|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|3DK3|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|1LUF|A Chain A, Crystal Structure Of The Musk Tyrosine Kinase: Insights Into Receptor Autoregulation Length = 343 Back     alignment and structure
>pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 Back     alignment and structure
>pdb|2V7A|A Chain A, Crystal Structure Of The T315i Abl Mutant In Complex With The Inhibitor Pha-739358 Length = 286 Back     alignment and structure
>pdb|2GQG|A Chain A, X-Ray Crystal Structure Of Dasatinib (Bms-354825) Bound To Activated Abl Kinase Domain Length = 278 Back     alignment and structure
>pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 Back     alignment and structure
>pdb|3DK6|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|3V5Q|A Chain A, Discovery Of A Selective Trk Inhibitor With Efficacy In Rodent Cancer Tumor Models Length = 297 Back     alignment and structure
>pdb|4ASZ|A Chain A, Crystal Structure Of Apo Trkb Kinase Domain Length = 299 Back     alignment and structure
>pdb|1MQB|A Chain A, Crystal Structure Of Ephrin A2 (Epha2) Receptor Protein Kinase Length = 333 Back     alignment and structure
>pdb|3BKB|A Chain A, Crystal Structure Of Human Feline Sarcoma Viral Oncogene Homologue (V- Fes) Length = 377 Back     alignment and structure
>pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 Back     alignment and structure
>pdb|2HK5|A Chain A, Hck Kinase In Complex With Lck Targetted Inhibitor Pg- 1009247 Length = 270 Back     alignment and structure
>pdb|3MPM|A Chain A, Lck Complexed With A Pyrazolopyrimidine Length = 267 Back     alignment and structure
>pdb|2OG8|A Chain A, Crystal Structure Of Aminoquinazoline 36 Bound To Lck Length = 265 Back     alignment and structure
>pdb|2PL0|A Chain A, Lck Bound To Imatinib Length = 289 Back     alignment and structure
>pdb|2OFV|A Chain A, Crystal Structure Of Aminoquinazoline 1 Bound To Lck Length = 277 Back     alignment and structure
>pdb|3BYS|A Chain A, Co-Crystal Structure Of Lck And Aminopyrimidine Amide 10b Length = 277 Back     alignment and structure
>pdb|2OF2|A Chain A, Crystal Structure Of Furanopyrimidine 8 Bound To Lck Length = 271 Back     alignment and structure
>pdb|2GS7|A Chain A, Crystal Structure Of The Inactive Egfr Kinase Domain In Complex With Amp-Pnp Length = 330 Back     alignment and structure
>pdb|4HJO|A Chain A, Crystal Structure Of The Inactive Egfr Tyrosine Kinase Domain With Erlotinib Length = 337 Back     alignment and structure
>pdb|3LZB|A Chain A, Egfr Kinase Domain Complexed With An Imidazo[2,1-B]thiazole Inhibitor Length = 327 Back     alignment and structure
>pdb|2WQB|A Chain A, Structure Of The Tie2 Kinase Domain In Complex With A Thiazolopyrimidine Inhibitor Length = 324 Back     alignment and structure
>pdb|2OO8|X Chain X, Synthesis, Structural Analysis, And Sar Studies Of Triazine Derivatives As Potent, Selective Tie-2 Inhibitors Length = 317 Back     alignment and structure
>pdb|3KUL|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|1FVR|A Chain A, Tie2 Kinase Domain Length = 327 Back     alignment and structure
>pdb|4I20|A Chain A, Crystal Structure Of Monomeric (v948r) Primary Oncogenic Mutant L858r Egfr Kinase Domain Length = 329 Back     alignment and structure
>pdb|4I1Z|A Chain A, Crystal Structure Of The Monomeric (v948r) Form Of The Gefitinib/erlotinib Resistant Egfr Kinase Domain L858r+t790m Length = 329 Back     alignment and structure
>pdb|3CD3|A Chain A, Crystal Structure Of Phosphorylated Human Feline Sarcoma Viral Oncogene Homologue (V-Fes) In Complex With Staurosporine And A Consensus Peptide Length = 377 Back     alignment and structure
>pdb|3KUL|B Chain B, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|2PZ5|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549t Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2Q0B|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565a Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2PZP|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K526e Mutation Responsible For Crouzon Syndrome Length = 324 Back     alignment and structure
>pdb|2PWL|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549h Mutation Responsible For Crouzon Syndrome. Length = 324 Back     alignment and structure
>pdb|2PSQ|A Chain A, Crystal Structure Of Unphosphorylated Unactivated Wild Type Fgf Receptor 2 (Fgfr2) Kinase Domain Length = 370 Back     alignment and structure
>pdb|2PZR|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K641r Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2PY3|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565g Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|3RI1|A Chain A, Crystal Structure Of The Catalytic Domain Of Fgfr2 Kinase In Complex With Arq 069 Length = 313 Back     alignment and structure
>pdb|3B2T|A Chain A, Structure Of Phosphotransferase Length = 311 Back     alignment and structure
>pdb|1GJO|A Chain A, The Fgfr2 Tyrosine Kinase Domain Length = 316 Back     alignment and structure
>pdb|2PVY|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K659n Mutation Responsible For An Unclassified Craniosynostosis Syndrome. Length = 324 Back     alignment and structure
>pdb|3LVP|A Chain A, Crystal Structure Of Bisphosphorylated Igf1-R Kinase Domain (2p) In Complex With A Bis-Azaindole Inhibitor Length = 336 Back     alignment and structure
>pdb|2GS2|A Chain A, Crystal Structure Of The Active Egfr Kinase Domain Length = 330 Back     alignment and structure
>pdb|1M14|A Chain A, Tyrosine Kinase Domain From Epidermal Growth Factor Receptor Length = 333 Back     alignment and structure
>pdb|3KXZ|A Chain A, The Complex Crystal Structure Of Lck With A Probe Molecule W259 Length = 287 Back     alignment and structure
>pdb|2EB2|A Chain A, Crystal Structure Of Mutated Egfr Kinase Domain (G719s) Length = 334 Back     alignment and structure
>pdb|2J5E|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 13-Jab Length = 327 Back     alignment and structure
>pdb|2JIV|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Compex With Hki-272 Length = 328 Back     alignment and structure
>pdb|1XKK|A Chain A, Egfr Kinase Domain Complexed With A Quinazoline Inhibitor- Gw572016 Length = 352 Back     alignment and structure
>pdb|3VJO|A Chain A, Crystal Structure Of The Wild-Type Egfr Kinase Domain In Complex With Amppnp Length = 334 Back     alignment and structure
>pdb|3UG1|A Chain A, Crystal Structure Of The Mutated Egfr Kinase Domain (G719sT790M) IN The Apo Form Length = 334 Back     alignment and structure
>pdb|3QUP|A Chain A, Inhibitor Bound Structure Of The Kinase Domain Of The Murine Receptor Tyrosine Kinase Tyro3 (Sky) Length = 323 Back     alignment and structure
>pdb|3BEL|A Chain A, X-Ray Structure Of Egfr In Complex With Oxime Inhibitor Length = 315 Back     alignment and structure
>pdb|1JQH|A Chain A, Igf-1 Receptor Kinase Domain Length = 308 Back     alignment and structure
>pdb|1QPE|A Chain A, Structural Analysis Of The Lymphocyte-Specific Kinase Lck In Complex With Non-Selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|3LW0|A Chain A, Igf-1rk In Complex With Ligand Msc1609119a-1 Length = 304 Back     alignment and structure
>pdb|3O23|A Chain A, Human Unphosphorylated Igf1-R Kinase Domain In Complex With An Hydantoin Inhibitor Length = 305 Back     alignment and structure
>pdb|2RFD|A Chain A, Crystal Structure Of The Complex Between The Egfr Kinase Domain And A Mig6 Peptide Length = 324 Back     alignment and structure
>pdb|2OJ9|A Chain A, Structure Of Igf-1r Kinase Domain Complexed With A Benzimidazole Inhibitor Length = 307 Back     alignment and structure
>pdb|2ITN|A Chain A, Crystal Structure Of Egfr Kinase Domain G719s Mutation In Complex With Amp-Pnp Length = 327 Back     alignment and structure
>pdb|2OFU|A Chain A, X-Ray Crystal Structure Of 2-Aminopyrimidine Carbamate 43 Bound To Lck Length = 273 Back     alignment and structure
>pdb|3LCK|A Chain A, The Kinase Domain Of Human Lymphocyte Kinase (Lck), Activated Form (Auto-Phosphorylated On Tyr394) Length = 271 Back     alignment and structure
>pdb|4G5J|A Chain A, Crystal Structure Of Egfr Kinase In Complex With Bibw2992 Length = 330 Back     alignment and structure
>pdb|3I81|A Chain A, Crystal Structure Of Insulin-Like Growth Factor 1 Receptor (Igf-1r-Wt) Complex With Bms-754807 [1-(4-((5-Cyclopropyl- 1h-Pyrazol-3-Yl)amino)pyrrolo[2,1-F][1,2, 4]triazin-2-Yl)-N- (6-Fluoro-3-Pyridinyl)-2-Methyl-L-Prolinamide] Length = 315 Back     alignment and structure
>pdb|4I23|A Chain A, Crystal Structure Of The Wild-type Egfr Kinase Domain In Complex With Dacomitinib (soaked) Length = 329 Back     alignment and structure
>pdb|3QQU|A Chain A, Cocrystal Structure Of Unphosphorylated Igf With Pyrimidine 8 Length = 301 Back     alignment and structure
>pdb|3KMM|A Chain A, Structure Of Human Lck Kinase With A Small Molecule Inhibitor Length = 288 Back     alignment and structure
>pdb|3PLS|A Chain A, Ron In Complex With Ligand Amp-Pnp Length = 298 Back     alignment and structure
>pdb|2ZM1|A Chain A, Crystal Structure Of Imidazo Pyrazin 1 Bound To The Kinase Domain Of Human Lck, (Auto-Phosphorylated On Tyr394) Length = 285 Back     alignment and structure
>pdb|2J5F|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 34-Jab Length = 327 Back     alignment and structure
>pdb|2JIU|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Complex With Aee788 Length = 328 Back     alignment and structure
>pdb|4I24|A Chain A, Structure Of T790m Egfr Kinase Domain Co-crystallized With Dacomitinib Length = 329 Back     alignment and structure
>pdb|3IKA|A Chain A, Crystal Structure Of Egfr 696-1022 T790m Mutant Covalently Binding To Wz4002 Length = 331 Back     alignment and structure
>pdb|2JIT|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation Length = 327 Back     alignment and structure
>pdb|3BYM|A Chain A, X-Ray Co-Crystal Structure Aminobenzimidazole Triazine 1 Bound To Lck Length = 272 Back     alignment and structure
>pdb|4G5P|A Chain A, Crystal Structure Of Egfr Kinase T790m In Complex With Bibw2992 Length = 330 Back     alignment and structure
>pdb|1M7N|A Chain A, Crystal Structure Of Unactivated Apo Insulin-Like Growth Factor-1 Receptor Kinase Domain Length = 322 Back     alignment and structure
>pdb|1P4O|A Chain A, Structure Of Apo Unactivated Igf-1r Kinase Domain At 1.5a Resolution. Length = 322 Back     alignment and structure
>pdb|3ETA|A Chain A, Kinase Domain Of Insulin Receptor Complexed With A Pyrrolo Pyridine Inhibitor Length = 317 Back     alignment and structure
>pdb|3TT0|A Chain A, Co-Structure Of Fibroblast Growth Factor Receptor 1 Kinase Domain With 3-(2,6-Dichloro-3, 5-Dimethoxy-Phenyl)-1-{6-[4-(4-Ethyl-Piperazin-1- Yl)-Phenylamino]-Pyrimidin-4-Yl}-1-Methyl-Urea (Bgj398) Length = 382 Back     alignment and structure
>pdb|3GOP|A Chain A, Crystal Structure Of The Egf Receptor Juxtamembrane And Kinase Domains Length = 361 Back     alignment and structure
>pdb|2REI|A Chain A, Kinase Domain Of Human Ephrin Type-a Receptor 7 (epha7) Length = 318 Back     alignment and structure
>pdb|1IRK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Human Insulin Receptor Length = 306 Back     alignment and structure
>pdb|4F63|A Chain A, Crystal Structure Of Human Fibroblast Growth Factor Receptor 1 Kinase Domain In Complex With Compound 1 Length = 309 Back     alignment and structure
>pdb|3KXX|A Chain A, Structure Of The Mutant Fibroblast Growth Factor Receptor 1 Length = 317 Back     alignment and structure
>pdb|3JS2|A Chain A, Crystal Structure Of Minimal Kinase Domain Of Fibroblast Growth Factor Receptor 1 In Complex With 5-(2-Thienyl) Nicotinic Acid Length = 317 Back     alignment and structure
>pdb|1FGK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of Fibroblast Growth Factor Receptor 1 Length = 310 Back     alignment and structure
>pdb|3RHX|B Chain B, Crystal Structure Of The Catalytic Domain Of Fgfr1 Kinase In Complex With Arq 069 Length = 306 Back     alignment and structure
>pdb|3GQL|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|2Y6M|A Chain A, Crystal Structure Of Epha4 Kinase Domain Length = 291 Back     alignment and structure
>pdb|3C4F|A Chain A, Fgfr Tyrosine Kinase Domain In Complex With 3-(3- Methoxybenzyl)-7-Azaindole Length = 302 Back     alignment and structure
>pdb|2HEL|A Chain A, Crystal Structure Of A Mutant Epha4 Kinase Domain (Y742a) Length = 306 Back     alignment and structure
>pdb|2XYU|A Chain A, Crystal Structure Of Epha4 Kinase Domain In Complex With Vuf 12058 Length = 285 Back     alignment and structure
>pdb|3EKK|A Chain A, Insulin Receptor Kinase Complexed With An Inhibitor Length = 307 Back     alignment and structure
>pdb|1P14|A Chain A, Crystal Structure Of A Catalytic-Loop Mutant Of The Insulin Receptor Tyrosine Kinase Length = 306 Back     alignment and structure
>pdb|2QOK|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:s768a Triple Mutant Length = 373 Back     alignment and structure
>pdb|1QPD|A Chain A, Structural Analysis Of The Lymphocyte-specific Kinase Lck In Complex With Non-selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|2QON|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742a Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QO7|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Dephosphorylated, Amp-Pnp Bound Length = 373 Back     alignment and structure
>pdb|3FXX|A Chain A, Human Epha3 Kinase And Juxtamembrane Region Bound To Substrate Kqwdnye[ptyr]iw Length = 371 Back     alignment and structure
>pdb|2GSF|A Chain A, The Human Epha3 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 373 Back     alignment and structure
>pdb|2QOI|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f Double Mutant Length = 373 Back     alignment and structure
>pdb|2QOF|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f Mutant Length = 373 Back     alignment and structure
>pdb|2QOD|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y602f Mutant Length = 373 Back     alignment and structure
>pdb|2QOC|A Chain A, Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp Bound Structure Length = 344 Back     alignment and structure
>pdb|3W2O|A Chain A, Egfr Kinase Domain T790m/l858r Mutant With Tak-285 Length = 331 Back     alignment and structure
>pdb|2EB3|A Chain A, Crystal Structure Of Mutated Egfr Kinase Domain (L858r) In Complex With Amppnp Length = 334 Back     alignment and structure
>pdb|2QOO|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742f Triple Mutant Length = 373 Back     alignment and structure
>pdb|4I21|A Chain A, Crystal Structure Of L858r + T790m Egfr Kinase Domain In Complex With Mig6 Peptide Length = 329 Back     alignment and structure
>pdb|2QOB|A Chain A, Human Epha3 Kinase Domain, Base Structure Length = 344 Back     alignment and structure
>pdb|2ITT|A Chain A, Crystal Structure Of Egfr Kinase Domain L858r Mutation In Complex With Aee788 Length = 327 Back     alignment and structure
>pdb|3BBT|B Chain B, Crystal Structure Of The Erbb4 Kinase In Complex With Lapatinib Length = 328 Back     alignment and structure
>pdb|3DZQ|A Chain A, Human Epha3 Kinase Domain In Complex With Inhibitor Awl-Ii- 38.3 Length = 361 Back     alignment and structure
>pdb|2R4B|A Chain A, Erbb4 Kinase Domain Complexed With A Thienopyrimidine Inhibitor Length = 321 Back     alignment and structure
>pdb|2DQ7|X Chain X, Crystal Structure Of Fyn Kinase Domain Complexed With Staurosporine Length = 283 Back     alignment and structure
>pdb|3D94|A Chain A, Crystal Structure Of The Insulin-Like Growth Factor-1 Receptor Kinase In Complex With Pqip Length = 301 Back     alignment and structure
>pdb|2QOL|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596:y602:s768g Triple Mutant Length = 373 Back     alignment and structure
>pdb|3PP0|A Chain A, Crystal Structure Of The Kinase Domain Of Human Her2 (Erbb2). Length = 338 Back     alignment and structure
>pdb|3KEX|A Chain A, Crystal Structure Of The Catalytically Inactive Kinase Domain Of The Human Epidermal Growth Factor Receptor 3 (Her3) Length = 325 Back     alignment and structure
>pdb|3LMG|A Chain A, Crystal Structure Of The Erbb3 Kinase Domain In Complex With Amp-Pnp Length = 344 Back     alignment and structure
>pdb|2PVF|A Chain A, Crystal Structure Of Tyrosine Phosphorylated Activated Fgf Receptor 2 (Fgfr2) Kinase Domain In Complex With Atp Analog And Substrate Peptide Length = 334 Back     alignment and structure
>pdb|3CLY|A Chain A, Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase Domains Trapped In Trans-Phosphorylation Reaction Length = 334 Back     alignment and structure
>pdb|2ZM3|A Chain A, Complex Structure Of Insulin-Like Growth Factor Receptor And Isoquinolinedione Inhibitor Length = 308 Back     alignment and structure
>pdb|2Z8C|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin-2- Yl]amino}phenyl)acetic Acid Length = 303 Back     alignment and structure
>pdb|1IR3|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With Peptide Substrate And Atp Analog Length = 306 Back     alignment and structure
>pdb|1I44|A Chain A, Crystallographic Studies Of An Activation Loop Mutant Of The Insulin Receptor Tyrosine Kinase Length = 306 Back     alignment and structure
>pdb|3G0F|A Chain A, Kit Kinase Domain Mutant D816h In Complex With Sunitinib Length = 336 Back     alignment and structure
>pdb|1RQQ|A Chain A, Crystal Structure Of The Insulin Receptor Kinase In Complex With The Sh2 Domain Of Aps Length = 306 Back     alignment and structure
>pdb|3GQI|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|2IVS|A Chain A, Crystal Structure Of Non-Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|3A4O|X Chain X, Lyn Kinase Domain Length = 286 Back     alignment and structure
>pdb|3ZZW|A Chain A, Crystal Structure Of The Kinase Domain Of Ror2 Length = 289 Back     alignment and structure
>pdb|4GT4|A Chain A, Structure Of Unliganded, Inactive Ror2 Kinase Domain Length = 308 Back     alignment and structure
>pdb|1K3A|A Chain A, Structure Of The Insulin-Like Growth Factor 1 Receptor Kinase Length = 299 Back     alignment and structure
>pdb|3OCT|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Mutant V555r In Complex With Dasatinib Length = 265 Back     alignment and structure
>pdb|2R2P|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 5 (Epha5) Length = 295 Back     alignment and structure
>pdb|1K2P|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Domain Length = 263 Back     alignment and structure
>pdb|3P08|A Chain A, Crystal Structure Of The Human Btk Kinase Domain Length = 267 Back     alignment and structure
>pdb|1T46|A Chain A, Structural Basis For The Autoinhibition And Sti-571 Inhibition Of C-kit Tyrosine Kinase Length = 313 Back     alignment and structure
>pdb|3PIX|A Chain A, Crystal Structure Of Btk Kinase Domain Complexed With 2-Isopropyl-7- (4-Methyl-Piperazin-1-Yl)-4-(5-Methyl-2h-Pyrazol-3- Ylamino)-2h- Phthalazin-1-One Length = 274 Back     alignment and structure
>pdb|3GEN|A Chain A, The 1.6 A Crystal Structure Of Human Bruton's Tyrosine Kinase Bound To A Pyrrolopyrimidine-Containing Compound Length = 283 Back     alignment and structure
>pdb|3OCS|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase In Complex With Inhibitor Cgi1746 Length = 271 Back     alignment and structure
>pdb|1T45|A Chain A, Structural Basis For The Autoinhibition And Sti-571 Inhibition Of C- Kit Tyrosine Kinase Length = 331 Back     alignment and structure
>pdb|3SXR|A Chain A, Crystal Structure Of Bmx Non-Receptor Tyrosine Kinase Complex With Dasatinib Length = 268 Back     alignment and structure
>pdb|3G0E|A Chain A, Kit Kinase Domain In Complex With Sunitinib Length = 336 Back     alignment and structure
>pdb|1PKG|A Chain A, Structure Of A C-kit Kinase Product Complex Length = 329 Back     alignment and structure
>pdb|2P0C|A Chain A, Catalytic Domain Of The Proto-Oncogene Tyrosine-Protein Kina Length = 313 Back     alignment and structure
>pdb|2ZV7|A Chain A, Lyn Tyrosine Kinase Domain, Apo Form Length = 279 Back     alignment and structure
>pdb|1AD5|A Chain A, Src Family Kinase Hck-Amp-Pnp Complex Length = 438 Back     alignment and structure
>pdb|1JPA|A Chain A, Crystal Structure Of Unphosphorylated Ephb2 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 312 Back     alignment and structure
>pdb|2HEN|A Chain A, Crystal Structure Of The Ephb2 Receptor Kinase Domain In Complex With Adp Length = 286 Back     alignment and structure
>pdb|2IVT|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|3GEQ|A Chain A, Structural Basis For The Chemical Rescue Of Src Kinase Activity Length = 286 Back     alignment and structure
>pdb|2OIQ|A Chain A, Crystal Structure Of Chicken C-Src Kinase Domain In Complex With The Cancer Drug Imatinib. Length = 286 Back     alignment and structure
>pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 Back     alignment and structure
>pdb|2IVV|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Complexed With The Inhibitor Pp1 Length = 314 Back     alignment and structure
>pdb|3OEZ|A Chain A, Crystal Structure Of The L317i Mutant Of The Chicken C-Src Tyrosine Kinase Domain Complexed With Imatinib Length = 286 Back     alignment and structure
>pdb|3G6H|A Chain A, Src Thr338ile Inhibited In The Dfg-Asp-Out Conformation Length = 286 Back     alignment and structure
>pdb|3D7U|B Chain B, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 277 Back     alignment and structure
>pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 Back     alignment and structure
>pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 Back     alignment and structure
>pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 Back     alignment and structure
>pdb|3U4W|A Chain A, Src In Complex With Dna-Templated Macrocyclic Inhibitor Mc4b Length = 275 Back     alignment and structure
>pdb|3SVV|A Chain A, Crystal Structure Of T338c C-Src Covalently Bound To Vinylsulfonamide- Pyrazolopyrimidine 9 Length = 286 Back     alignment and structure
>pdb|2HWO|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Covalent Inhibitor Length = 286 Back     alignment and structure
>pdb|2QQ7|A Chain A, Crystal Structure Of Drug Resistant Src Kinase Domain With Irreversible Inhibitor Length = 286 Back     alignment and structure
>pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 Back     alignment and structure
>pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 Back     alignment and structure
>pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 Back     alignment and structure
>pdb|3QGW|A Chain A, Crystal Structure Of Itk Kinase Bound To An Inhibitor Length = 286 Back     alignment and structure
>pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 Back     alignment and structure
>pdb|1YOL|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Cgp77675 Length = 283 Back     alignment and structure
>pdb|3T9T|A Chain A, Crystal Structure Of Btk Mutant (F435t,K596r) Complexed With Imidazo[1,5-A]quinoxaline Length = 267 Back     alignment and structure
>pdb|2BDF|A Chain A, Src Kinase In Complex With Inhibitor Ap23451 Length = 279 Back     alignment and structure
>pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 Back     alignment and structure
>pdb|2RFN|A Chain A, X-ray Structure Of C-met With Inhibitor. Length = 310 Back     alignment and structure
>pdb|3I5N|A Chain A, Crystal Structure Of C-Met With Triazolopyridazine Inhibitor 13 Length = 309 Back     alignment and structure
>pdb|3Q6U|A Chain A, Structure Of The Apo Met Receptor Kinase In The Dually-Phosphorylated, Activated State Length = 308 Back     alignment and structure
>pdb|3F66|A Chain A, Human C-Met Kinase In Complex With Quinoxaline Inhibitor Length = 298 Back     alignment and structure
>pdb|2G15|A Chain A, Structural Characterization Of Autoinhibited C-Met Kinase Length = 318 Back     alignment and structure
>pdb|2WGJ|A Chain A, X-Ray Structure Of Pf-02341066 Bound To The Kinase Domain Of C-Met Length = 306 Back     alignment and structure
>pdb|3LQ8|A Chain A, Structure Of The Kinase Domain Of C-Met Bound To Xl880 (Gsk1 Length = 302 Back     alignment and structure
>pdb|4GG5|A Chain A, Crystal Structure Of Cmet In Complex With Novel Inhibitor Length = 319 Back     alignment and structure
>pdb|2WD1|A Chain A, Human C-Met Kinase In Complex With Azaindole Inhibitor Length = 292 Back     alignment and structure
>pdb|4AW5|A Chain A, Complex Of The Ephb4 Kinase Domain With An Oxindole Inhibitor Length = 291 Back     alignment and structure
>pdb|3HNG|A Chain A, Crystal Structure Of Vegfr1 In Complex With N-(4-chlorophenyl)-2- ((pyridin-4-ylmethyl)amino)benzamide Length = 360 Back     alignment and structure
>pdb|3K54|A Chain A, Structures Of Human Bruton's Tyrosine Kinase In Active And Inactive Conformations Suggests A Mechanism Of Activation For Tec Family Kinases Length = 283 Back     alignment and structure
>pdb|2VWU|A Chain A, Ephb4 Kinase Domain Inhibitor Complex Length = 302 Back     alignment and structure
>pdb|3SRV|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase (Syk) In Complex With A Diaminopyrimidine Carboxamide Inhibitor Length = 277 Back     alignment and structure
>pdb|3BEA|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A Pyrimidinopyridone Inhibitor Length = 333 Back     alignment and structure
>pdb|2I1M|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An Arylamide Inhibitor Length = 333 Back     alignment and structure
>pdb|2OGV|A Chain A, Crystal Structure Of The Autoinhibited Human C-Fms Kinase Domain Length = 317 Back     alignment and structure
>pdb|3LCD|A Chain A, Inhibitor Bound To A Dfg-In Structure Of The Kinase Domain Of Csf-1r Length = 329 Back     alignment and structure
>pdb|2I0V|A Chain A, C-Fms Tyrosine Kinase In Complex With A Quinolone Inhibitor Length = 335 Back     alignment and structure
>pdb|4FL3|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 635 Back     alignment and structure
>pdb|4FL2|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 636 Back     alignment and structure
>pdb|3LCO|A Chain A, Inhibitor Bound To A Dfg-Out Structure Of The Kinase Domain Of Csf-1r Length = 324 Back     alignment and structure
>pdb|4F4P|A Chain A, Syk In Complex With Ligand Lasw836 Length = 273 Back     alignment and structure
>pdb|4DFL|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase Complexed With A Sulfonamidopyrazine Piperidine Inhibitor Length = 274 Back     alignment and structure
>pdb|3SRV|B Chain B, Crystal Structure Of Spleen Tyrosine Kinase (Syk) In Complex With A Diaminopyrimidine Carboxamide Inhibitor Length = 277 Back     alignment and structure
>pdb|3EMG|A Chain A, Discovery And Sar Of Novel 4-Thiazolyl-2- Phenylaminopyrimidines As Potent Inhibitors Of Spleen Tyrosine Kinase (Syk) Length = 291 Back     alignment and structure
>pdb|3TUB|A Chain A, Crystal Structure Of Syk Kinase Domain With 1-(5-(6,7- Dimethoxyquinolin-4-Yloxy)pyridin-2-Yl)-3-((1r,2s)-2- Phenylcyclopropyl)urea Length = 293 Back     alignment and structure
>pdb|3VF8|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase Syk Catalytic Domain With Pyrazolylbenzimidazole Inhibitor 416 Length = 299 Back     alignment and structure
>pdb|1XBA|A Chain A, Crystal Structure Of Apo Syk Tyrosine Kinase Domain Length = 291 Back     alignment and structure
>pdb|4HVD|A Chain A, Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h-pyrrolo[2,3- B]pyrazine-7-carboxylic Acid ((s)-1,2,2-trimethyl-propyl)-amide Length = 314 Back     alignment and structure
>pdb|1YOJ|A Chain A, Crystal Structure Of Src Kinase Domain Length = 283 Back     alignment and structure
>pdb|3DQW|A Chain A, C-Src Kinase Domain Thr338ile Mutant In Complex With Atpgs Length = 286 Back     alignment and structure
>pdb|1R0P|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With The Microbial Alkaloid K-252a Length = 312 Back     alignment and structure
>pdb|3A4P|A Chain A, Human C-Met Kinase Domain Complexed With 6-Benzyloxyquinoline Inhibitor Length = 319 Back     alignment and structure
>pdb|4FOB|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Acyliminobenzimidazole Inhibitor 1 Length = 353 Back     alignment and structure
>pdb|4DCE|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With A Piperidine-Carboxamide Inhibitor Length = 333 Back     alignment and structure
>pdb|3CTH|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Aminopyridine Based Inhibitor Length = 314 Back     alignment and structure
>pdb|4FNZ|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Piperidine-Carboxamide Inhibitor 2 Length = 327 Back     alignment and structure
>pdb|4FNW|A Chain A, Crystal Structure Of The Apo F1174l Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|3QTI|A Chain A, C-Met Kinase In Complex With Nvp-Bvu972 Length = 314 Back     alignment and structure
>pdb|3DKC|A Chain A, Sgx Clone 5698a65kfg1h1 Length = 317 Back     alignment and structure
>pdb|3Q6W|A Chain A, Structure Of Dually-phosphorylated Met Receptor Kinase In Complex With An Mk-2461 Analog With Specificity For The Activated Receptor Length = 307 Back     alignment and structure
>pdb|3L9P|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 367 Back     alignment and structure
>pdb|3DKG|A Chain A, Sgx Clone 5698a109kfg1h1 Length = 317 Back     alignment and structure
>pdb|3LCT|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 344 Back     alignment and structure
>pdb|3C1X|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Pyrrolotriazine Based Inhibitor Length = 373 Back     alignment and structure
>pdb|3AOX|A Chain A, X-Ray Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Ch5424802 Length = 344 Back     alignment and structure
>pdb|2YHV|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|2YJS|A Chain A, Structure Of C1156y Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|2YJR|A Chain A, Structure Of F1174l Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|1YI6|A Chain A, C-Term Tail Segment Of Human Tyrosine Kinase (258-533) Length = 276 Back     alignment and structure
>pdb|2YFX|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase In Complex With Crizotinib Length = 327 Back     alignment and structure
>pdb|2XB7|A Chain A, Structure Of Human Anaplastic Lymphoma Kinase In Complex With Nvp- Tae684 Length = 315 Back     alignment and structure
>pdb|2XP2|A Chain A, Structure Of The Human Anaplastic Lymphoma Kinase In Complex With Crizotinib (Pf-02341066) Length = 327 Back     alignment and structure
>pdb|3LXK|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 327 Back     alignment and structure
>pdb|1K9A|A Chain A, Crystal Structure Analysis Of Full-Length Carboxyl-Terminal Src Kinase At 2.5 A Resolution Length = 450 Back     alignment and structure
>pdb|3CJF|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|4FNX|A Chain A, Crystal Structure Of The Apo R1275q Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|3PJC|A Chain A, Crystal Structure Of Jak3 Complexed With A Potent Atp Site Inhibitor Showing High Selectivity Within The Janus Kinase Family Length = 315 Back     alignment and structure
>pdb|1BYG|A Chain A, Kinase Domain Of Human C-Terminal Src Kinase (Csk) In Complex With Inhibitor Staurosporine Length = 278 Back     alignment and structure
>pdb|3UGC|A Chain A, Structural Basis Of Jak2 Inhibition By The Type Ii Inhibtor Nvp-Bbt594 Length = 295 Back     alignment and structure
>pdb|3D7U|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 263 Back     alignment and structure
>pdb|4BBE|A Chain A, Aminoalkylpyrimidine Inhibitor Complexes With Jak2 Length = 298 Back     alignment and structure
>pdb|3LXN|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 318 Back     alignment and structure
>pdb|3Q32|A Chain A, Structure Of Janus Kinase 2 With A Pyrrolotriazine Inhibitor Length = 301 Back     alignment and structure
>pdb|3LPB|A Chain A, Crystal Structure Of Jak2 Complexed With A Potent 2,8-Diaryl Quinoxaline Inhibitor Length = 295 Back     alignment and structure
>pdb|3TJC|A Chain A, Co-Crystal Structure Of Jak2 With Thienopyridine 8 Length = 298 Back     alignment and structure
>pdb|2XA4|A Chain A, Inhibitors Of Jak2 Kinase Domain Length = 298 Back     alignment and structure
>pdb|3E62|A Chain A, Fragment Based Discovery Of Jak-2 Inhibitors Length = 293 Back     alignment and structure
>pdb|3JY9|A Chain A, Janus Kinase 2 Inhibitors Length = 311 Back     alignment and structure
>pdb|3IO7|A Chain A, 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Selective Inhibitors Of Jak2 Length = 313 Back     alignment and structure
>pdb|4HGE|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 Length = 300 Back     alignment and structure
>pdb|2B7A|A Chain A, The Structural Basis Of Janus Kinase 2 Inhibition By A Potent And Specific Pan-Janus Kinase Inhibitor Length = 293 Back     alignment and structure
>pdb|4E4M|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|3RVG|A Chain A, Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido[4,3-B]indol-4- Carboxamide Inhibitor Length = 303 Back     alignment and structure
>pdb|4E6D|A Chain A, Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex With Compound 7 Length = 298 Back     alignment and structure
>pdb|4AQC|A Chain A, Triazolopyridine-Based Inhibitor Of Janus Kinase 2 Length = 301 Back     alignment and structure
>pdb|1U59|A Chain A, Crystal Structure Of The Zap-70 Kinase Domain In Complex With Staurosporine Length = 287 Back     alignment and structure
>pdb|2W1I|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 326 Back     alignment and structure
>pdb|2OZO|A Chain A, Autoinhibited Intact Human Zap-70 Length = 613 Back     alignment and structure
>pdb|3NYX|A Chain A, Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-Thiadiazole- Thiophene Inhibitor Length = 302 Back     alignment and structure
>pdb|3NZ0|A Chain A, Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 302 Back     alignment and structure
>pdb|3D7T|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 269 Back     alignment and structure
>pdb|1Y6A|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 2-Anilino-5-Aryl-Oxazole Inhibitor Length = 366 Back     alignment and structure
>pdb|3VHK|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Back Pocket Binder Length = 368 Back     alignment and structure
>pdb|3VID|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With Compound A Length = 356 Back     alignment and structure
>pdb|3VHE|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With A Novel Pyrrolopyrimidine Inhibitor Length = 359 Back     alignment and structure
>pdb|3CJG|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|4AGC|A Chain A, Crystal Structure Of Vegfr2 (Juxtamembrane And Kinase Domains) In Complex With Axitinib (Ag-013736) (N-Methyl-2-( 3-((E)-2-Pyridin-2-Yl-Vinyl)-1h-Indazol-6-Ylsulfanyl)- Benzamide) Length = 353 Back     alignment and structure
>pdb|3VNT|A Chain A, Crystal Structure Of The Kinase Domain Of Human Vegfr2 With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 318 Back     alignment and structure
>pdb|3EWH|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridyl-Pyrimidine Benzimidazole Inhibitor Length = 314 Back     alignment and structure
>pdb|3U6J|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyrazolone Inhibitor Length = 314 Back     alignment and structure
>pdb|2XIR|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With Pf-00337210 (N,2-Dimethyl-6-(7-(2-Morpholinoethoxy) Quinolin-4-Yloxy)benzofuran-3-Carboxamide) Length = 316 Back     alignment and structure
>pdb|4E20|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 290 Back     alignment and structure
>pdb|4E1Z|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 291 Back     alignment and structure
>pdb|1YVJ|A Chain A, Crystal Structure Of The Jak3 Kinase Domain In Complex With A Staurosporine Analogue Length = 290 Back     alignment and structure
>pdb|3C7Q|A Chain A, Structure Of Vegfr2 Kinase Domain In Complex With Bibf1120 Length = 316 Back     alignment and structure
>pdb|2OH4|A Chain A, Crystal Structure Of Vegfr2 With A Benzimidazole-Urea Inhibitor Length = 316 Back     alignment and structure
>pdb|1YWN|A Chain A, Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]pyrimidine Length = 316 Back     alignment and structure
>pdb|2P2I|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Nicotinamide Inhibitor Length = 314 Back     alignment and structure
>pdb|2P2H|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridinyl-Triazine Inhibitor Length = 314 Back     alignment and structure
>pdb|1RJB|A Chain A, Crystal Structure Of Flt3 Length = 344 Back     alignment and structure
>pdb|1VR2|A Chain A, Human Vascular Endothelial Growth Factor Receptor 2 (Kdr) Kinase Domain Length = 316 Back     alignment and structure
>pdb|4E4L|A Chain A, Jak1 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|3EYG|A Chain A, Crystal Structures Of Jak1 And Jak2 Inhibitor Complexes Length = 290 Back     alignment and structure
>pdb|3DTC|A Chain A, Crystal Structure Of Mixed-Lineage Kinase Mlk1 Complexed With Compound 16 Length = 271 Back     alignment and structure
>pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|3KMW|A Chain A, Crystal Structure Of The IlkALPHA-Parvin Core Complex (Mgatp) Length = 271 Back     alignment and structure
>pdb|4FVP|A Chain A, Crystal Structure Of The Jak2 Pseudokinase Domain (Apo Form) Length = 289 Back     alignment and structure
>pdb|4FVR|A Chain A, Crystal Structure Of The Jak2 Pseudokinase Domain Mutant V617f (Mg- Atp-Bound Form) Length = 289 Back     alignment and structure
>pdb|3KMU|A Chain A, Crystal Structure Of The IlkALPHA-Parvin Core Complex (Apo) Length = 271 Back     alignment and structure
>pdb|4GS6|A Chain A, Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxozeaenol Length = 315 Back     alignment and structure
>pdb|2EVA|A Chain A, Structural Basis For The Interaction Of Tak1 Kinase With Its Activating Protein Tab1 Length = 307 Back     alignment and structure
>pdb|4F0F|A Chain A, Crystal Structure Of The Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|4F1M|A Chain A, Crystal Structure Of The G1179s Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|4F1O|A Chain A, Crystal Structure Of The L1180t Mutant Roco4 Kinase Domain From D. Discoideum Bound To Appcp Length = 287 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 1e-56
3lzb_A327 Epidermal growth factor receptor; epidermal growth 1e-51
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 2e-50
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 1e-49
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 1e-49
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 5e-49
3poz_A327 Epidermal growth factor receptor; kinase domain, a 4e-48
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 7e-48
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 2e-45
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 4e-45
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 4e-45
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 4e-45
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 5e-45
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 6e-45
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 1e-44
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 2e-43
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 3e-43
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 3e-43
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 7e-43
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 1e-42
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 1e-42
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 2e-42
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 3e-42
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 5e-42
3v5q_A297 NT-3 growth factor receptor; kinase domain, kinase 1e-41
3zzw_A289 Tyrosine-protein kinase transmembrane receptor RO; 1e-41
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 1e-41
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 1e-41
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 3e-41
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 4e-41
4aoj_A329 High affinity nerve growth factor receptor; transf 4e-41
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 5e-41
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 6e-41
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 6e-41
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 7e-41
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 1e-40
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 4e-40
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 5e-40
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 5e-40
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 1e-39
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 1e-39
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 2e-39
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 2e-39
3pls_A298 Macrophage-stimulating protein receptor; protein k 2e-39
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 1e-38
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 1e-38
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 2e-38
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 4e-38
2xir_A316 Vascular endothelial growth factor receptor 2; ang 5e-38
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 3e-37
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 4e-37
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 9e-36
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 2e-34
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 3e-31
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 5e-28
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 4e-25
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 9e-25
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 3e-23
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 4e-23
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 2e-22
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 4e-22
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 4e-21
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 7e-11
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 2e-10
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 2e-10
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 4e-10
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 4e-10
3q4u_A301 Activin receptor type-1; structural genomics conso 4e-10
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 8e-10
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 1e-09
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 5e-09
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 7e-09
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 8e-09
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 3e-08
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 7e-08
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 7e-08
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 8e-08
3soc_A322 Activin receptor type-2A; structural genomics cons 2e-07
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 2e-07
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 3e-07
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 3e-07
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 4e-07
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 4e-07
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 5e-07
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 5e-07
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 6e-07
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 6e-07
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 7e-07
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 1e-06
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 1e-06
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 2e-06
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 2e-06
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 2e-06
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 2e-06
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 2e-06
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 3e-06
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 3e-06
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 3e-06
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 3e-06
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 3e-06
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 4e-06
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 4e-06
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 5e-06
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 5e-06
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 6e-06
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 9e-06
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 9e-06
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 9e-06
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 1e-05
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 2e-05
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 2e-05
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 2e-05
1uti_A58 GRB2-related adaptor protein 2; signaling protein 2e-05
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 3e-05
1awj_A77 ITK; transferase, regulatory intramolecular comple 4e-05
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 4e-05
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 5e-05
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 5e-05
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 5e-05
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 5e-05
2a19_B284 Interferon-induced, double-stranded RNA-activated 6e-05
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 6e-05
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 7e-05
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 9e-05
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 9e-05
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 9e-05
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 1e-04
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 1e-04
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 1e-04
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 1e-04
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 1e-04
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 2e-04
3uqc_A286 Probable conserved transmembrane protein; structur 2e-04
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 2e-04
2dyl_A318 Dual specificity mitogen-activated protein kinase 2e-04
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 2e-04
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 2e-04
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 2e-04
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 2e-04
2cuc_A70 SH3 domain containing ring finger 2; structural ge 3e-04
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 3e-04
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 3e-04
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 3e-04
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 3e-04
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 4e-04
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 4e-04
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 4e-04
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 4e-04
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 4e-04
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 5e-04
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 5e-04
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 5e-04
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 5e-04
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 5e-04
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 6e-04
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 6e-04
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 6e-04
2j6f_A62 CD2-associated protein; metal-binding, immune resp 7e-04
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 8e-04
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 8e-04
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 9e-04
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 9e-04
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 9e-04
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
 Score =  181 bits (462), Expect = 1e-56
 Identities = 74/127 (58%), Positives = 89/127 (70%), Gaps = 2/127 (1%)

Query: 61  GDFGMMR--YSQNDCYVMTERKPLPCPWCPMESLKHNQFSQASDAWMFGVTIWEMFTFGA 118
           GDFG+MR     +D YVM E + +P  WC  ESLK   FS ASD WMFGVT+WEMFT+G 
Sbjct: 163 GDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQ 222

Query: 119 EPWVGLNGMQILQKIDREGERLPRPEACPVEVYALMRQCWSKNPAERPKFSTLKDCLYRL 178
           EPW+GLNG QIL KID+EGERLPRPE CP ++Y +M QCW+  P +RP F  L+D L   
Sbjct: 223 EPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEA 282

Query: 179 TPAVMKA 185
            P  M+A
Sbjct: 283 QPTDMRA 289


>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Length = 78 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Length = 70 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A 1qwf_A 1prl_C ... Length = 84 Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Length = 62 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} Length = 67 Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Length = 79 Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Length = 60 Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Length = 71 Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} PDB: 3h0i_A 3h0f_A* Length = 73 Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Length = 67 Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Length = 86 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Length = 71 Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Length = 72 Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Length = 57 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Length = 65 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Length = 90 Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 58 Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Length = 58 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Length = 67 Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 80 Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Length = 58 Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Length = 77 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Length = 64 Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Length = 62 Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Length = 58 Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Length = 67 Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Length = 60 Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Length = 59 Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Length = 73 Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Length = 65 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Length = 54 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Length = 92 Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Length = 69 Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 69 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Length = 70 Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Length = 62 Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Length = 58 Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Length = 68 Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Length = 76 Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Length = 63 Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Length = 65 Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Length = 67 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Length = 58 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Length = 60 Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Length = 62 Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Length = 58 Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Length = 69 Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Length = 142 Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Length = 89 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query251
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 100.0
4ase_A353 Vascular endothelial growth factor receptor 2; tra 100.0
4aoj_A329 High affinity nerve growth factor receptor; transf 100.0
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 100.0
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 100.0
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 100.0
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 100.0
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 100.0
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 100.0
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 100.0
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 100.0
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 100.0
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 100.0
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 100.0
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 100.0
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 100.0
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 100.0
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 100.0
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 100.0
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 100.0
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 100.0
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 100.0
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 100.0
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 100.0
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 100.0
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 100.0
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 100.0
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 100.0
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 100.0
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 100.0
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 100.0
3poz_A327 Epidermal growth factor receptor; kinase domain, a 100.0
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 100.0
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 100.0
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 100.0
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 100.0
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 100.0
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 100.0
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 100.0
2xir_A316 Vascular endothelial growth factor receptor 2; ang 100.0
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 100.0
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 100.0
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 100.0
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 100.0
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 100.0
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 100.0
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 100.0
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 100.0
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 100.0
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 100.0
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 100.0
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 100.0
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 100.0
3lzb_A327 Epidermal growth factor receptor; epidermal growth 100.0
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 100.0
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 100.0
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 100.0
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 100.0
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 100.0
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 100.0
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 100.0
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 100.0
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 100.0
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 100.0
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 100.0
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 100.0
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 100.0
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 100.0
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 100.0
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 100.0
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 100.0
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 100.0
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 100.0
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 100.0
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 100.0
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 100.0
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 100.0
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 100.0
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 100.0
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 100.0
3q4u_A301 Activin receptor type-1; structural genomics conso 100.0
2y0a_A326 Death-associated protein kinase 1; transferase, ca 100.0
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 100.0
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 100.0
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 100.0
3pls_A298 Macrophage-stimulating protein receptor; protein k 100.0
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 100.0
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 100.0
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 100.0
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 100.0
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 100.0
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 100.0
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 100.0
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 100.0
3soc_A322 Activin receptor type-2A; structural genomics cons 100.0
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 100.0
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 100.0
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 100.0
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 100.0
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 100.0
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 100.0
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 100.0
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 100.0
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 100.0
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 100.0
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 100.0
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 100.0
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 100.0
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 100.0
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 100.0
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 100.0
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 100.0
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 100.0
3niz_A311 Rhodanese family protein; structural genomics, str 100.0
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 100.0
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 100.0
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 100.0
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 100.0
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 100.0
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 100.0
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 100.0
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 100.0
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 100.0
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 99.98
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.98
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 99.98
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 99.98
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.98
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 99.98
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.98
3ork_A311 Serine/threonine protein kinase; structural genomi 99.98
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 99.98
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 99.98
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 99.98
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 99.98
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 99.98
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.98
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.98
2eue_A275 Carbon catabolite derepressing protein kinase; kin 99.98
3o0g_A292 Cell division protein kinase 5; kinase activator c 99.98
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.98
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 99.98
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 99.98
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.98
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 99.98
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.98
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 99.98
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.98
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 99.98
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 99.98
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 99.98
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 99.98
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.97
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.97
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 99.97
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.97
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 99.97
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 99.97
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.97
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.97
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 99.97
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 99.97
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.97
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 99.97
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 99.97
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 99.97
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.97
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.97
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 99.97
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 99.97
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 99.97
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.97
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 99.97
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 99.97
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 99.97
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 99.97
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.97
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 99.97
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.97
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.97
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 99.97
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 99.97
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 99.97
3dls_A335 PAS domain-containing serine/threonine-protein KI; 99.97
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.97
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.97
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 99.97
3eqc_A360 Dual specificity mitogen-activated protein kinase; 99.97
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 99.97
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 99.97
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 99.97
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.97
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 99.97
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 99.97
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 99.97
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 99.97
3rp9_A458 Mitogen-activated protein kinase; structural genom 99.97
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 99.97
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.97
3bhy_A283 Death-associated protein kinase 3; death associate 99.97
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 99.97
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.97
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 99.97
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.97
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 99.97
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 99.97
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 99.97
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 99.97
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 99.97
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 99.97
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 99.97
3an0_A340 Dual specificity mitogen-activated protein kinase; 99.97
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.97
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.97
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 99.97
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 99.97
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 99.97
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.97
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 99.97
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 99.97
3fme_A290 Dual specificity mitogen-activated protein kinase; 99.97
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 99.97
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.97
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 99.97
2fst_X367 Mitogen-activated protein kinase 14; active mutant 99.97
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.97
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.97
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 99.97
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 99.97
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 99.97
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 99.97
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 99.97
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.97
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 99.97
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 99.96
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 99.96
2dyl_A318 Dual specificity mitogen-activated protein kinase 99.96
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.96
3aln_A327 Dual specificity mitogen-activated protein kinase; 99.96
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.95
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 99.95
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.94
3uqc_A286 Probable conserved transmembrane protein; structur 99.93
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.93
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.87
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.72
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.5
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 99.17
4gyi_A397 RIO2 kinase; protein kinase, ADP complex, phosphoa 98.67
1nd4_A264 Aminoglycoside 3'-phosphotransferase; protein kina 97.58
3tm0_A263 Aminoglycoside 3'-phosphotransferase; protein kina 97.5
3dxp_A359 Putative acyl-COA dehydrogenase; protein kinase-li 96.37
3sg8_A304 APH(2'')-ID; antibiotic resistance enzyme, transfe 96.18
2yle_A229 Protein spire homolog 1; actin-binding protein, ac 96.08
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 95.87
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 95.72
2q83_A346 YTAA protein; 2635576, structural genomics, joint 95.54
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 95.46
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 95.24
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 95.15
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 95.15
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 94.99
2lj0_A65 Sorbin and SH3 domain-containing protein 1; R85FL, 94.78
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 94.43
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 94.43
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 94.26
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 94.21
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 94.18
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 94.12
2cuc_A70 SH3 domain containing ring finger 2; structural ge 94.06
2pyw_A420 Uncharacterized protein; 5-methylthioribose kinase 94.06
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 94.02
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 93.85
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 93.77
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 93.72
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 93.67
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 93.66
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 93.61
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 93.49
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 93.43
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 93.34
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 93.16
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 93.0
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 92.98
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 92.86
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 92.84
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 92.76
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 92.75
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 92.73
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 92.73
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 92.71
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 92.7
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 92.59
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 92.58
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 92.56
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 92.54
2ppq_A322 HSK, HK, homoserine kinase; structural genomics, M 92.51
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 92.46
3r70_A320 Aminoglycoside phosphotransferase; structural geno 92.46
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 92.45
4gkh_A272 Aminoglycoside 3'-phosphotransferase APHA1-IAB; py 92.43
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 92.42
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 92.41
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 92.39
1uti_A58 GRB2-related adaptor protein 2; signaling protein 92.37
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 92.3
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 92.25
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 92.21
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 92.07
2dil_A69 Proline-serine-threonine phosphatase-interacting p 92.01
3ovc_A362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 91.88
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 91.88
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 91.8
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 91.78
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 91.76
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 91.74
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 91.74
1wxb_A68 Epidermal growth factor receptor pathway substrate 91.65
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 91.65
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 91.64
2j6f_A62 CD2-associated protein; metal-binding, immune resp 91.61
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 91.59
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 91.56
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 91.52
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 91.5
3csv_A333 Aminoglycoside phosphotransferase; YP_614837.1, ph 91.5
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 91.44
3tdw_A306 Gentamicin resistance protein; kinase, phosphoryl 91.41
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 91.23
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 91.16
1i07_A60 Epidermal growth factor receptor kinase substrate 91.16
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 91.16
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 91.15
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 91.05
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 91.04
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 91.03
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 90.89
2da9_A70 SH3-domain kinase binding protein 1; structural ge 90.88
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 90.85
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 90.74
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 90.69
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 90.64
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} 90.56
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 90.55
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 90.54
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 90.46
3ats_A357 Putative uncharacterized protein; hypothetical pro 90.44
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 90.3
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 90.28
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 90.22
2lx7_A60 GAS-7, growth arrest-specific protein 7; structura 90.17
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 90.15
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 90.13
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 90.1
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 90.0
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 90.0
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 90.0
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 89.99
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 89.93
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 89.89
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 89.72
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 89.66
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 89.59
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 89.51
1zyl_A328 Hypothetical protein YIHE; putative protein kinase 89.45
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 89.41
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 89.25
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 89.21
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 89.14
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 89.07
3c5i_A369 Choline kinase; choline, kinase, malaria, transfer 88.95
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 88.92
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 88.92
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 88.89
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 88.86
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 88.64
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 88.57
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 88.49
3dxq_A301 Choline/ethanolamine kinase family protein; NP_106 88.43
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 88.13
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 88.11
3i1a_A339 Spectinomycin phosphotransferase; protein kinase, 88.09
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 87.91
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 87.9
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 87.9
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 87.88
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 87.85
1nw1_A429 Choline kinase (49.2 KD); phospholipid synthesis, 87.8
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 87.79
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 87.79
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 87.7
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 87.69
2m0y_A74 Dedicator of cytokinesis protein 1; apoptosis; NMR 87.67
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 87.62
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 87.61
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 87.58
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 87.57
2qg7_A458 Ethanolamine kinase PV091845; malaria, SGC, struct 87.44
1i1j_A108 Melanoma derived growth regulatory protein; SH3 su 87.43
2olc_A397 MTR kinase, methylthioribose kinase; kinase ADP-2H 87.4
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 87.38
3i5r_A83 Phosphatidylinositol 3-kinase regulatory subunit a 87.35
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 87.28
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 87.22
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 87.15
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 87.08
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 87.0
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 86.96
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 86.87
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 86.68
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 86.56
1awj_A77 ITK; transferase, regulatory intramolecular comple 86.48
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 86.4
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 86.33
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 86.32
3feg_A379 Choline/ethanolamine kinase; non-protein kinase, c 86.29
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 86.06
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 85.74
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 85.7
3f2s_A401 CK, chetk-alpha, choline kinase alpha; non-protein 85.4
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 85.03
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 84.98
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 84.7
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 84.69
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 84.67
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 84.16
4glm_A72 Dynamin-binding protein; SH3 domain, DNMBP, struct 84.08
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 84.02
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 83.88
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 83.82
3g15_A401 CK, chetk-alpha, choline kinase alpha; non-protein 83.42
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 83.21
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 82.88
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 82.71
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 82.68
3u23_A65 CD2-associated protein; structural genomics, struc 82.06
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 81.77
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 81.6
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 81.45
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 81.37
3mes_A424 Choline kinase; malaria, structural genomics, stru 81.24
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 81.17
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 80.95
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 80.61
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
Probab=100.00  E-value=1.3e-45  Score=307.88  Aligned_cols=175  Identities=25%  Similarity=0.564  Sum_probs=152.7

Q ss_pred             CcccccchhHHHHHhcCCC-----------------------CCCCchhhHHhhhhhhCCcccCCCCCCCceEEEccCCc
Q psy2787           1 MSANFAELNAFQENYTEPC-----------------------RKPLPPERRGYGTFSVNNICSCQFSSSSLLILFFSSSS   57 (251)
Q Consensus         1 ~~~e~~~l~~l~~~~~~~~-----------------------~~~~~~~~~gl~~lH~~~iiHrdlkp~ni~il~~~~~~   57 (251)
                      |++||++.|+|.+++....                       ..++.|+++||+|||+++||||||||+|  ||+++++.
T Consensus       106 lV~Ey~~~G~L~~~L~~~~~~~~~~~~~~~~~~~~~l~~~~~~~i~~qia~gl~yLH~~~iiHRDLK~~N--ILl~~~~~  183 (308)
T 4gt4_A          106 MIFSYCSHGDLHEFLVMRSPHSDVGSTDDDRTVKSALEPPDFVHLVAQIAAGMEYLSSHHVVHKDLATRN--VLVYDKLN  183 (308)
T ss_dssp             EEEECCSSCBHHHHHHTTCSSCCCC-----CCEECCCCHHHHHHHHHHHHHHHHHHHHTTCCCSCCSGGG--EEECGGGC
T ss_pred             EEEEcCCCCcHHHHHHhhCccccccccccccccccCCCHHHHHHHHHHHHHHHHHHHhCCCCCCCccccc--eEECCCCC
Confidence            4789999999999874321                       1245688999999999999999999999  99999999


Q ss_pred             eEEccCCCCcccCCCc-eeecCCCCcCcccCCCcccCCCCCCchhHHHHHHHHHHHHHhCCCCCCCCCChhHHHHHHHhc
Q psy2787          58 SSSGDFGMMRYSQNDC-YVMTERKPLPCPWCPMESLKHNQFSQASDAWMFGVTIWEMFTFGAEPWVGLNGMQILQKIDRE  136 (251)
Q Consensus        58 ~kl~DFGla~~~~~~~-~~~~~~~~~~~~y~aPE~~~~~~~~~~~Di~S~G~il~el~~~g~~pf~~~~~~~~~~~i~~~  136 (251)
                      +||+|||+|+...... ........||+.|||||++.+..++.++|||||||++|||+|.|..||.+.+..++...+. .
T Consensus       184 ~Ki~DFGlar~~~~~~~~~~~~~~~gt~~ymAPE~l~~~~~s~ksDVwSfGvvl~El~t~g~~Pf~~~~~~~~~~~i~-~  262 (308)
T 4gt4_A          184 VKISDLGLFREVYAADYYKLLGNSLLPIRWMAPEAIMYGKFSIDSDIWSYGVVLWEVFSYGLQPYCGYSNQDVVEMIR-N  262 (308)
T ss_dssp             EEECCSCCBCGGGGGGCBCSSSSSCBCGGGCCHHHHHHCCCCHHHHHHHHHHHHHHHHTTTCCTTTTCCHHHHHHHHH-T
T ss_pred             EEECCcccceeccCCCceeEecccccCCcccCHHHHhCCCCCccchhhhHHHHHHHHHhCCCCCCCCCCHHHHHHHHH-c
Confidence            9999999998754332 3334566899999999999999999999999999999999987899999999888888874 5


Q ss_pred             CCCCCCCCCCcHHHHHHHHHHhccCCCCCCCHHHHHHHHHhh
Q psy2787         137 GERLPRPEACPVEVYALMRQCWSKNPAERPKFSTLKDCLYRL  178 (251)
Q Consensus       137 ~~~~~~~~~~~~~~~~li~~cl~~dP~~Rps~~~il~~l~~~  178 (251)
                      +.+++.|..+|.++.+++.+||+.||++|||+.+|+++|+..
T Consensus       263 ~~~~~~p~~~~~~~~~li~~C~~~dP~~RPs~~ei~~~L~a~  304 (308)
T 4gt4_A          263 RQVLPCPDDCPAWVYALMIECWNEFPSRRPRFKDIHSRLRAW  304 (308)
T ss_dssp             TCCCCCCTTCCHHHHHHHHHHTCSSGGGSCCHHHHHHHHHTS
T ss_pred             CCCCCCcccchHHHHHHHHHHcCCChhHCcCHHHHHHHHHhc
Confidence            677788889999999999999999999999999999999764



>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure
>2yle_A Protein spire homolog 1; actin-binding protein, actin polymerization; 1.80A {Homo sapiens} PDB: 2ylf_A 3r7g_A 3rbw_A Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Back     alignment and structure
>2q83_A YTAA protein; 2635576, structural genomics, joint center for structu genomics, JCSG, protein structure initiative, PSI-2, transf; HET: ADN CIT UNL; 2.50A {Bacillus subtilis} Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Back     alignment and structure
>2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2pyw_A Uncharacterized protein; 5-methylthioribose kinase, plant methionine recycling, refol transferase; HET: SR1 ADP; 1.90A {Arabidopsis thaliana} Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* Back     alignment and structure
>2ppq_A HSK, HK, homoserine kinase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: d.144.1.6 Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3csv_A Aminoglycoside phosphotransferase; YP_614837.1, phosphotransferase enzyme family, structural genomics, JOIN for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3ats_A Putative uncharacterized protein; hypothetical protein, putative aminoglycoside phosphortransf transferase; 1.67A {Mycobacterium tuberculosis} PDB: 3att_A* Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Back     alignment and structure
>2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1zyl_A Hypothetical protein YIHE; putative protein kinase, structural genomics, PSI, protein structure initiative; 2.80A {Escherichia coli} SCOP: d.144.1.6 Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3c5i_A Choline kinase; choline, kinase, malaria, transferase, structural genomics, structural genomics consortium; 2.20A {Plasmodium knowlesi} PDB: 3fi8_A* Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Back     alignment and structure
>3dxq_A Choline/ethanolamine kinase family protein; NP_106042.1, STR genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 2.55A {Mesorhizobium loti} Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Back     alignment and structure
>3i1a_A Spectinomycin phosphotransferase; protein kinase, aminoglycoside phosphotransferase, antibiotic resistance; HET: MES PG4; 1.70A {Legionella pneumophila} PDB: 3i0q_A* 3i0o_A* 3q2m_A* Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Back     alignment and structure
>1nw1_A Choline kinase (49.2 KD); phospholipid synthesis, protein kinase fold, transferase; 2.02A {Caenorhabditis elegans} SCOP: d.144.1.8 Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qg7_A Ethanolamine kinase PV091845; malaria, SGC, structural genomics consortium, transferase; 2.41A {Plasmodium vivax} Back     alignment and structure
>1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Back     alignment and structure
>2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Back     alignment and structure
>3feg_A Choline/ethanolamine kinase; non-protein kinase, choline kinase, structural genomics CONS SGC, hemicholinium-3, phosphorylation; HET: HC7 ADP AMP; 1.30A {Homo sapiens} PDB: 3lq3_A* 2ig7_A* Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Back     alignment and structure
>4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Back     alignment and structure
>3g15_A CK, chetk-alpha, choline kinase alpha; non-protein kinase, structural genomics CONS SGC, hemicholinium-3, transferase; HET: ADP HC6; 1.70A {Homo sapiens} PDB: 3f2r_A* 2i7q_A 2cko_A 2ckp_A* 2ckq_A* Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Back     alignment and structure
>3mes_A Choline kinase; malaria, structural genomics, structural genomics consortium, SGC, transferase; HET: ADP DME PT3; 2.35A {Cryptosporidium parvum} Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 251
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 3e-33
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 6e-28
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 8e-28
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 7e-27
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 8e-27
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 2e-26
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 3e-26
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 4e-26
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 7e-26
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 9e-26
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 1e-25
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 1e-25
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 4e-25
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 6e-25
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 3e-24
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 1e-23
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 2e-23
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 5e-23
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 2e-22
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 4e-22
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 2e-21
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 4e-21
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 3e-20
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 5e-20
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 6e-20
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 2e-18
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 5e-18
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 2e-17
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 2e-17
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 8e-17
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 2e-16
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 3e-16
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 6e-16
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 6e-16
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 9e-16
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 2e-15
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 2e-15
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 3e-15
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 1e-14
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 3e-14
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 5e-14
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 7e-14
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 2e-13
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 4e-13
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 9e-13
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 2e-12
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 7e-11
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 9e-11
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 1e-10
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 2e-10
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 3e-10
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 3e-10
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 3e-09
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 1e-08
d1gcqc_69 b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mu 1e-08
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 1e-08
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 1e-06
d1efna_57 b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, 7e-06
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 7e-06
d1fmka164 b.34.2.1 (A:82-145) c-src protein tyrosine kinase 7e-06
d1arka_60 b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo 1e-05
d1jo8a_58 b.34.2.1 (A:) Actin binding protein ABP1 {Baker's 2e-05
d1gl5a_67 b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musc 9e-05
d1qcfa165 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Hu 1e-04
d1gria156 b.34.2.1 (A:1-56) Growth factor receptor-bound pro 1e-04
d2iima162 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 d 1e-04
d1opka157 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domai 1e-04
d1spka_72 b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RI 1e-04
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 2e-04
d1awwa_67 b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Hom 2e-04
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 2e-04
d1k9aa171 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (cs 3e-04
d1zuua156 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyc 3e-04
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 4e-04
d1u5sa171 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [Tax 4e-04
d1utia_57 b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona 5e-04
d1ckaa_57 b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse 6e-04
d1u06a155 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chic 6e-04
d2hspa_71 b.34.2.1 (A:) Phospholipase C, SH3 domain {Human ( 8e-04
d1ycsb263 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [ 0.002
d1k4us_62 b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId 0.002
d1ujya_76 b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens 0.002
d1oota_58 b.34.2.1 (A:) Hypothetical protein YFR024c {Baker' 0.002
d1ng2a2118 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic 0.003
d1uj0a_58 b.34.2.1 (A:) Signal transducing adaptor molecule 0.004
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Activated CDC42 kinase 1, ACK1
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  119 bits (299), Expect = 3e-33
 Identities = 72/142 (50%), Positives = 91/142 (64%), Gaps = 4/142 (2%)

Query: 36  NNICSCQFSSSSLLILFFSSSSSSSGDFGMMR--YSQNDCYVMTERKPLPCPWCPMESLK 93
                   ++ +  +L  +      GDFG+MR     +D YVM E + +P  WC  ESLK
Sbjct: 130 KRFIHRDLAARN--LLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLK 187

Query: 94  HNQFSQASDAWMFGVTIWEMFTFGAEPWVGLNGMQILQKIDREGERLPRPEACPVEVYAL 153
              FS ASD WMFGVT+WEMFT+G EPW+GLNG QIL KID+EGERLPRPE CP ++Y +
Sbjct: 188 TRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNV 247

Query: 154 MRQCWSKNPAERPKFSTLKDCL 175
           M QCW+  P +RP F  L+D L
Sbjct: 248 MVQCWAHKPEDRPTFVALRDFL 269


>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 69 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 55 Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query251
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 100.0
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 100.0
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 100.0
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 100.0
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 100.0
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 100.0
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 100.0
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 100.0
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 100.0
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 100.0
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 100.0
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 100.0
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 100.0
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 100.0
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 100.0
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 100.0
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 100.0
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 100.0
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 100.0
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 100.0
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 100.0
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 100.0
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 100.0
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 100.0
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 100.0
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 100.0
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 100.0
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.98
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.97
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.97
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.97
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.95
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.37
d1gcqc_69 Vav N-terminal SH3 domain {Mouse (Mus musculus) [T 97.28
d1spka_72 BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 95.96
d1efna_57 Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu 94.64
d1fmka164 c-src protein tyrosine kinase {Human (Homo sapiens 94.54
d1jo8a_58 Actin binding protein ABP1 {Baker's yeast (Sacchar 94.16
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 94.16
d1k9aa171 Carboxyl-terminal src kinase (csk) {Human (Homo sa 93.83
d1gl5a_67 tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 93.81
d1utia_57 Grb2-related adaptor protein 2 (Mona/Gads) {Mouse 93.55
d1qcfa165 Hemapoetic cell kinase Hck {Human (Homo sapiens) [ 93.35
d2iima162 p56-lck tyrosine kinase, SH3 domain {Human (Homo s 92.98
d1arka_60 SH3 domain from nebulin {Human (Homo sapiens) [Tax 92.78
d1gcqa_56 Growth factor receptor-bound protein 2 (GRB2), N- 92.75
d1opka157 Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul 92.63
d1zuua156 BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 92.59
d1wfwa_74 Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} 92.38
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 92.16
d1u5sa171 Nck-2 {Human (Homo sapiens) [TaxId: 9606]} 92.09
d1ycsb263 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 92.08
d1k4us_62 p67phox {Human (Homo sapiens) [TaxId: 9606]} 92.01
d1ugva_72 Olygophrenin-1 like protein (KIAA0621) {Human (Hom 91.91
d1ue9a_80 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 91.87
d1wiea_96 RIM binding protein 2, RIMBP2 {Human (Homo sapiens 91.85
d1u06a155 alpha-Spectrin, SH3 domain {Chicken (Gallus gallus 91.69
d1ng2a158 p47pox (neutrophil cytosolic factor 1) {Human (Hom 91.53
d2rn8a153 Bruton's tyrosine kinase {Mus musculus [TaxId: 100 91.32
d1wlpb153 p47pox (neutrophil cytosolic factor 1) {Human (Hom 91.21
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 91.17
d1awwa_67 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 90.22
d1sema_58 Growth factor receptor-bound protein 2 (GRB2), N- 90.17
d1uj0a_58 Signal transducing adaptor molecule Stam2 {Mouse ( 89.87
d1ckaa_57 C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) 89.67
d1gria156 Growth factor receptor-bound protein 2 (GRB2), N- 89.38
d1phta_83 Phosphatidylinositol 3-kinase (p85-alpha subunit, 89.31
d1ujya_76 Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 89.19
d1i07a_59 EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 88.28
d1uhca_79 Hypothetical protein Baa76854.1 (KIAA1010) {Human 87.89
d1uhfa_69 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 87.75
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 87.71
d1ug1a_92 Hypothetical protein Baa76854.1 (KIAA1010) {Human 87.01
d1zyla1325 RdoA {Escherichia coli [TaxId: 562]} 87.01
d1uffa_93 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 86.36
d1udla_98 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 85.89
d1i1ja_106 Melanoma inhibitory activity protein {Human (Homo 85.76
d1j3ta_74 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 85.43
d2hspa_71 Phospholipase C, SH3 domain {Human (Homo sapiens) 83.89
d2v1ra167 Peroxisomal membrane protein Pex13p {Baker's yeast 82.54
d1ng2a2118 p47pox (neutrophil cytosolic factor 1) {Human (Hom 81.36
d1oota_58 Hypothetical protein YFR024c {Baker's yeast (Sacch 80.81
d1bb9a_83 Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 80.05
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Fl cytokine receptor
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=8.2e-44  Score=297.94  Aligned_cols=175  Identities=22%  Similarity=0.445  Sum_probs=151.5

Q ss_pred             CcccccchhHHHHHhcCCCC------------------------------CCCchhhHHhhhhhhCCcccCCCCCCCceE
Q psy2787           1 MSANFAELNAFQENYTEPCR------------------------------KPLPPERRGYGTFSVNNICSCQFSSSSLLI   50 (251)
Q Consensus         1 ~~~e~~~l~~l~~~~~~~~~------------------------------~~~~~~~~gl~~lH~~~iiHrdlkp~ni~i   50 (251)
                      |.+||++.|+|.+.+.....                              .++.|+++||+|||+++|+||||||+|  |
T Consensus       118 lv~Ey~~~g~L~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~i~~qi~~gl~yLH~~~IiHRDlKp~N--i  195 (325)
T d1rjba_         118 LIFEYCCYGDLLNYLRSKREKFSEDEIEYENQKRLEEEEDLNVLTFEDLLCFAYQVAKGMEFLEFKSCVHRDLAARN--V  195 (325)
T ss_dssp             EEEECCTTCBHHHHHHTTTTCC---------------------CCHHHHHHHHHHHHHHHHHHHHTTEEETTCSGGG--E
T ss_pred             EEEEcCCCCcHHHHHHhccCCCcchhhhhccccccccccccCCCCHHHHHHHHHHHHHHHHHHHhCCeeeccCchhc--c
Confidence            46899999999998764322                              245688899999999999999999999  9


Q ss_pred             EEccCCceEEccCCCCcccCCC-ceeecCCCCcCcccCCCcccCCCCCCchhHHHHHHHHHHHHHhCCCCCCCCCChhHH
Q psy2787          51 LFFSSSSSSSGDFGMMRYSQND-CYVMTERKPLPCPWCPMESLKHNQFSQASDAWMFGVTIWEMFTFGAEPWVGLNGMQI  129 (251)
Q Consensus        51 l~~~~~~~kl~DFGla~~~~~~-~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Di~S~G~il~el~~~g~~pf~~~~~~~~  129 (251)
                      +++.++.+||+|||+|+..... .........+|+.|||||++.+..++.++|||||||++|||+++|..||.+.+..+.
T Consensus       196 ll~~~~~~Kl~DFGla~~~~~~~~~~~~~~~~gt~~y~aPE~l~~~~~~~~~DiwS~Gvil~emlt~g~~Pf~~~~~~~~  275 (325)
T d1rjba_         196 LVTHGKVVKICDFGLARDIMSDSNYVVRGNARLPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDAN  275 (325)
T ss_dssp             EEETTTEEEECCCGGGSCGGGCTTSEEETTEEECGGGCCHHHHHHCCCCHHHHHHHHHHHHHHHTTTSCCSSTTCCCSHH
T ss_pred             ccccCCeEEEeeccccccccCCCceeeeccccCCCccCChHHHcCCCCCcceeccchhHHHHHHHhCCCCCCCCCCHHHH
Confidence            9999999999999999874332 233445567899999999999999999999999999999999768999998777666


Q ss_pred             HHHHHhcCCCCCCCCCCcHHHHHHHHHHhccCCCCCCCHHHHHHHHHh
Q psy2787         130 LQKIDREGERLPRPEACPVEVYALMRQCWSKNPAERPKFSTLKDCLYR  177 (251)
Q Consensus       130 ~~~i~~~~~~~~~~~~~~~~~~~li~~cl~~dP~~Rps~~~il~~l~~  177 (251)
                      ...+...+.+++.|..+++++.+|+.+||+.||++|||+++|+++|..
T Consensus       276 ~~~~~~~~~~~~~p~~~~~~l~~li~~cl~~dP~~RPt~~ei~~~L~~  323 (325)
T d1rjba_         276 FYKLIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGC  323 (325)
T ss_dssp             HHHHHHTTCCCCCCTTCCHHHHHHHHHHTCSSGGGSCCHHHHHHHHHH
T ss_pred             HHHHHhcCCCCCCCCcCCHHHHHHHHHHcCCChhHCcCHHHHHHHHhC
Confidence            666667888888889999999999999999999999999999999863



>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure