Psyllid ID: psy3183


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120------
MQTYNMIINVGIDKIPFPKHVTRTAQSLIKALCKESPAERLGYQRGGIVDIKKHKWFQGFDWDGLRNQTLTPPIIPVIKGPTDTSNFDRYSAENDIKGPTDTSNFDRYSAENDVPPDETSNWDCDF
cHHHHHHHHcccccccccccccHHHHHHHHHHHccccccccccccccHHHHHcccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cHHHHHHHHcccccccccccccHHHHHHHHHHccccccccccccccccHHHHccHHHccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccc
MQTYNMIINVgidkipfpkhvTRTAQSLIKALCKespaerlgyqrggivdikkhkwfqgfdwdglrnqtltppiipvikgptdtsnfdrysaendikgptdtsnfdrysaendvppdetsnwdcdf
MQTYNMIInvgidkipfpkHVTRTAQSLIKALCkespaerlgyqrggivdIKKHKWFQGFDWDGLRNQTLtppiipvikgptdtSNFDRYSAEndikgptdtsnfdrysaendvppdetsnwdcdf
MQTYNMIINVGIDKIPFPKHVTRTAQSLIKALCKESPAERLGYQRGGIVDIKKHKWFQGFDWDGLRNQTLTPPIIPVIKGPTDTSNFDRYSAENDIKGPTDTSNFDRYSAENDVPPDETSNWDCDF
***YNMIINVGIDKIPFPKHVTRTAQSLIKALCKESPAERLGYQRGGIVDIKKHKWFQGFDWDGLRNQTLTPPIIPVIKG**********************************************
MQTYNMIINVGIDKIPFPKHVTRTAQSLIKALCKESPAERLGYQRGGIVDIKKHKWFQGFDWDGLRNQTLTPPIIPVIKGPTDTSNFDRYSAENDI**PTDTSNFDRYSAENDVPPDETSNWDCDF
MQTYNMIINVGIDKIPFPKHVTRTAQSLIKALCKESPAERLGYQRGGIVDIKKHKWFQGFDWDGLRNQTLTPPIIPVIKGPTDTSNFDRYSAENDIKGPTDTSNFDRYSAE***************
MQTYNMIINVGIDKIPFPKHVTRTAQSLIKALCKESPAERLGYQRGGIVDIKKHKWFQGFDWDGLRNQTLTPPIIPVIKGPTDTSNFDRYSA**********************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQTYNMIINVGIDKIPFPKHVTRTAQSLIKALCKESPAERLGYQRGGIVDIKKHKWFQGFDWDGLRNQTLTPPIIPVIKGPTDTSNFDRYSAENDIKGPTDTSNFDRYSAENDVPPDETSNWDCDF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query126 2.2.26 [Sep-21-2011]
Q03042768 cGMP-dependent protein ki yes N/A 0.849 0.139 0.539 4e-33
Q13976671 cGMP-dependent protein ki no N/A 0.857 0.160 0.5 7e-31
P00516671 cGMP-dependent protein ki yes N/A 0.857 0.160 0.5 7e-31
O77676671 cGMP-dependent protein ki yes N/A 0.857 0.160 0.5 1e-30
P0C605671 cGMP-dependent protein ki no N/A 0.857 0.160 0.492 3e-30
O76360780 cGMP-dependent protein ki yes N/A 0.849 0.137 0.456 9e-29
A8X6H1749 cGMP-dependent protein ki N/A N/A 0.849 0.142 0.456 9e-29
P32023934 cGMP-dependent protein ki no N/A 0.682 0.092 0.620 5e-27
Q030431088 cGMP-dependent protein ki no N/A 0.682 0.079 0.620 1e-26
Q13237762 cGMP-dependent protein ki no N/A 0.849 0.140 0.444 9e-26
>sp|Q03042|KGP1_DROME cGMP-dependent protein kinase, isozyme 1 OS=Drosophila melanogaster GN=Pkg21D PE=1 SV=2 Back     alignment and function desciption
 Score =  139 bits (351), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 68/126 (53%), Positives = 79/126 (62%), Gaps = 19/126 (15%)

Query: 1   MQTYNMIINVGIDKIPFPKHVTRTAQSLIKALCKESPAERLGYQRGGIVDIKKHKWFQGF 60
           MQTYN+I+  GID I FPKH++R A  LIK LC++ P+ERLGYQ GGI DIKKHKWF GF
Sbjct: 662 MQTYNLILK-GIDMIAFPKHISRWAVQLIKRLCRDVPSERLGYQTGGIQDIKKHKWFLGF 720

Query: 61  DWDGLRNQTLTPPIIPVIKGPTDTSNFDRYSAENDIKGPTDTSNFDRYSAENDVPPDETS 120
           DWDGL +Q L PP +  I  PTD   FDR+        P D +           PPDE S
Sbjct: 721 DWDGLASQLLIPPFVRPIAHPTDVRYFDRF--------PCDLNE----------PPDELS 762

Query: 121 NWDCDF 126
            WD DF
Sbjct: 763 GWDADF 768





Drosophila melanogaster (taxid: 7227)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1EC: 2
>sp|Q13976|KGP1_HUMAN cGMP-dependent protein kinase 1 OS=Homo sapiens GN=PRKG1 PE=1 SV=3 Back     alignment and function description
>sp|P00516|KGP1_BOVIN cGMP-dependent protein kinase 1 OS=Bos taurus GN=PRKG1 PE=1 SV=2 Back     alignment and function description
>sp|O77676|KGP1_RABIT cGMP-dependent protein kinase 1 OS=Oryctolagus cuniculus GN=PRKG1 PE=1 SV=3 Back     alignment and function description
>sp|P0C605|KGP1_MOUSE cGMP-dependent protein kinase 1 OS=Mus musculus GN=Prkg1 PE=1 SV=1 Back     alignment and function description
>sp|O76360|EGL4_CAEEL cGMP-dependent protein kinase egl-4 OS=Caenorhabditis elegans GN=egl-4 PE=1 SV=2 Back     alignment and function description
>sp|A8X6H1|EGL4_CAEBR cGMP-dependent protein kinase egl-4 OS=Caenorhabditis briggsae GN=egl-4 PE=3 SV=2 Back     alignment and function description
>sp|P32023|KGP25_DROME cGMP-dependent protein kinase, isozyme 2 forms cD5/T2 OS=Drosophila melanogaster GN=for PE=2 SV=3 Back     alignment and function description
>sp|Q03043|KGP24_DROME cGMP-dependent protein kinase, isozyme 2 forms cD4/T1/T3A/T3B OS=Drosophila melanogaster GN=for PE=1 SV=3 Back     alignment and function description
>sp|Q13237|KGP2_HUMAN cGMP-dependent protein kinase 2 OS=Homo sapiens GN=PRKG2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query126
242024535 1045 cGMP-dependent protein kinase, isozyme, 0.849 0.102 0.579 1e-35
321476601 655 hypothetical protein DAPPUDRAFT_207381 [ 0.849 0.163 0.571 9e-34
260830800 573 hypothetical protein BRAFLDRAFT_277757 [ 0.849 0.186 0.539 2e-33
241557549 592 cAMP-dependent protein kinase catalytic 0.849 0.180 0.547 4e-33
157111148 1288 cgmp-dependent protein kinase [Aedes aeg 0.849 0.083 0.555 6e-33
91094575 948 PREDICTED: similar to cgmp-dependent pro 0.849 0.112 0.551 2e-32
322785849 526 hypothetical protein SINV_08925 [Solenop 0.857 0.205 0.523 2e-32
291220954 247 PREDICTED: protein kinase, cGMP-dependen 0.849 0.433 0.547 2e-32
325297092 733 PKG [Aplysia californica] gi|37964177|gb 0.849 0.145 0.539 4e-32
405972747 760 cGMP-dependent protein kinase, isozyme 1 0.849 0.140 0.539 5e-32
>gi|242024535|ref|XP_002432683.1| cGMP-dependent protein kinase, isozyme, putative [Pediculus humanus corporis] gi|212518153|gb|EEB19945.1| cGMP-dependent protein kinase, isozyme, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 73/126 (57%), Positives = 87/126 (69%), Gaps = 19/126 (15%)

Query: 1    MQTYNMIINVGIDKIPFPKHVTRTAQSLIKALCKESPAERLGYQRGGIVDIKKHKWFQGF 60
            M+TYN+I+  GID I FPKH+T+ AQSLIK LC++SP+ERLGYQRGGI DIKKHKWFQGF
Sbjct: 939  MRTYNIILK-GIDVIDFPKHITKGAQSLIKRLCRDSPSERLGYQRGGIQDIKKHKWFQGF 997

Query: 61   DWDGLRNQTLTPPIIPVIKGPTDTSNFDRYSAENDIKGPTDTSNFDRYSAENDVPPDETS 120
            DW GL+ + L PP+ P+++ PTDT                  SNFD YS E  VPPDE S
Sbjct: 998  DWSGLKQRALIPPVAPIVRSPTDT------------------SNFDSYSKETVVPPDEFS 1039

Query: 121  NWDCDF 126
             WD  F
Sbjct: 1040 CWDAKF 1045




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|321476601|gb|EFX87561.1| hypothetical protein DAPPUDRAFT_207381 [Daphnia pulex] Back     alignment and taxonomy information
>gi|260830800|ref|XP_002610348.1| hypothetical protein BRAFLDRAFT_277757 [Branchiostoma floridae] gi|229295713|gb|EEN66358.1| hypothetical protein BRAFLDRAFT_277757 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|241557549|ref|XP_002399970.1| cAMP-dependent protein kinase catalytic subunit, putative [Ixodes scapularis] gi|215499728|gb|EEC09222.1| cAMP-dependent protein kinase catalytic subunit, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|157111148|ref|XP_001651409.1| cgmp-dependent protein kinase [Aedes aegypti] gi|108878512|gb|EAT42737.1| AAEL005754-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|91094575|ref|XP_968718.1| PREDICTED: similar to cgmp-dependent protein kinase [Tribolium castaneum] gi|270016394|gb|EFA12840.1| hypothetical protein TcasGA2_TC006940 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|322785849|gb|EFZ12468.1| hypothetical protein SINV_08925 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|291220954|ref|XP_002730488.1| PREDICTED: protein kinase, cGMP-dependent, type I beta-like, partial [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|325297092|ref|NP_001191554.1| PKG [Aplysia californica] gi|37964177|gb|AAR06171.1| PKG [Aplysia californica] Back     alignment and taxonomy information
>gi|405972747|gb|EKC37497.1| cGMP-dependent protein kinase, isozyme 1 [Crassostrea gigas] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query126
UNIPROTKB|J9NWY9474 PRKG1 "Uncharacterized protein 0.833 0.221 0.556 2.3e-30
UNIPROTKB|Q5JP05283 PRKG1 "cGMP-dependent protein 0.833 0.371 0.556 2.3e-30
UNIPROTKB|J9JHE0489 PRKG1 "Uncharacterized protein 0.833 0.214 0.556 2.4e-30
UNIPROTKB|F1SD02459 PRKG1 "Uncharacterized protein 0.833 0.228 0.547 7.9e-30
UNIPROTKB|Q5SQU3659 PRKG1 "cGMP-dependent protein 0.833 0.159 0.556 1.4e-29
UNIPROTKB|P00516671 PRKG1 "cGMP-dependent protein 0.833 0.156 0.556 1.5e-29
UNIPROTKB|Q13976671 PRKG1 "cGMP-dependent protein 0.833 0.156 0.556 1.5e-29
UNIPROTKB|F1NE85685 F1NE85 "cGMP-dependent protein 0.833 0.153 0.556 1.6e-29
UNIPROTKB|F1MY76686 PRKG1 "cGMP-dependent protein 0.833 0.153 0.556 1.6e-29
UNIPROTKB|O77676671 PRKG1 "cGMP-dependent protein 0.833 0.156 0.556 2e-29
UNIPROTKB|J9NWY9 PRKG1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 335 (123.0 bits), Expect = 2.3e-30, P = 2.3e-30
 Identities = 59/106 (55%), Positives = 79/106 (74%)

Query:     1 MQTYNMIINVGIDKIPFPKHVTRTAQSLIKALCKESPAERLGYQRGGIVDIKKHKWFQGF 60
             M+TYN+I+  GID I FPK + + A +LIK LC+++P+ERLG  + G+ DI+KHKWF+GF
Sbjct:   367 MKTYNIILR-GIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGF 425

Query:    61 DWDGLRNQTLTPPIIPVIKGPTDTSNFDRYSAENDIKGPTDTSNFD 106
             +W+GLR  TLTPPIIP +  PTDTSNFD +  +ND   P D S +D
Sbjct:   426 NWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWD 471


GO:0005524 "ATP binding" evidence=IEA
GO:0004692 "cGMP-dependent protein kinase activity" evidence=IEA
UNIPROTKB|Q5JP05 PRKG1 "cGMP-dependent protein kinase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9JHE0 PRKG1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SD02 PRKG1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5SQU3 PRKG1 "cGMP-dependent protein kinase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P00516 PRKG1 "cGMP-dependent protein kinase 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q13976 PRKG1 "cGMP-dependent protein kinase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NE85 F1NE85 "cGMP-dependent protein kinase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MY76 PRKG1 "cGMP-dependent protein kinase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O77676 PRKG1 "cGMP-dependent protein kinase 1" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q03042KGP1_DROME2, ., 7, ., 1, 1, ., 1, 20.53960.84920.1393yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query126
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 2e-30
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 1e-25
cd05612291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 3e-21
cd05589324 cd05589, STKc_PKN, Catalytic domain of the Protein 2e-19
cd05597331 cd05597, STKc_DMPK_like, Catalytic domain of Myoto 3e-19
cd05599364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 4e-19
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 3e-18
cd05570318 cd05570, STKc_PKC, Catalytic domain of the Protein 9e-18
PTZ00263329 PTZ00263, PTZ00263, protein kinase A catalytic sub 1e-17
cd05582318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 2e-17
cd05587324 cd05587, STKc_cPKC, Catalytic domain of the Protei 8e-15
cd05586330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 8e-14
cd05598376 cd05598, STKc_LATS, Catalytic domain of the Protei 9e-14
cd05574316 cd05574, STKc_phototropin_like, Catalytic domain o 1e-13
cd05584323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 1e-13
cd05592316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 2e-13
cd05624331 cd05624, STKc_MRCK_beta, Catalytic domain of the P 2e-13
cd05575323 cd05575, STKc_SGK, Catalytic domain of the Protein 4e-13
cd05583288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 1e-12
cd05591321 cd05591, STKc_nPKC_epsilon, Catalytic domain of th 1e-12
cd05623332 cd05623, STKc_MRCK_alpha, Catalytic domain of the 2e-12
cd05614332 cd05614, STKc_MSK2_N, N-terminal catalytic domain 2e-12
cd05585312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 3e-12
cd05601330 cd05601, STKc_CRIK, Catalytic domain of the Protei 3e-12
cd05590320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 3e-12
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 5e-12
cd05595323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 8e-12
cd05616323 cd05616, STKc_cPKC_beta, Catalytic domain of the P 2e-11
cd05571323 cd05571, STKc_PKB, Catalytic domain of the Protein 3e-11
cd05615323 cd05615, STKc_cPKC_alpha, Catalytic domain of the 4e-11
cd05609305 cd05609, STKc_MAST, Catalytic domain of the Protei 4e-11
cd05588329 cd05588, STKc_aPKC, Catalytic domain of the Protei 4e-11
cd05594325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 6e-11
cd05619316 cd05619, STKc_nPKC_theta, Catalytic domain of the 6e-11
cd05617327 cd05617, STKc_aPKC_zeta, Catalytic domain of the P 6e-11
cd05629377 cd05629, STKc_NDR_like_fungal, Catalytic domain of 2e-10
smart0013364 smart00133, S_TK_X, Extension to Ser/Thr-type prot 4e-10
cd05602325 cd05602, STKc_SGK1, Catalytic domain of the Protei 5e-10
cd05620316 cd05620, STKc_nPKC_delta, Catalytic domain of the 5e-10
cd05618329 cd05618, STKc_aPKC_iota, Catalytic domain of the P 5e-10
cd05593328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 9e-10
PTZ00426340 PTZ00426, PTZ00426, cAMP-dependent protein kinase 2e-09
cd05596370 cd05596, STKc_ROCK, Catalytic domain of the Protei 4e-09
cd05627360 cd05627, STKc_NDR2, Catalytic domain of the Protei 1e-08
cd05600333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 1e-08
cd05604325 cd05604, STKc_SGK3, Catalytic domain of the Protei 1e-08
cd05577277 cd05577, STKc_GRK, Catalytic domain of the Protein 2e-08
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 2e-08
cd05625382 cd05625, STKc_LATS1, Catalytic domain of the Prote 7e-08
cd05603321 cd05603, STKc_SGK2, Catalytic domain of the Protei 8e-08
cd05610669 cd05610, STKc_MASTL, Catalytic domain of the Prote 9e-08
cd05628363 cd05628, STKc_NDR1, Catalytic domain of the Protei 1e-07
cd05605285 cd05605, STKc_GRK4_like, Catalytic domain of G pro 4e-07
cd05613290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 4e-07
cd05606278 cd05606, STKc_beta_ARK, Catalytic domain of the Pr 9e-07
cd05576237 cd05576, STKc_RPK118_like, Catalytic domain of the 1e-06
cd05608280 cd05608, STKc_GRK1, Catalytic domain of the Protei 1e-06
cd05626381 cd05626, STKc_LATS2, Catalytic domain of the Prote 1e-06
cd05621370 cd05621, STKc_ROCK2, Catalytic domain of the Prote 1e-06
cd05633279 cd05633, STKc_GRK3, Catalytic domain of the Protei 1e-06
cd05630285 cd05630, STKc_GRK6, Catalytic domain of the Protei 4e-06
cd05632285 cd05632, STKc_GRK5, Catalytic domain of the Protei 4e-05
cd05622371 cd05622, STKc_ROCK1, Catalytic domain of the Prote 7e-05
cd05631285 cd05631, STKc_GRK4, Catalytic domain of the Protei 1e-04
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 3e-04
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 0.001
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 0.002
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
 Score =  109 bits (276), Expect = 2e-30
 Identities = 37/90 (41%), Positives = 50/90 (55%), Gaps = 3/90 (3%)

Query: 1   MQTYNMIINVGIDKIPFPKHVTRTAQSLIKALCKESPAERLGYQRGGIVDIKKHKWFQGF 60
           +Q Y  I+     K+ FP   +  A+ LI+ L +    +RLG  + G+ DIK H WF G 
Sbjct: 204 IQIYEKILE---GKVRFPSFFSPDAKDLIRNLLQVDLTKRLGNLKNGVNDIKNHPWFAGI 260

Query: 61  DWDGLRNQTLTPPIIPVIKGPTDTSNFDRY 90
           DW  L  + +  P IP +KGP DTSNFD Y
Sbjct: 261 DWIALLQRKIEAPFIPKVKGPGDTSNFDDY 290


Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This subfamily is composed of the cAMP-dependent proteins kinases, PKA and PRKX. The inactive PKA holoenzyme is a heterotetramer composed of two phosphorylated and active catalytic (C) subunits with a dimer of regulatory (R) subunits. Activation is achieved through the binding of the important second messenger cAMP to the R subunits, which leads to the dissociation of PKA into the R dimer and two active C subunits. PKA is present ubiquitously in cells and interacts with many different downstream targets. It plays a role in the regulation of diverse processes such as growth, development, memory, metabolism, gene expression, immunity, and lipolysis. Length = 290

>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|214529 smart00133, S_TK_X, Extension to Ser/Thr-type protein kinases Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>gnl|CDD|173667 cd05576, STKc_RPK118_like, Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 126
KOG0694|consensus694 99.92
KOG0614|consensus732 99.91
KOG0696|consensus683 99.88
KOG0690|consensus516 99.87
KOG0605|consensus550 99.86
KOG0616|consensus355 99.86
KOG0695|consensus593 99.83
KOG0598|consensus357 99.8
KOG0612|consensus 1317 99.75
KOG0986|consensus591 99.74
KOG0610|consensus459 99.62
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.56
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.53
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.53
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.5
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.48
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.48
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.47
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.46
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.44
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 99.44
KOG0608|consensus1034 99.43
PTZ00263329 protein kinase A catalytic subunit; Provisional 99.43
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.42
KOG0603|consensus 612 99.42
KOG0592|consensus 604 99.42
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.41
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.41
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.39
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.39
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.38
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.37
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.37
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.31
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.31
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.31
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 99.27
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.24
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.23
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.21
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.2
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.2
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.18
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.17
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.17
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.15
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.14
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.13
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.13
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.13
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.1
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.04
smart0013364 S_TK_X Extension to Ser/Thr-type protein kinases. 99.0
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 98.98
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 98.97
KOG0606|consensus 1205 98.97
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 98.95
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 98.95
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 98.91
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 98.88
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 98.82
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 98.81
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 98.79
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 98.79
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 98.77
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 98.77
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 98.72
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 98.72
KOG0033|consensus355 98.71
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 98.7
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 98.65
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 98.63
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 98.59
KOG0588|consensus 786 98.58
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 98.58
KOG0606|consensus1205 98.58
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 98.56
KOG0575|consensus 592 98.55
KOG0615|consensus475 98.5
KOG0580|consensus281 98.49
KOG4717|consensus 864 98.48
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 98.46
KOG0583|consensus370 98.45
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 98.43
cd05610669 STKc_MASTL Catalytic domain of the Protein Serine/ 98.42
KOG0585|consensus 576 98.39
KOG0604|consensus400 98.38
KOG0599|consensus411 98.28
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 98.28
KOG0607|consensus463 98.25
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 98.22
KOG0581|consensus364 98.2
KOG0603|consensus612 98.04
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 98.01
KOG0032|consensus382 97.98
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 97.97
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 97.86
PTZ00036440 glycogen synthase kinase; Provisional 97.86
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 97.83
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 97.75
PHA03209357 serine/threonine kinase US3; Provisional 97.74
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 97.7
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 97.66
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 97.66
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 97.65
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 97.65
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 97.64
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 97.63
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 97.63
KOG0597|consensus 808 97.62
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 97.61
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 97.59
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 97.58
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 97.58
PHA03207392 serine/threonine kinase US3; Provisional 97.57
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 97.57
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 97.56
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 97.55
PLN00034353 mitogen-activated protein kinase kinase; Provision 97.53
PTZ00284467 protein kinase; Provisional 97.52
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 97.52
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 97.52
KOG0198|consensus313 97.52
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 97.51
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 97.5
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 97.49
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 97.48
KOG0660|consensus359 97.48
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 97.47
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 97.47
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 97.47
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 97.47
KOG0578|consensus550 97.45
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 97.45
PF0043348 Pkinase_C: Protein kinase C terminal domain; Inter 97.44
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 97.41
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 97.39
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 97.39
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 97.38
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 97.35
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 97.35
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 97.35
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 97.34
PHA03210501 serine/threonine kinase US3; Provisional 97.34
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 97.31
PHA03211461 serine/threonine kinase US3; Provisional 97.31
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 97.31
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 97.31
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 97.31
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 97.31
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 97.3
KOG0579|consensus 1187 97.29
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 97.29
PLN00009294 cyclin-dependent kinase A; Provisional 97.29
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 97.29
PHA03212391 serine/threonine kinase US3; Provisional 97.29
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 97.29
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 97.29
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 97.28
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 97.27
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 97.27
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 97.26
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 97.25
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 97.24
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 97.23
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 97.22
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 97.22
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 97.22
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 97.21
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 97.21
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 97.2
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 97.19
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 97.18
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 97.18
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 97.17
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 97.16
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 97.16
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 97.14
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 97.13
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 97.13
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 97.12
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 97.12
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 97.12
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 97.11
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 97.11
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 97.1
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 97.09
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 97.09
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 97.08
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 97.08
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 97.08
PTZ00024335 cyclin-dependent protein kinase; Provisional 97.07
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 97.07
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 97.07
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 97.03
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 97.02
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 97.02
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 97.01
PLN03224507 probable serine/threonine protein kinase; Provisio 97.01
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 96.98
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 96.94
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 96.93
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 96.91
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 96.91
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 96.91
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 96.86
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 96.86
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 96.85
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 96.84
KOG0586|consensus 596 96.82
KOG0593|consensus396 96.81
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 96.8
KOG0671|consensus415 96.8
KOG0661|consensus 538 96.78
KOG0983|consensus391 96.76
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 96.74
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 96.73
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 96.71
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 96.71
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 96.7
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 96.7
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 96.7
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 96.69
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 96.68
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 96.68
PTZ00283 496 serine/threonine protein kinase; Provisional 96.67
KOG0596|consensus677 96.64
KOG0663|consensus419 96.64
KOG0665|consensus369 96.63
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 96.6
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 96.58
KOG0668|consensus338 96.56
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 96.55
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 96.55
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 96.53
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 96.53
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 96.52
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 96.52
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 96.52
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 96.51
KOG0659|consensus318 96.49
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 96.46
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 96.45
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 96.44
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 96.41
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 96.4
PTZ00267478 NIMA-related protein kinase; Provisional 96.39
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 96.34
KOG1290|consensus590 96.32
KOG1167|consensus418 96.3
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 96.25
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 96.23
KOG0582|consensus 516 96.16
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 96.15
KOG4236|consensus888 96.12
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 96.06
KOG0584|consensus 632 96.06
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 96.03
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 96.02
KOG0666|consensus438 96.01
KOG1027|consensus903 95.99
KOG0658|consensus364 95.92
KOG0669|consensus376 95.85
PHA02988283 hypothetical protein; Provisional 95.67
KOG4645|consensus1509 95.59
KOG0594|consensus323 95.47
KOG0670|consensus752 95.47
KOG0667|consensus586 95.4
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 95.39
KOG0201|consensus 467 95.28
KOG0662|consensus292 95.2
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 95.16
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 95.05
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 95.03
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 95.0
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 94.94
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 94.91
KOG1151|consensus775 94.87
KOG0611|consensus 668 94.83
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 94.82
PTZ00266 1021 NIMA-related protein kinase; Provisional 94.71
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 94.71
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 94.63
KOG0574|consensus 502 94.6
KOG0600|consensus560 94.39
KOG1989|consensus 738 94.27
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 94.26
KOG0590|consensus601 94.22
KOG4279|consensus 1226 94.14
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 94.03
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 94.0
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 93.95
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 93.93
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 93.88
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 93.84
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 93.66
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 93.57
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 93.54
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 93.51
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 93.5
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 93.45
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 93.39
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 93.29
KOG2345|consensus302 93.28
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 93.26
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 93.25
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 93.17
PLN00181 793 protein SPA1-RELATED; Provisional 93.17
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 93.17
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 93.08
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 93.04
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 93.0
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 92.83
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 92.82
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 92.79
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 92.68
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 92.63
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 92.6
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 92.59
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 92.55
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 92.54
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 92.53
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 92.42
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 92.31
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 92.21
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 92.15
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 92.14
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 92.05
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 91.99
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 91.88
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 91.85
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 91.84
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 91.74
KOG0589|consensus426 91.66
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 91.65
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 91.6
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 91.6
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 91.44
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 91.41
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 91.39
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 91.31
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 91.28
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 91.18
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 91.07
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 91.05
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 91.02
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 91.01
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 90.69
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 90.57
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 90.34
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 90.17
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 90.14
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 90.13
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 90.1
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 89.98
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 89.94
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 89.78
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 89.64
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 89.31
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 89.16
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 88.89
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 88.75
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 88.7
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 88.69
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 87.6
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 87.54
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 87.47
KOG1035|consensus 1351 87.26
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 87.14
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 87.04
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 87.0
KOG0591|consensus375 85.57
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 82.34
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 82.3
>KOG0694|consensus Back     alignment and domain information
Probab=99.92  E-value=1.7e-25  Score=179.46  Aligned_cols=109  Identities=33%  Similarity=0.749  Sum_probs=102.2

Q ss_pred             hHHHHHHhcCCCcccCCCCCCHHHHHHHHHhhhcCcCccCCCCCCChhhhccCCCCCCCChhHHhcCCCCCCcccCCCCC
Q psy3183           2 QTYNMIINVGIDKIPFPKHVTRTAQSLIKALCKESPAERLGYQRGGIVDIKKHKWFQGFDWDGLRNQTLTPPIIPVIKGP   81 (126)
Q Consensus         2 ~l~~~I~~~~~~~~~~p~~~s~~a~dli~~lL~~dp~~Rl~~~~~g~~~i~~hp~f~~v~w~~l~~~~~~ppf~P~~~~~   81 (126)
                      ++|..|+   .+.+.||.++|.++.+++++||+++|.+|||++.+|+++|+.||||+.|+|++|++|+++|||+|.++++
T Consensus       575 e~FdsI~---~d~~~yP~~ls~ea~~il~~ll~k~p~kRLG~~e~d~~~i~~hpFFr~i~w~~L~~r~i~PPf~P~i~~~  651 (694)
T KOG0694|consen  575 EVFDSIV---NDEVRYPRFLSKEAIAIMRRLLRKNPEKRLGSGERDAEDIKKHPFFRSIDWDDLLNRRIKPPFVPTIKGP  651 (694)
T ss_pred             HHHHHHh---cCCCCCCCcccHHHHHHHHHHhccCcccccCCCCCCchhhhhCCccccCCHHHHhhccCCCCCCcccCCh
Confidence            6899999   4589999999999999999999999999999988899999999999999999999999999999999999


Q ss_pred             CCCCCCCC-CCCCCCCCCCC--------CCCCCCCCccCCC
Q psy3183          82 TDTSNFDR-YSAENDIKGPT--------DTSNFDRYSAEND  113 (126)
Q Consensus        82 ~d~~~fd~-~~~e~~~~~~~--------~~~~f~~f~~~~~  113 (126)
                      .|.+|||. |+.|.+.+++.        ++.+|.+|+|.++
T Consensus       652 ~D~snFd~eFt~e~p~Lt~~~~~~l~~~~q~~F~~Fs~~~~  692 (694)
T KOG0694|consen  652 EDVSNFDEEFTSEKPALTPSDPRPLTEEEQEAFRDFSFVAE  692 (694)
T ss_pred             hhhcccchhhhcCCCccCCCCccccchhhHHHhcCccccCC
Confidence            99999997 99999998864        3779999999864



>KOG0614|consensus Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>KOG0695|consensus Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>KOG0608|consensus Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>smart00133 S_TK_X Extension to Ser/Thr-type protein kinases Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0588|consensus Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>KOG0575|consensus Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>KOG4717|consensus Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>KOG0607|consensus Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>KOG0660|consensus Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>PF00433 Pkinase_C: Protein kinase C terminal domain; InterPro: IPR017892 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0579|consensus Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>KOG0586|consensus Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0671|consensus Back     alignment and domain information
>KOG0661|consensus Back     alignment and domain information
>KOG0983|consensus Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0596|consensus Back     alignment and domain information
>KOG0663|consensus Back     alignment and domain information
>KOG0665|consensus Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG0668|consensus Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>KOG1290|consensus Back     alignment and domain information
>KOG1167|consensus Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>KOG0582|consensus Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>KOG0584|consensus Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0666|consensus Back     alignment and domain information
>KOG1027|consensus Back     alignment and domain information
>KOG0658|consensus Back     alignment and domain information
>KOG0669|consensus Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>KOG4645|consensus Back     alignment and domain information
>KOG0594|consensus Back     alignment and domain information
>KOG0670|consensus Back     alignment and domain information
>KOG0667|consensus Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>KOG0662|consensus Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>KOG1151|consensus Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>KOG0574|consensus Back     alignment and domain information
>KOG0600|consensus Back     alignment and domain information
>KOG1989|consensus Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>KOG2345|consensus Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>KOG0589|consensus Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query126
3fhi_A350 Crystal Structure Of A Complex Between The Catalyti 7e-14
1fmo_E350 Crystal Structure Of A Polyhistidine-Tagged Recombi 8e-14
3o7l_B350 Crystal Structure Of Phospholamban (1-19):pka C-Sub 8e-14
1j3h_A350 Crystal Structure Of Apoenzyme Camp-Dependent Prote 8e-14
1rdq_E350 Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of 8e-14
4dfx_E350 Crystal Structure Of Myristoylated K7c Catalytic Su 8e-14
2gnf_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 8e-14
1jbp_E350 Crystal Structure Of The Catalytic Subunit Of Camp- 8e-14
2c1a_A351 Structure Of Camp-Dependent Protein Kinase Complexe 8e-14
2qcs_A350 A Complex Structure Between The Catalytic And Regul 8e-14
1bkx_A350 A Binary Complex Of The Catalytic Subunit Of Camp-D 8e-14
1l3r_E350 Crystal Structure Of A Transition State Mimic Of Th 8e-14
1syk_A350 Crystal Structure Of E230q Mutant Of Camp-Dependent 8e-14
2gnj_A350 Pka Three Fold Mutant Model Of Rho-Kinase With Y-27 8e-14
2erz_E351 Crystal Structure Of C-amp Dependent Kinase (pka) B 8e-14
3agm_A351 Complex Of Pka With The Bisubstrate Protein Kinase 8e-14
2gng_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 8e-14
1q61_A350 Pka Triple Mutant Model Of Pkb Length = 350 8e-14
3qam_E350 Crystal Structure Of Glu208ala Mutant Of Catalytic 8e-14
1apm_E350 2.0 Angstrom Refined Crystal Structure Of The Catal 9e-14
1q24_A350 Pka Double Mutant Model Of Pkb In Complex With Mgat 9e-14
3agl_A351 Complex Of Pka With The Bisubstrate Protein Kinase 9e-14
2jds_A351 Structure Of Camp-Dependent Protein Kinase Complexe 9e-14
1xh9_A350 Crystal Structures Of Protein Kinase B Selective In 9e-14
1svh_A350 Crystal Structure Of Protein Kinase A In Complex Wi 9e-14
1q8w_A350 The Catalytic Subunit Of Camp-Dependent Protein Kin 9e-14
1ctp_E350 Structure Of The Mammalian Catalytic Subunit Of Cam 9e-14
2gu8_A337 Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel 9e-14
1stc_E350 Camp-Dependent Protein Kinase, Alpha-Catalytic Subu 9e-14
1szm_A350 Dual Binding Mode Of Bisindolylmaleimide 2 To Prote 9e-14
4ae6_A343 Structure And Function Of The Human Sperm-specific 9e-14
3pvb_A345 Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca 9e-14
2jdt_A351 Structure Of Pka-Pkb Chimera Complexed With Isoquin 9e-14
1smh_A350 Protein Kinase A Variant Complex With Completely Or 9e-14
3ama_A351 Protein Kinase A Sixfold Mutant Model Of Aurora B W 9e-14
2vo0_A351 Structure Of Pka-Pkb Chimera Complexed With C-(4-(4 9e-14
2uvy_A351 Structure Of Pka-pkb Chimera Complexed With Methyl- 9e-14
2f7e_E351 Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoqu 9e-14
3l9m_A351 Crystal Structure Of Pkab3 (Pka Triple Mutant V123a 9e-14
4dg3_E371 Crystal Structure Of R336a Mutant Of Camp-dependent 9e-14
4dfy_A371 Crystal Structure Of R194a Mutant Of Camp-Dependent 9e-14
1xh7_A350 Crystal Structures Of Protein Kinase B Selective In 9e-14
4ae9_A343 Structure And Function Of The Human Sperm-specific 9e-14
3mvj_A371 Human Cyclic Amp-Dependent Protein Kinase Pka Inhib 1e-13
1ydt_E350 Structure Of Camp-Dependent Protein Kinase, Alpha-C 1e-13
3dnd_A350 Camp-Dependent Protein Kinase Pka Catalytic Subunit 1e-13
1cdk_A350 Camp-Dependent Protein Kinase Catalytic Subunit (E. 1e-13
1cmk_E350 Crystal Structures Of The Myristylated Catalytic Su 1e-13
2uzt_A336 Pka Structures Of Akt, Indazole-Pyridine Inhibitors 1e-13
3nx8_A351 Human Camp Dependent Protein Kinase In Complex With 3e-13
3qal_E350 Crystal Structure Of Arg280ala Mutant Of Catalytic 5e-13
2qur_A350 Crystal Structure Of F327aK285P MUTANT OF CAMP-Depe 4e-12
3tku_A433 Mrck Beta In Complex With Fasudil Length = 433 1e-11
3qfv_A415 Mrck Beta In Complex With Tpca-1 Length = 415 1e-11
3g51_A325 Structural Diversity Of The Active Conformation Of 5e-11
2z7q_A321 Crystal Structure Of The N-Terminal Kinase Domain O 7e-11
4aw2_A437 Crystal Structure Of Cdc42 Binding Protein Kinase A 1e-10
3iw4_A360 Crystal Structure Of Pkc Alpha In Complex With Nvp- 2e-09
4dc2_A396 Structure Of Pkc In Complex With A Substrate Peptid 3e-09
4ejn_A446 Crystal Structure Of Autoinhibited Form Of Akt1 In 4e-09
3o96_A446 Crystal Structure Of Human Akt1 With An Allosteric 4e-09
2vd5_A412 Structure Of Human Myotonic Dystrophy Protein Kinas 5e-09
3zh8_A349 A Novel Small Molecule Apkc Inhibitor Length = 349 5e-09
3a8w_A345 Crystal Structure Of Pkciota Kinase Domain Length = 5e-09
3a60_A327 Crystal Structure Of Unphosphorylated P70s6k1 (Form 5e-09
3a62_A327 Crystal Structure Of Phosphorylated P70s6k1 Length 5e-09
4gv1_A340 Pkb Alpha In Complex With Azd5363 Length = 340 6e-09
3ocb_A341 Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor 6e-09
3cqu_A342 Crystal Structure Of Akt-1 Complexed With Substrate 6e-09
3pfq_A674 Crystal Structure And Allosteric Activation Of Prot 9e-09
1fot_A318 Structure Of The Unliganded Camp-Dependent Protein 9e-09
1zrz_A364 Crystal Structure Of The Catalytic Domain Of Atypic 1e-08
4el9_A305 Structure Of N-Terminal Kinase Domain Of Rsk2 With 1e-08
3ubd_A304 Structure Of N-Terminal Domain Of Rsk2 Kinase In Co 1e-08
2i0e_A353 Structure Of Catalytic Domain Of Human Protein Kina 2e-08
2r5t_A373 Crystal Structure Of Inactive Serum And Glucocortic 3e-08
3e87_A335 Crystal Structures Of The Kinase Domain Of Akt2 In 6e-08
1vzo_A355 The Structure Of The N-Terminal Kinase Domain Of Ms 6e-08
1gzn_A335 Structure Of Pkb Kinase Domain Length = 335 6e-08
1o6k_A336 Structure Of Activated Form Of Pkb Kinase Domain S4 6e-08
1mrv_A339 Crystal Structure Of An Inactive Akt2 Kinase Domain 6e-08
2jed_A352 The Crystal Structure Of The Kinase Domain Of The P 7e-08
1xjd_A345 Crystal Structure Of Pkc-Theta Complexed With Staur 7e-08
2jdo_A342 Structure Of Pkb-Beta (Akt2) Complexed With Isoquin 8e-08
3txo_A353 Pkc Eta Kinase In Complex With A Naphthyridine Leng 8e-08
1o6l_A337 Crystal Structure Of An Activated Akt/protein Kinas 8e-08
1gzk_A315 Molecular Mechanism For The Regulation Of Protein K 1e-07
3qc9_A543 Crystal Structure Of Cross-Linked Bovine Grk1 T8cN4 2e-05
3c4x_A543 Crystal Structure Of G Protein Coupled Receptor Kin 2e-05
3c4w_A543 Crystal Structure Of G Protein Coupled Receptor Kin 2e-05
3t8o_A543 Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolu 2e-05
2f2u_A402 Crystal Structure Of The Rho-Kinase Kinase Domain L 6e-05
2v55_A406 Mechanism Of Multi-site Phosphorylation From A Rock 9e-05
2esm_A415 Crystal Structure Of Rock 1 Bound To Fasudil Length 1e-04
3v8s_A410 Human Rho-Associated Protein Kinase 1 (Rock 1) In C 1e-04
3nyn_A576 Crystal Structure Of G Protein-Coupled Receptor Kin 7e-04
2acx_A576 Crystal Structure Of G Protein Coupled Receptor Kin 8e-04
>pdb|3FHI|A Chain A, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 350 Back     alignment and structure

Iteration: 1

Score = 72.0 bits (175), Expect = 7e-14, Method: Compositional matrix adjust. Identities = 35/93 (37%), Positives = 50/93 (53%), Gaps = 3/93 (3%) Query: 1 MQTYNMIINVGIDKIPFPKHVTRTAQSLIKALCKESPAERLGYQRGGIVDIKKHKWFQGF 60 +Q Y I++ K+ FP H + + L++ L + +R G + G+ DIK HKWF Sbjct: 244 IQIYEKIVS---GKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATT 300 Query: 61 DWDGLRNQTLTPPIIPVIKGPTDTSNFDRYSAE 93 DW + + + P IP KGP DTSNFD Y E Sbjct: 301 DWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEE 333
>pdb|1FMO|E Chain E, Crystal Structure Of A Polyhistidine-Tagged Recombinant Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With The Peptide Inhibitor Pki(5-24) And Adenosine Length = 350 Back     alignment and structure
>pdb|3O7L|B Chain B, Crystal Structure Of Phospholamban (1-19):pka C-Subunit:amp-Pnp:mg2+ Complex Length = 350 Back     alignment and structure
>pdb|1J3H|A Chain A, Crystal Structure Of Apoenzyme Camp-Dependent Protein Kinase Catalytic Subunit Length = 350 Back     alignment and structure
>pdb|1RDQ|E Chain E, Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|4DFX|E Chain E, Crystal Structure Of Myristoylated K7c Catalytic Subunit Of Camp- Dependent Protein Kinase In Complex With Sp20 And Amp-Pnp Length = 350 Back     alignment and structure
>pdb|2GNF|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase With Y- 27632 Length = 350 Back     alignment and structure
>pdb|1JBP|E Chain E, Crystal Structure Of The Catalytic Subunit Of Camp- Dependent Protein Kinase Complexed With A Substrate Peptide, Adp And Detergent Length = 350 Back     alignment and structure
>pdb|2C1A|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With Isoquinoline-5-Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl)amide Length = 351 Back     alignment and structure
>pdb|2QCS|A Chain A, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 350 Back     alignment and structure
>pdb|1BKX|A Chain A, A Binary Complex Of The Catalytic Subunit Of Camp-Dependent Protein Kinase And Adenosine Further Defines Conformational Flexibility Length = 350 Back     alignment and structure
>pdb|1L3R|E Chain E, Crystal Structure Of A Transition State Mimic Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1SYK|A Chain A, Crystal Structure Of E230q Mutant Of Camp-Dependent Protein Kinase Reveals Unexpected Apoenzyme Conformation Length = 350 Back     alignment and structure
>pdb|2GNJ|A Chain A, Pka Three Fold Mutant Model Of Rho-Kinase With Y-27632 Length = 350 Back     alignment and structure
>pdb|2ERZ|E Chain E, Crystal Structure Of C-amp Dependent Kinase (pka) Bound To Hydroxyfasudil Length = 351 Back     alignment and structure
>pdb|3AGM|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-670 Length = 351 Back     alignment and structure
>pdb|2GNG|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase Length = 350 Back     alignment and structure
>pdb|1Q61|A Chain A, Pka Triple Mutant Model Of Pkb Length = 350 Back     alignment and structure
>pdb|3QAM|E Chain E, Crystal Structure Of Glu208ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1APM|E Chain E, 2.0 Angstrom Refined Crystal Structure Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With A Peptide Inhibitor And Detergent Length = 350 Back     alignment and structure
>pdb|1Q24|A Chain A, Pka Double Mutant Model Of Pkb In Complex With Mgatp Length = 350 Back     alignment and structure
>pdb|3AGL|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-1039 Length = 351 Back     alignment and structure
>pdb|2JDS|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With A- 443654 Length = 351 Back     alignment and structure
>pdb|1XH9|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|1SVH|A Chain A, Crystal Structure Of Protein Kinase A In Complex With Azepane Derivative 8 Length = 350 Back     alignment and structure
>pdb|1Q8W|A Chain A, The Catalytic Subunit Of Camp-Dependent Protein Kinase In Complex With Rho-Kinase Inhibitor Fasudil (Ha-1077) Length = 350 Back     alignment and structure
>pdb|1CTP|E Chain E, Structure Of The Mammalian Catalytic Subunit Of Camp-Dependent Protein Kinase And An Inhibitor Peptide Displays An Open Conformation Length = 350 Back     alignment and structure
>pdb|2GU8|A Chain A, Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel And Potent Inhibitors For Akt: Synthesis And Sar Studies Length = 337 Back     alignment and structure
>pdb|1STC|E Chain E, Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With Staurosporine Length = 350 Back     alignment and structure
>pdb|1SZM|A Chain A, Dual Binding Mode Of Bisindolylmaleimide 2 To Protein Kinase A (Pka) Length = 350 Back     alignment and structure
>pdb|4AE6|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit Calpha 2 Length = 343 Back     alignment and structure
>pdb|3PVB|A Chain A, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 345 Back     alignment and structure
>pdb|2JDT|A Chain A, Structure Of Pka-Pkb Chimera Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 351 Back     alignment and structure
>pdb|1SMH|A Chain A, Protein Kinase A Variant Complex With Completely Ordered N- Terminal Helix Length = 350 Back     alignment and structure
>pdb|3AMA|A Chain A, Protein Kinase A Sixfold Mutant Model Of Aurora B With Inhibitor Jnj- 7706621 Length = 351 Back     alignment and structure
>pdb|2VO0|A Chain A, Structure Of Pka-Pkb Chimera Complexed With C-(4-(4- Chlorophenyl)-1-(7h-Pyrrolo(2, 3-D)pyrimidin-4-Yl)piperidin- 4-Yl)methylamine Length = 351 Back     alignment and structure
>pdb|2UVY|A Chain A, Structure Of Pka-pkb Chimera Complexed With Methyl-(4-(9h- Purin-6-yl)-benzyl)-amine Length = 351 Back     alignment and structure
>pdb|2F7E|E Chain E, Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoquinolin-6- Yl-Pyridin-3-Yloxymethyl-Etylamine Length = 351 Back     alignment and structure
>pdb|3L9M|A Chain A, Crystal Structure Of Pkab3 (Pka Triple Mutant V123a, L173m, Q181k) With Compound 18 Length = 351 Back     alignment and structure
>pdb|4DG3|E Chain E, Crystal Structure Of R336a Mutant Of Camp-dependent Protein Kinase With Unphosphorylated Turn Motif Length = 371 Back     alignment and structure
>pdb|4DFY|A Chain A, Crystal Structure Of R194a Mutant Of Camp-Dependent Protein Kinase With Unphosphorylated Activation Loop Length = 371 Back     alignment and structure
>pdb|1XH7|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|4AE9|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit C Alpha 2 Length = 343 Back     alignment and structure
>pdb|3MVJ|A Chain A, Human Cyclic Amp-Dependent Protein Kinase Pka Inhibitor Complex Length = 371 Back     alignment and structure
>pdb|1YDT|E Chain E, Structure Of Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With H89 Protein Kinase Inhibitor N-[2- (4-Bromocinnamylamino)ethyl]-5-Isoquinoline Length = 350 Back     alignment and structure
>pdb|3DND|A Chain A, Camp-Dependent Protein Kinase Pka Catalytic Subunit With Pki-5-24 Length = 350 Back     alignment and structure
>pdb|1CDK|A Chain A, Camp-Dependent Protein Kinase Catalytic Subunit (E.C.2.7.1.37) (Protein Kinase A) Complexed With Protein Kinase Inhibitor Peptide Fragment 5-24 (Pki(5-24) Isoelectric Variant Ca) And Mn2+ Adenylyl Imidodiphosphate (Mnamp-Pnp) At Ph 5.6 And 7c And 4c Length = 350 Back     alignment and structure
>pdb|1CMK|E Chain E, Crystal Structures Of The Myristylated Catalytic Subunit Of Camp- Dependent Protein Kinase Reveal Open And Closed Conformations Length = 350 Back     alignment and structure
>pdb|2UZT|A Chain A, Pka Structures Of Akt, Indazole-Pyridine Inhibitors Length = 336 Back     alignment and structure
>pdb|3NX8|A Chain A, Human Camp Dependent Protein Kinase In Complex With Phenol Length = 351 Back     alignment and structure
>pdb|3QAL|E Chain E, Crystal Structure Of Arg280ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|2QUR|A Chain A, Crystal Structure Of F327aK285P MUTANT OF CAMP-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3TKU|A Chain A, Mrck Beta In Complex With Fasudil Length = 433 Back     alignment and structure
>pdb|3QFV|A Chain A, Mrck Beta In Complex With Tpca-1 Length = 415 Back     alignment and structure
>pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 Back     alignment and structure
>pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 Back     alignment and structure
>pdb|4AW2|A Chain A, Crystal Structure Of Cdc42 Binding Protein Kinase Alpha (Mrck Alpha) Length = 437 Back     alignment and structure
>pdb|3IW4|A Chain A, Crystal Structure Of Pkc Alpha In Complex With Nvp-Aeb071 Length = 360 Back     alignment and structure
>pdb|4DC2|A Chain A, Structure Of Pkc In Complex With A Substrate Peptide From Par-3 Length = 396 Back     alignment and structure
>pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 Back     alignment and structure
>pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 Back     alignment and structure
>pdb|2VD5|A Chain A, Structure Of Human Myotonic Dystrophy Protein Kinase In Complex With The Bisindoylmaleide Inhibitor Bim Viii Length = 412 Back     alignment and structure
>pdb|3ZH8|A Chain A, A Novel Small Molecule Apkc Inhibitor Length = 349 Back     alignment and structure
>pdb|3A8W|A Chain A, Crystal Structure Of Pkciota Kinase Domain Length = 345 Back     alignment and structure
>pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 Back     alignment and structure
>pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 Back     alignment and structure
>pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 Back     alignment and structure
>pdb|3OCB|A Chain A, Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor Length = 341 Back     alignment and structure
>pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 Back     alignment and structure
>pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 Back     alignment and structure
>pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 Back     alignment and structure
>pdb|1ZRZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Atypical Protein Kinase C-Iota Length = 364 Back     alignment and structure
>pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 Back     alignment and structure
>pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 Back     alignment and structure
>pdb|2I0E|A Chain A, Structure Of Catalytic Domain Of Human Protein Kinase C Beta Ii Complexed With A Bisindolylmaleimide Inhibitor Length = 353 Back     alignment and structure
>pdb|2R5T|A Chain A, Crystal Structure Of Inactive Serum And Glucocorticoid- Regulated Kinase 1 In Complex With Amp-Pnp Length = 373 Back     alignment and structure
>pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 Back     alignment and structure
>pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 Back     alignment and structure
>pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 Back     alignment and structure
>pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 Back     alignment and structure
>pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 Back     alignment and structure
>pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 Back     alignment and structure
>pdb|1XJD|A Chain A, Crystal Structure Of Pkc-Theta Complexed With Staurosporine At 2a Resolution Length = 345 Back     alignment and structure
>pdb|2JDO|A Chain A, Structure Of Pkb-Beta (Akt2) Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 342 Back     alignment and structure
>pdb|3TXO|A Chain A, Pkc Eta Kinase In Complex With A Naphthyridine Length = 353 Back     alignment and structure
>pdb|1O6L|A Chain A, Crystal Structure Of An Activated Akt/protein Kinase B (pkb-pif Chimera) Ternary Complex With Amp-pnp And Gsk3 Peptide Length = 337 Back     alignment and structure
>pdb|1GZK|A Chain A, Molecular Mechanism For The Regulation Of Protein Kinase B Akt By Hydrophobic Motif Phosphorylation Length = 315 Back     alignment and structure
>pdb|3QC9|A Chain A, Crystal Structure Of Cross-Linked Bovine Grk1 T8cN480C DOUBLE MUTANT Complexed With Adp And Mg Length = 543 Back     alignment and structure
>pdb|3C4X|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.9a Length = 543 Back     alignment and structure
>pdb|3C4W|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.7a Length = 543 Back     alignment and structure
>pdb|3T8O|A Chain A, Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolution Length = 543 Back     alignment and structure
>pdb|2F2U|A Chain A, Crystal Structure Of The Rho-Kinase Kinase Domain Length = 402 Back     alignment and structure
>pdb|2V55|A Chain A, Mechanism Of Multi-site Phosphorylation From A Rock-i:rhoe Complex Structure Length = 406 Back     alignment and structure
>pdb|2ESM|A Chain A, Crystal Structure Of Rock 1 Bound To Fasudil Length = 415 Back     alignment and structure
>pdb|3V8S|A Chain A, Human Rho-Associated Protein Kinase 1 (Rock 1) In Complex With Indazole Derivative (Compound 18) Length = 410 Back     alignment and structure
>pdb|3NYN|A Chain A, Crystal Structure Of G Protein-Coupled Receptor Kinase 6 In Complex With Sangivamycin Length = 576 Back     alignment and structure
>pdb|2ACX|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 6 Bound To Amppnp Length = 576 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query126
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 2e-38
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 3e-33
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 4e-28
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 9e-28
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 9e-28
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 3e-27
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 2e-26
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 7e-26
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 2e-25
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 2e-25
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 5e-25
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 8e-25
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 1e-24
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 2e-24
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 2e-24
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 8e-24
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 2e-23
3pvu_A 695 Beta-adrenergic receptor kinase 1; transferase, se 7e-23
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 5e-22
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 8e-21
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 6e-20
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 5e-19
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 3e-09
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 8e-09
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 4e-07
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 5e-06
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 1e-05
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 1e-05
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 1e-05
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 2e-04
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 2e-04
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 2e-04
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 3e-04
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 5e-04
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 7e-04
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 8e-04
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
 Score =  131 bits (331), Expect = 2e-38
 Identities = 35/102 (34%), Positives = 51/102 (50%), Gaps = 3/102 (2%)

Query: 1   MQTYNMIINVGIDKIPFPKHVTRTAQSLIKALCKESPAERLGYQRGGIVDIKKHKWFQGF 60
           +Q Y  I++    K+ FP H +   + L++ L +    +R G  + G+ DIK HKWF   
Sbjct: 244 IQIYEKIVS---GKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATT 300

Query: 61  DWDGLRNQTLTPPIIPVIKGPTDTSNFDRYSAENDIKGPTDT 102
           DW  +  + +  P IP  KGP DTSNFD Y  E       + 
Sbjct: 301 DWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEK 342


>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query126
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 99.83
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.82
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 99.81
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.81
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 99.8
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 99.8
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 99.77
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.77
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 99.76
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.76
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.71
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 99.68
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 99.66
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 99.64
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.61
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 99.58
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.55
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.54
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 99.47
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.45
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.33
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 99.33
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 98.69
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 98.58
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 98.58
3rp9_A458 Mitogen-activated protein kinase; structural genom 98.53
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 98.51
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 98.46
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 98.45
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 98.45
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 98.37
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 98.36
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 98.33
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 98.3
3niz_A311 Rhodanese family protein; structural genomics, str 98.29
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 98.28
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 98.26
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 98.26
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 98.26
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 98.24
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 98.24
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 98.23
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 98.21
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 98.19
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 98.18
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 98.14
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 98.14
2eue_A275 Carbon catabolite derepressing protein kinase; kin 98.14
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 98.13
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 98.13
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 98.11
2y0a_A326 Death-associated protein kinase 1; transferase, ca 98.11
3o0g_A292 Cell division protein kinase 5; kinase activator c 98.1
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 98.07
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 98.05
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 98.03
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 98.03
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 98.02
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 98.02
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 98.0
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 97.99
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 97.98
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 97.96
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 97.95
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 97.94
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 97.94
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 97.93
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 97.92
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 97.92
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 97.91
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 97.9
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 97.9
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 97.9
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 97.89
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 97.88
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 97.87
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 97.87
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 97.87
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 97.85
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 97.85
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 97.85
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 97.84
3eqc_A360 Dual specificity mitogen-activated protein kinase; 97.84
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 97.84
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 97.84
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 97.83
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 97.82
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 97.81
3dls_A335 PAS domain-containing serine/threonine-protein KI; 97.81
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 97.81
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 97.81
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 97.79
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 97.79
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 97.78
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 97.77
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 97.77
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 97.77
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 97.76
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 97.76
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 97.75
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 97.74
2fst_X367 Mitogen-activated protein kinase 14; active mutant 97.74
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 97.74
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 97.74
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 97.73
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 97.73
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 97.72
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 97.72
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 97.71
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 97.71
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 97.71
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 97.69
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 97.69
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 97.68
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 97.67
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 97.66
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 97.65
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 97.65
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 97.65
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 97.65
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 97.64
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 97.63
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 97.63
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 97.61
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 97.61
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 97.6
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 97.59
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 97.59
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 97.56
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 97.56
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 97.56
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 97.53
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 97.53
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 97.52
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 97.52
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 97.51
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 97.5
3bhy_A283 Death-associated protein kinase 3; death associate 97.49
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 97.49
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 97.47
3fme_A290 Dual specificity mitogen-activated protein kinase; 97.47
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 97.41
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 97.39
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 97.37
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 97.35
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 97.34
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 97.25
2dyl_A318 Dual specificity mitogen-activated protein kinase 97.22
3an0_A340 Dual specificity mitogen-activated protein kinase; 97.19
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 97.17
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 97.16
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 97.03
3aln_A327 Dual specificity mitogen-activated protein kinase; 96.95
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 96.94
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 96.8
4aoj_A329 High affinity nerve growth factor receptor; transf 96.66
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 96.54
4ase_A353 Vascular endothelial growth factor receptor 2; tra 96.48
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 96.37
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 96.02
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 96.0
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 95.73
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 95.63
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 95.61
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 95.6
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 95.56
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 95.53
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 95.36
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 95.26
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 95.26
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 95.26
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 95.25
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 95.25
3ork_A311 Serine/threonine protein kinase; structural genomi 95.23
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 95.19
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 95.18
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 95.15
2xir_A316 Vascular endothelial growth factor receptor 2; ang 95.14
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 95.13
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 95.1
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 95.1
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 95.09
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 95.09
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 95.05
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 95.01
2a19_B284 Interferon-induced, double-stranded RNA-activated 94.97
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 94.95
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 94.82
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 94.66
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 94.65
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 94.6
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 94.57
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 94.56
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 94.55
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 94.48
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 94.38
3pls_A298 Macrophage-stimulating protein receptor; protein k 94.34
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 94.31
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 94.21
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 94.17
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 94.15
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 94.03
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 94.03
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 94.02
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 94.01
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 93.95
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 93.87
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 93.76
3poz_A327 Epidermal growth factor receptor; kinase domain, a 93.76
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 93.74
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 93.71
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 93.7
3lzb_A327 Epidermal growth factor receptor; epidermal growth 93.7
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 93.64
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 93.64
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 93.32
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 93.31
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 93.27
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 93.25
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 93.24
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 93.16
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 92.95
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 92.62
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 92.37
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 92.3
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 92.03
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 91.82
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 91.27
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 91.26
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 90.98
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 90.7
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 90.44
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 89.85
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 89.72
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 89.44
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 89.42
3uqc_A286 Probable conserved transmembrane protein; structur 89.36
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 89.09
3q4u_A301 Activin receptor type-1; structural genomics conso 89.01
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 88.97
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 88.65
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 88.02
3soc_A322 Activin receptor type-2A; structural genomics cons 87.41
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 86.58
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 86.49
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 85.53
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 85.1
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 82.21
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 80.82
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
Probab=99.83  E-value=4.3e-21  Score=147.94  Aligned_cols=108  Identities=31%  Similarity=0.628  Sum_probs=95.2

Q ss_pred             HHHHHHhcCCCcccCCCCCCHHHHHHHHHhhhcCcCccCCCC-CCChhhhccCCCCCCCChhHHhcCCCCCCcccCCCCC
Q psy3183           3 TYNMIINVGIDKIPFPKHVTRTAQSLIKALCKESPAERLGYQ-RGGIVDIKKHKWFQGFDWDGLRNQTLTPPIIPVIKGP   81 (126)
Q Consensus         3 l~~~I~~~~~~~~~~p~~~s~~a~dli~~lL~~dp~~Rl~~~-~~g~~~i~~hp~f~~v~w~~l~~~~~~ppf~P~~~~~   81 (126)
                      +++.|+ ..  .+.+|..+|.++++||++||++||.+|+|+. ..|+.+|+.||||++++|+.+..+++.|||+|.+.+.
T Consensus       270 ~~~~i~-~~--~~~~p~~~s~~~~~li~~lL~~dP~~R~~~~~~~~~~ei~~Hpff~~i~w~~l~~~~~~pp~~p~~~~~  346 (396)
T 4dc2_A          270 LFQVIL-EK--QIRIPRSLSVKAASVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGE  346 (396)
T ss_dssp             HHHHHH-HC--CCCCCTTSCHHHHHHHHHHTCSCTTTSTTCSTTTHHHHHHHSTTTTTCCHHHHHTTCSCCSCCCCCCSS
T ss_pred             HHHHHh-cc--ccCCCCcCCHHHHHHHHHHhcCCHhHcCCCCCCCCHHHHhcCccccCCCHHHHHcCCCCCCCcCCCCCc
Confidence            567777 44  7889999999999999999999999999974 2478999999999999999999999999999999999


Q ss_pred             CCCCCCCC-CCCCCCCCCCC--------CCCCCCCCccCCC
Q psy3183          82 TDTSNFDR-YSAENDIKGPT--------DTSNFDRYSAEND  113 (126)
Q Consensus        82 ~d~~~fd~-~~~e~~~~~~~--------~~~~f~~f~~~~~  113 (126)
                      .|++|||. |+.+....++.        ++..|.||+|.+.
T Consensus       347 ~d~~~fd~~~~~~~~~~~~~~~~~~~~~~~~~f~~f~~~~~  387 (396)
T 4dc2_A          347 FGLDNFDSQFTNEPVQLTPDDDDIVRKIDQSEFEGFEYINP  387 (396)
T ss_dssp             TTGGGSCHHHHTSCCCCCCCCHHHHTTSCGGGGTTCCEECC
T ss_pred             cchhhcChhhccCCCccCCCcchhhccccccccCCcEeECc
Confidence            99999997 88877766654        3568999999875



>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 126
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 9e-25
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 2e-24
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 2e-24
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 1e-23
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 2e-21
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 9e-20
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 1e-13
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 3e-08
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 6e-07
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 9e-07
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 1e-06
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 6e-06
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 8e-06
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 1e-05
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 3e-05
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 4e-05
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 5e-05
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 1e-04
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 1e-04
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 5e-04
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 5e-04
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 0.001
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 0.001
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 0.002
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 0.002
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: cAMP-dependent PK, catalytic subunit
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 94.1 bits (233), Expect = 9e-25
 Identities = 35/101 (34%), Positives = 51/101 (50%), Gaps = 3/101 (2%)

Query: 1   MQTYNMIINVGIDKIPFPKHVTRTAQSLIKALCKESPAERLGYQRGGIVDIKKHKWFQGF 60
           +Q Y  I++    K+ FP H +   + L++ L +    +R G  + G+ DIK HKWF   
Sbjct: 244 IQIYEKIVS---GKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATT 300

Query: 61  DWDGLRNQTLTPPIIPVIKGPTDTSNFDRYSAENDIKGPTD 101
           DW  +  + +  P IP  KGP DTSNFD Y  E       +
Sbjct: 301 DWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINE 341


>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query126
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.8
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 99.77
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.72
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.69
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.63
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.49
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.37
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 98.89
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 98.69
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 98.55
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 98.55
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 98.52
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 98.43
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 98.42
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 98.4
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 98.4
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 98.38
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 98.32
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 98.31
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 98.28
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 98.27
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 98.27
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 98.25
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 98.23
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 98.2
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 98.19
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 98.18
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 98.15
d1s9ja_322 Dual specificity mitogen-activated protein kinase 98.14
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 98.13
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 98.09
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 98.04
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 98.04
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 97.96
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 97.89
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 97.88
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 97.46
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 97.28
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 97.09
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 97.07
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 97.04
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 97.03
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 97.03
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 96.89
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 96.84
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 96.72
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 96.68
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 96.61
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 96.51
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 96.5
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 96.4
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 96.35
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 96.29
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 96.15
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 96.1
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 95.93
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 95.84
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 95.81
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 94.47
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 93.29
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 82.27
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Pkb kinase (Akt-2)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.80  E-value=6.4e-20  Score=137.06  Aligned_cols=108  Identities=25%  Similarity=0.575  Sum_probs=89.6

Q ss_pred             hHHHHHHhcCCCcccCCCCCCHHHHHHHHHhhhcCcCccCCCCCCChhhhccCCCCCCCChhHHhcCCCCCCcccCCCCC
Q psy3183           2 QTYNMIINVGIDKIPFPKHVTRTAQSLIKALCKESPAERLGYQRGGIVDIKKHKWFQGFDWDGLRNQTLTPPIIPVIKGP   81 (126)
Q Consensus         2 ~l~~~I~~~~~~~~~~p~~~s~~a~dli~~lL~~dp~~Rl~~~~~g~~~i~~hp~f~~v~w~~l~~~~~~ppf~P~~~~~   81 (126)
                      +++++|. .+  .+.+|..+|+++++||++||++||.+|+++...++.+|++||||++++|..+..+++.||++|.+...
T Consensus       212 ~~~~~i~-~~--~~~~p~~~s~~~~dli~~~L~~dP~~R~~~~~~~~~eil~Hp~f~~i~~~~l~~~~~~~p~~P~~~~~  288 (337)
T d1o6la_         212 RLFELIL-ME--EIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSE  288 (337)
T ss_dssp             HHHHHHH-HC--CCCCCTTSCHHHHHHHHHHTCSSTTTSTTCSTTTHHHHHTSGGGTTCCHHHHHTTCSCCSCCCCCSST
T ss_pred             HHHHHHh-cC--CCCCCccCCHHHHHHHHhhccCCchhhcccccccHHHHHcCcccccCCHHHHHhCCCCCCCCCCCCCh
Confidence            4678888 55  78999999999999999999999999998755678999999999999999999999999999999999


Q ss_pred             CCCCCCCC-CCCCCCCCCC---------------CCCCCCCCCccCC
Q psy3183          82 TDTSNFDR-YSAENDIKGP---------------TDTSNFDRYSAEN  112 (126)
Q Consensus        82 ~d~~~fd~-~~~e~~~~~~---------------~~~~~f~~f~~~~  112 (126)
                      .++.+|+. ++.+....++               ..+..|.+|+|..
T Consensus       289 ~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~f~~v~  335 (337)
T d1o6la_         289 VDTRYFDDEFTAQSITITPPDRYDSLGLLELDQREEQEMFEDFDYIA  335 (337)
T ss_dssp             TCCTTSCHHHHTSCCC--------------------CCTTTTCCEEC
T ss_pred             hhhhhcCchhhhccCCCCCCccccccccccccchhhhhccCCCEeeC
Confidence            99999986 4444333222               2356799999864



>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure