Psyllid ID: psy3214
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 336 | ||||||
| 312861579 | 395 | cathepsin D [Branchiostoma belcheri] | 0.327 | 0.278 | 0.625 | 1e-32 | |
| 197631813 | 398 | cathepsin D [Salmo salar] gi|223648160|g | 0.327 | 0.276 | 0.651 | 1e-31 | |
| 118344558 | 396 | cathepsin D1 precursor [Takifugu rubripe | 0.327 | 0.277 | 0.633 | 4e-31 | |
| 342675479 | 396 | cathepsin D [Cynoglossus semilaevis] | 0.303 | 0.257 | 0.669 | 1e-30 | |
| 432850601 | 398 | PREDICTED: cathepsin D-like isoform 2 [O | 0.327 | 0.276 | 0.625 | 1e-30 | |
| 387915174 | 394 | cathepsin D1 [Callorhinchus milii] | 0.327 | 0.279 | 0.625 | 1e-30 | |
| 432850599 | 396 | PREDICTED: cathepsin D-like isoform 1 [O | 0.327 | 0.277 | 0.625 | 1e-30 | |
| 147906891 | 409 | cathepsin D precursor [Xenopus laevis] g | 0.327 | 0.268 | 0.625 | 1e-30 | |
| 301619112 | 355 | PREDICTED: cathepsin D-like [Xenopus (Si | 0.327 | 0.309 | 0.616 | 2e-30 | |
| 185132376 | 398 | cathepsin D precursor [Oncorhynchus myki | 0.327 | 0.276 | 0.633 | 2e-30 |
| >gi|312861579|gb|ADR10277.1| cathepsin D [Branchiostoma belcheri] | Back alignment and taxonomy information |
|---|
Score = 146 bits (368), Expect = 1e-32, Method: Compositional matrix adjust.
Identities = 70/112 (62%), Positives = 88/112 (78%), Gaps = 2/112 (1%)
Query: 70 KNGTQFAIRYGSGAVSGYLSQDTLRIGDLTIKNQVFGEAIKEPGFTFVAAKFDGILGMGY 129
KNGT FAIRYGSG+++G+LS+DT+ IG L ++NQ F EA+ +PG TFVAAKFDGILGMGY
Sbjct: 123 KNGTDFAIRYGSGSLTGFLSEDTVTIGGLKVQNQTFAEAVTQPGITFVAAKFDGILGMGY 182
Query: 130 DNIAVDGVEPPFYNIIQQKLLEKNVFGFYLNRYNTEKLANGEVPIPSAHDPK 181
D I+VDGV PPFYN++QQKL++K VF FYLNR + GE+ + DPK
Sbjct: 183 DTISVDGVVPPFYNMVQQKLVDKPVFSFYLNR-DPSSTTRGEL-LLGGTDPK 232
|
Source: Branchiostoma belcheri Species: Branchiostoma belcheri Genus: Branchiostoma Family: Branchiostomidae Order: Class: Phylum: Chordata Superkingdom: Eukaryota |
| >gi|197631813|gb|ACH70630.1| cathepsin D [Salmo salar] gi|223648160|gb|ACN10838.1| Cathepsin D precursor [Salmo salar] | Back alignment and taxonomy information |
|---|
| >gi|118344558|ref|NP_001072052.1| cathepsin D1 precursor [Takifugu rubripes] gi|55771082|dbj|BAD69801.1| cathepsin D1 [Takifugu rubripes] | Back alignment and taxonomy information |
|---|
| >gi|342675479|gb|AEL31665.1| cathepsin D [Cynoglossus semilaevis] | Back alignment and taxonomy information |
|---|
| >gi|432850601|ref|XP_004066828.1| PREDICTED: cathepsin D-like isoform 2 [Oryzias latipes] | Back alignment and taxonomy information |
|---|
| >gi|387915174|gb|AFK11196.1| cathepsin D1 [Callorhinchus milii] | Back alignment and taxonomy information |
|---|
| >gi|432850599|ref|XP_004066827.1| PREDICTED: cathepsin D-like isoform 1 [Oryzias latipes] | Back alignment and taxonomy information |
|---|
| >gi|147906891|ref|NP_001082550.1| cathepsin D precursor [Xenopus laevis] gi|28436104|dbj|BAC57431.1| cathepsin D [Xenopus laevis] | Back alignment and taxonomy information |
|---|
| >gi|301619112|ref|XP_002938948.1| PREDICTED: cathepsin D-like [Xenopus (Silurana) tropicalis] | Back alignment and taxonomy information |
|---|
| >gi|185132376|ref|NP_001118183.1| cathepsin D precursor [Oncorhynchus mykiss] gi|1858020|gb|AAC60301.1| cathepsin D [Oncorhynchus mykiss] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 336 | ||||||
| UNIPROTKB|Q05744 | 398 | CTSD "Cathepsin D" [Gallus gal | 0.327 | 0.276 | 0.598 | 3.7e-32 | |
| ZFIN|ZDB-GENE-010131-8 | 399 | ctsd "cathepsin D" [Danio reri | 0.327 | 0.275 | 0.616 | 3.7e-32 | |
| UNIPROTKB|O93428 | 396 | ctsd "Cathepsin D" [Chionodrac | 0.327 | 0.277 | 0.633 | 3.7e-32 | |
| SGD|S000006075 | 405 | PEP4 "Vacuolar aspartyl protea | 0.523 | 0.434 | 0.423 | 9.1e-29 | |
| FB|FBgn0029093 | 392 | cathD "cathD" [Drosophila mela | 0.324 | 0.278 | 0.576 | 1.2e-28 | |
| RGD|621511 | 407 | Ctsd "cathepsin D" [Rattus nor | 0.303 | 0.250 | 0.559 | 9.4e-27 | |
| MGI|MGI:88562 | 410 | Ctsd "cathepsin D" [Mus muscul | 0.303 | 0.248 | 0.553 | 1.2e-26 | |
| UNIPROTKB|F1MMR6 | 412 | CTSD "Cathepsin D" [Bos taurus | 0.273 | 0.223 | 0.584 | 2.5e-26 | |
| UNIPROTKB|P80209 | 390 | CTSD "Cathepsin D" [Bos taurus | 0.273 | 0.235 | 0.584 | 2.5e-26 | |
| ASPGD|ASPL0000040189 | 394 | pepE [Emericella nidulans (tax | 0.288 | 0.246 | 0.546 | 2.5e-26 |
| UNIPROTKB|Q05744 CTSD "Cathepsin D" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 352 (129.0 bits), Expect = 3.7e-32, P = 3.7e-32
Identities = 67/112 (59%), Positives = 89/112 (79%)
Query: 70 KNGTQFAIRYGSGAVSGYLSQDTLRIGDLTIKNQVFGEAIKEPGFTFVAAKFDGILGMGY 129
+NGT+FAI YG+G++SG+LSQDT+ +G+L IKNQ+FGEA+K+PG TF+AAKFDGILGM +
Sbjct: 132 ENGTEFAIHYGTGSLSGFLSQDTVTLGNLKIKNQIFGEAVKQPGITFIAAKFDGILGMAF 191
Query: 130 DNIAVDGVEPPFYNIIQQKLLEKNVFGFYLNRYNTEKLANGEVPIPSAHDPK 181
I+VD V P F N++QQKL+EKN+F FYLNR T + GE+ + DPK
Sbjct: 192 PRISVDKVTPFFDNVMQQKLIEKNIFSFYLNRDPTAQ-PGGELLLGGT-DPK 241
|
|
| ZFIN|ZDB-GENE-010131-8 ctsd "cathepsin D" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O93428 ctsd "Cathepsin D" [Chionodraco hamatus (taxid:36188)] | Back alignment and assigned GO terms |
|---|
| SGD|S000006075 PEP4 "Vacuolar aspartyl protease (proteinase A)" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0029093 cathD "cathD" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| RGD|621511 Ctsd "cathepsin D" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:88562 Ctsd "cathepsin D" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MMR6 CTSD "Cathepsin D" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P80209 CTSD "Cathepsin D" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000040189 pepE [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 336 | |||
| cd05490 | 325 | cd05490, Cathepsin_D2, Cathepsin_D2, pepsin family | 1e-44 | |
| cd05488 | 320 | cd05488, Proteinase_A_fungi, Fungal Proteinase A , | 3e-43 | |
| cd05485 | 329 | cd05485, Cathepsin_D_like, Cathepsin_D_like, pepsi | 2e-41 | |
| cd06098 | 317 | cd06098, phytepsin, Phytepsin, a plant homolog of | 1e-39 | |
| pfam00026 | 316 | pfam00026, Asp, Eukaryotic aspartyl protease | 2e-33 | |
| cd05487 | 326 | cd05487, renin_like, Renin stimulates production o | 9e-31 | |
| cd05490 | 325 | cd05490, Cathepsin_D2, Cathepsin_D2, pepsin family | 2e-30 | |
| cd05471 | 283 | cd05471, pepsin_like, Pepsin-like aspartic proteas | 6e-30 | |
| cd05485 | 329 | cd05485, Cathepsin_D_like, Cathepsin_D_like, pepsi | 9e-30 | |
| cd06098 | 317 | cd06098, phytepsin, Phytepsin, a plant homolog of | 9e-27 | |
| cd05486 | 316 | cd05486, Cathespin_E, Cathepsin E, non-lysosomal a | 3e-26 | |
| cd05478 | 317 | cd05478, pepsin_A, Pepsin A, aspartic protease pro | 7e-25 | |
| cd05477 | 318 | cd05477, gastricsin, Gastricsins, asparate proteas | 1e-22 | |
| cd05486 | 316 | cd05486, Cathespin_E, Cathepsin E, non-lysosomal a | 4e-22 | |
| cd05487 | 326 | cd05487, renin_like, Renin stimulates production o | 5e-20 | |
| cd05488 | 320 | cd05488, Proteinase_A_fungi, Fungal Proteinase A , | 9e-20 | |
| pfam03723 | 249 | pfam03723, Hemocyanin_C, Hemocyanin, ig-like domai | 6e-19 | |
| cd05470 | 109 | cd05470, pepsin_retropepsin_like, Cellular and ret | 1e-18 | |
| pfam00026 | 316 | pfam00026, Asp, Eukaryotic aspartyl protease | 2e-18 | |
| PTZ00165 | 482 | PTZ00165, PTZ00165, aspartyl protease; Provisional | 2e-13 | |
| cd05478 | 317 | cd05478, pepsin_A, Pepsin A, aspartic protease pro | 4e-12 | |
| PTZ00165 | 482 | PTZ00165, PTZ00165, aspartyl protease; Provisional | 6e-12 | |
| PTZ00147 | 453 | PTZ00147, PTZ00147, plasmepsin-1; Provisional | 8e-11 | |
| PTZ00013 | 450 | PTZ00013, PTZ00013, plasmepsin 4 (PM4); Provisiona | 4e-10 | |
| cd05477 | 318 | cd05477, gastricsin, Gastricsins, asparate proteas | 1e-09 | |
| cd05474 | 295 | cd05474, SAP_like, SAPs, pepsin-like proteinases s | 4e-09 | |
| cd06097 | 278 | cd06097, Aspergillopepsin_like, Aspergillopepsin_l | 7e-08 | |
| cd05471 | 283 | cd05471, pepsin_like, Pepsin-like aspartic proteas | 6e-05 | |
| PTZ00147 | 453 | PTZ00147, PTZ00147, plasmepsin-1; Provisional | 9e-05 | |
| cd05476 | 265 | cd05476, pepsin_A_like_plant, Chroloplast Nucleoid | 6e-04 | |
| cd05474 | 295 | cd05474, SAP_like, SAPs, pepsin-like proteinases s | 0.002 |
| >gnl|CDD|133157 cd05490, Cathepsin_D2, Cathepsin_D2, pepsin family of proteinases | Back alignment and domain information |
|---|
Score = 154 bits (392), Expect = 1e-44
Identities = 64/92 (69%), Positives = 79/92 (85%)
Query: 70 KNGTQFAIRYGSGAVSGYLSQDTLRIGDLTIKNQVFGEAIKEPGFTFVAAKFDGILGMGY 129
KNGT+FAI+YGSG++SGYLSQDT+ IG L ++ Q+FGEA+K+PG TF+AAKFDGILGM Y
Sbjct: 61 KNGTEFAIQYGSGSLSGYLSQDTVSIGGLQVEGQLFGEAVKQPGITFIAAKFDGILGMAY 120
Query: 130 DNIAVDGVEPPFYNIIQQKLLEKNVFGFYLNR 161
I+VDGV P F NI+ QKL+E+NVF FYLNR
Sbjct: 121 PRISVDGVTPVFDNIMAQKLVEQNVFSFYLNR 152
|
Cathepsin D is the major aspartic proteinase of the lysosomal compartment where it functions in protein catabolism. It is a member of the pepsin family of proteinases. This enzyme is distinguished from other members of the pepsin family by two features that are characteristic of lysosomal hydrolases. First, mature Cathepsin D is found predominantly in a two-chain form due to a posttranslational cleavage event. Second, it contains phosphorylated, N-linked oligosaccharides that target the enzyme to lysosomes via mannose-6-phosphate receptors. Cathepsin D preferentially attacks peptide bonds flanked by bulky hydrophobic amino acids and its pH optimum is between pH 2.8 and 4.0. Two active site aspartic acid residues are essential for the catalytic activity of aspartic proteinases. Like other aspartic proteinases, Cathepsin D is a bilobed molecule; the two evolutionary related lobes are mostly made up of beta-sheets and flank a deep active site cleft. Each of the two related lobes contributes one active site aspartic acid residue and contains a single carbohydrate group. Cathepsin D is an essential enzyme. Mice deficient for proteinase cathepsin D, generated by gene targeting, develop normally during the first 2 weeks, stop thriving in the third week and die in a state of anorexia in the fourth week. The mice develop atrophy of ileal mucosa followed by other degradation of intestinal organs. In these knockout mice, lysosomal proteolysis was normal. These results suggest that vital functions of cathepsin D are exerted by limited proteolysis of proteins regulating cell growth and/or tissue homeostasis, while its contribution to bulk proteolysis in lysosomes appears to be non-critical. This family of aspartate proteases is classified by MEROPS as the peptidase family A1 (pepsin A, clan AA). Length = 325 |
| >gnl|CDD|133155 cd05488, Proteinase_A_fungi, Fungal Proteinase A , aspartic proteinase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|133152 cd05485, Cathepsin_D_like, Cathepsin_D_like, pepsin family of proteinases | Back alignment and domain information |
|---|
| >gnl|CDD|133162 cd06098, phytepsin, Phytepsin, a plant homolog of mammalian lysosomal pepsins | Back alignment and domain information |
|---|
| >gnl|CDD|215663 pfam00026, Asp, Eukaryotic aspartyl protease | Back alignment and domain information |
|---|
| >gnl|CDD|133154 cd05487, renin_like, Renin stimulates production of angiotensin and thus affects blood pressure | Back alignment and domain information |
|---|
| >gnl|CDD|133157 cd05490, Cathepsin_D2, Cathepsin_D2, pepsin family of proteinases | Back alignment and domain information |
|---|
| >gnl|CDD|133138 cd05471, pepsin_like, Pepsin-like aspartic proteases, bilobal enzymes that cleave bonds in peptides at acidic pH | Back alignment and domain information |
|---|
| >gnl|CDD|133152 cd05485, Cathepsin_D_like, Cathepsin_D_like, pepsin family of proteinases | Back alignment and domain information |
|---|
| >gnl|CDD|133162 cd06098, phytepsin, Phytepsin, a plant homolog of mammalian lysosomal pepsins | Back alignment and domain information |
|---|
| >gnl|CDD|133153 cd05486, Cathespin_E, Cathepsin E, non-lysosomal aspartic protease | Back alignment and domain information |
|---|
| >gnl|CDD|133145 cd05478, pepsin_A, Pepsin A, aspartic protease produced in gastric mucosa of mammals | Back alignment and domain information |
|---|
| >gnl|CDD|133144 cd05477, gastricsin, Gastricsins, asparate proteases produced in gastric mucosa | Back alignment and domain information |
|---|
| >gnl|CDD|133153 cd05486, Cathespin_E, Cathepsin E, non-lysosomal aspartic protease | Back alignment and domain information |
|---|
| >gnl|CDD|133154 cd05487, renin_like, Renin stimulates production of angiotensin and thus affects blood pressure | Back alignment and domain information |
|---|
| >gnl|CDD|133155 cd05488, Proteinase_A_fungi, Fungal Proteinase A , aspartic proteinase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|217694 pfam03723, Hemocyanin_C, Hemocyanin, ig-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|133137 cd05470, pepsin_retropepsin_like, Cellular and retroviral pepsin-like aspartate proteases | Back alignment and domain information |
|---|
| >gnl|CDD|215663 pfam00026, Asp, Eukaryotic aspartyl protease | Back alignment and domain information |
|---|
| >gnl|CDD|240300 PTZ00165, PTZ00165, aspartyl protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133145 cd05478, pepsin_A, Pepsin A, aspartic protease produced in gastric mucosa of mammals | Back alignment and domain information |
|---|
| >gnl|CDD|240300 PTZ00165, PTZ00165, aspartyl protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|140176 PTZ00147, PTZ00147, plasmepsin-1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|140051 PTZ00013, PTZ00013, plasmepsin 4 (PM4); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133144 cd05477, gastricsin, Gastricsins, asparate proteases produced in gastric mucosa | Back alignment and domain information |
|---|
| >gnl|CDD|133141 cd05474, SAP_like, SAPs, pepsin-like proteinases secreted from pathogens to degrade host proteins | Back alignment and domain information |
|---|
| >gnl|CDD|133161 cd06097, Aspergillopepsin_like, Aspergillopepsin_like, aspartic proteases of fungal origin | Back alignment and domain information |
|---|
| >gnl|CDD|133138 cd05471, pepsin_like, Pepsin-like aspartic proteases, bilobal enzymes that cleave bonds in peptides at acidic pH | Back alignment and domain information |
|---|
| >gnl|CDD|140176 PTZ00147, PTZ00147, plasmepsin-1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133143 cd05476, pepsin_A_like_plant, Chroloplast Nucleoids DNA-binding Protease and Nucellin, pepsin-like aspartic proteases from plants | Back alignment and domain information |
|---|
| >gnl|CDD|133141 cd05474, SAP_like, SAPs, pepsin-like proteinases secreted from pathogens to degrade host proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 336 | |||
| PTZ00165 | 482 | aspartyl protease; Provisional | 100.0 | |
| cd05490 | 325 | Cathepsin_D2 Cathepsin_D2, pepsin family of protei | 100.0 | |
| cd05486 | 316 | Cathespin_E Cathepsin E, non-lysosomal aspartic pr | 100.0 | |
| cd06098 | 317 | phytepsin Phytepsin, a plant homolog of mammalian | 100.0 | |
| cd05487 | 326 | renin_like Renin stimulates production of angioten | 99.97 | |
| cd05478 | 317 | pepsin_A Pepsin A, aspartic protease produced in g | 99.97 | |
| cd05477 | 318 | gastricsin Gastricsins, asparate proteases produce | 99.97 | |
| cd05485 | 329 | Cathepsin_D_like Cathepsin_D_like, pepsin family o | 99.97 | |
| PTZ00147 | 453 | plasmepsin-1; Provisional | 99.97 | |
| cd05488 | 320 | Proteinase_A_fungi Fungal Proteinase A , aspartic | 99.97 | |
| PTZ00013 | 450 | plasmepsin 4 (PM4); Provisional | 99.97 | |
| PF03723 | 250 | Hemocyanin_C: Hemocyanin, ig-like domain; InterPro | 99.97 | |
| cd06097 | 278 | Aspergillopepsin_like Aspergillopepsin_like, aspar | 99.96 | |
| PF00026 | 317 | Asp: Eukaryotic aspartyl protease The Prosite entr | 99.95 | |
| cd05473 | 364 | beta_secretase_like Beta-secretase, aspartic-acid | 99.95 | |
| cd05471 | 283 | pepsin_like Pepsin-like aspartic proteases, biloba | 99.93 | |
| cd06096 | 326 | Plasmepsin_5 Plasmepsins are a class of aspartic p | 99.92 | |
| KOG1339|consensus | 398 | 99.92 | ||
| cd05474 | 295 | SAP_like SAPs, pepsin-like proteinases secreted fr | 99.91 | |
| cd05476 | 265 | pepsin_A_like_plant Chroloplast Nucleoids DNA-bind | 99.88 | |
| cd05472 | 299 | cnd41_like Chloroplast Nucleoids DNA-binding Prote | 99.87 | |
| cd05475 | 273 | nucellin_like Nucellins, plant aspartic proteases | 99.85 | |
| PLN03146 | 431 | aspartyl protease family protein; Provisional | 99.84 | |
| cd05470 | 109 | pepsin_retropepsin_like Cellular and retroviral pe | 99.79 | |
| PF14543 | 164 | TAXi_N: Xylanase inhibitor N-terminal; PDB: 3HD8_A | 99.67 | |
| cd05489 | 362 | xylanase_inhibitor_I_like TAXI-I inhibits degradat | 99.64 | |
| cd05483 | 96 | retropepsin_like_bacteria Bacterial aspartate prot | 97.87 | |
| cd06098 | 317 | phytepsin Phytepsin, a plant homolog of mammalian | 97.4 | |
| cd05490 | 325 | Cathepsin_D2 Cathepsin_D2, pepsin family of protei | 97.38 | |
| cd05486 | 316 | Cathespin_E Cathepsin E, non-lysosomal aspartic pr | 97.25 | |
| PTZ00165 | 482 | aspartyl protease; Provisional | 97.14 | |
| cd05487 | 326 | renin_like Renin stimulates production of angioten | 97.07 | |
| cd05485 | 329 | Cathepsin_D_like Cathepsin_D_like, pepsin family o | 96.98 | |
| PTZ00147 | 453 | plasmepsin-1; Provisional | 96.18 | |
| cd05488 | 320 | Proteinase_A_fungi Fungal Proteinase A , aspartic | 96.11 | |
| PTZ00013 | 450 | plasmepsin 4 (PM4); Provisional | 95.8 | |
| PF00026 | 317 | Asp: Eukaryotic aspartyl protease The Prosite entr | 95.68 | |
| PF13650 | 90 | Asp_protease_2: Aspartyl protease | 95.53 | |
| cd05478 | 317 | pepsin_A Pepsin A, aspartic protease produced in g | 95.19 | |
| cd05477 | 318 | gastricsin Gastricsins, asparate proteases produce | 94.56 | |
| TIGR02281 | 121 | clan_AA_DTGA clan AA aspartic protease, TIGR02281 | 93.74 | |
| cd05489 | 362 | xylanase_inhibitor_I_like TAXI-I inhibits degradat | 93.63 | |
| cd05474 | 295 | SAP_like SAPs, pepsin-like proteinases secreted fr | 93.53 | |
| KOG1339|consensus | 398 | 92.65 | ||
| cd05475 | 273 | nucellin_like Nucellins, plant aspartic proteases | 91.93 | |
| cd05479 | 124 | RP_DDI RP_DDI; retropepsin-like domain of DNA dama | 91.42 | |
| cd05472 | 299 | cnd41_like Chloroplast Nucleoids DNA-binding Prote | 91.18 | |
| cd05476 | 265 | pepsin_A_like_plant Chroloplast Nucleoids DNA-bind | 89.87 | |
| PF11925 | 370 | DUF3443: Protein of unknown function (DUF3443); In | 86.48 | |
| cd06096 | 326 | Plasmepsin_5 Plasmepsins are a class of aspartic p | 85.19 | |
| cd05484 | 91 | retropepsin_like_LTR_2 Retropepsins_like_LTR, peps | 83.9 | |
| cd06095 | 86 | RP_RTVL_H_like Retropepsin of the RTVL_H family of | 82.88 |
| >PTZ00165 aspartyl protease; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.9e-33 Score=277.08 Aligned_cols=201 Identities=22% Similarity=0.382 Sum_probs=167.3
Q ss_pred CccCceeEeccCCccceecccccCcCCCCCCCcEEEcc------ccccceeeeecccCccC--CCc---EEEEEeCCceE
Q psy3214 16 TPTDYVLKVSIASSSMCLSGFAGMDIPPPAGPIWILGD------VFIGKFYTVFDMDNNQK--NGT---QFAIRYGSGAV 84 (336)
Q Consensus 16 ~~~~y~~~~~~g~~~~c~~~~~~~~~dtGS~~~Wv~~~------c~~~~~y~~~~Sst~~~--~~~---~~~i~Yg~Gs~ 84 (336)
.-.+|..++++|+|+|.. .+.+||||+++||++. |..|+.|+|++|+||++ .+. .+.|.||+|++
T Consensus 117 ~d~~Y~~~I~IGTPpQ~f----~Vv~DTGSS~lWVps~~C~~~~C~~~~~yd~s~SSTy~~~~~~~~~~~~~i~YGsGs~ 192 (482)
T PTZ00165 117 HNSQYFGEIQVGTPPKSF----VVVFDTGSSNLWIPSKECKSGGCAPHRKFDPKKSSTYTKLKLGDESAETYIQYGTGEC 192 (482)
T ss_pred cCCeEEEEEEeCCCCceE----EEEEeCCCCCEEEEchhcCcccccccCCCCccccCCcEecCCCCccceEEEEeCCCcE
Confidence 345799999999999964 7889999999999974 55688999999999998 665 68899999999
Q ss_pred EEEEeEEEEEECCeEEeceEEEEEEeeCCcccccccccccccCccccc---ccCCCCchHHHHHHhcccCCCeEEEEeec
Q psy3214 85 SGYLSQDTLRIGDLTIKNQVFGEAIKEPGFTFVAAKFDGILGMGYDNI---AVDGVEPPFYNIIQQKLLEKNVFGFYLNR 161 (336)
Q Consensus 85 ~G~~~~D~v~ig~~~v~~~~fg~~~~~~~~~~~~~~~dGIlGLg~~~~---s~~~~~~~~~~l~~q~~i~~~~Fs~~l~~ 161 (336)
+|.+++|+|++|++++++|.||+++.+++..|...++|||||||++.+ +..+..|++++|++||+|++|+||+||++
T Consensus 193 ~G~l~~DtV~ig~l~i~~q~FG~a~~~s~~~f~~~~~DGILGLg~~~~s~~s~~~~~p~~~~l~~qgli~~~~FS~yL~~ 272 (482)
T PTZ00165 193 VLALGKDTVKIGGLKVKHQSIGLAIEESLHPFADLPFDGLVGLGFPDKDFKESKKALPIVDNIKKQNLLKRNIFSFYMSK 272 (482)
T ss_pred EEEEEEEEEEECCEEEccEEEEEEEeccccccccccccceeecCCCcccccccCCCCCHHHHHHHcCCcccceEEEEecc
Confidence 999999999999999999999999988776787788999999999987 34457899999999999999999999987
Q ss_pred CCCCCCCCceEEecCCCCCccc--ccccceeEecC-Cccc------c---------CCC---ccccchhhhhhhHHHHHH
Q psy3214 162 YNTEKLANGEVPIPSAHDPKEL--ESRIENKYQLP-EYDH------V---------GDG---CSASYTEMQQWTNNIIEA 220 (336)
Q Consensus 162 ~~~~~~~~G~l~f~GGiD~~~~--~G~l~~~~~~~-~~~~------~---------~~~---~~~s~t~l~~w~~~i~~~ 220 (336)
+. ..+|+|+| ||+|++++ .|+++|++... .+|. . ..+ ..++++++...+..++++
T Consensus 273 -~~--~~~G~l~f-GGiD~~~~~~~g~i~~~Pv~~~~yW~i~l~~i~vgg~~~~~~~~~~~aIiDTGTSli~lP~~~~~~ 348 (482)
T PTZ00165 273 -DL--NQPGSISF-GSADPKYTLEGHKIWWFPVISTDYWEIEVVDILIDGKSLGFCDRKCKAAIDTGSSLITGPSSVINP 348 (482)
T ss_pred -CC--CCCCEEEe-CCcCHHHcCCCCceEEEEccccceEEEEeCeEEECCEEeeecCCceEEEEcCCCccEeCCHHHHHH
Confidence 43 34799999 99999887 57899974332 1221 0 111 344778888888888887
Q ss_pred Hhcc
Q psy3214 221 INQG 224 (336)
Q Consensus 221 i~~g 224 (336)
+.+.
T Consensus 349 i~~~ 352 (482)
T PTZ00165 349 LLEK 352 (482)
T ss_pred HHHH
Confidence 7765
|
|
| >cd05490 Cathepsin_D2 Cathepsin_D2, pepsin family of proteinases | Back alignment and domain information |
|---|
| >cd05486 Cathespin_E Cathepsin E, non-lysosomal aspartic protease | Back alignment and domain information |
|---|
| >cd06098 phytepsin Phytepsin, a plant homolog of mammalian lysosomal pepsins | Back alignment and domain information |
|---|
| >cd05487 renin_like Renin stimulates production of angiotensin and thus affects blood pressure | Back alignment and domain information |
|---|
| >cd05478 pepsin_A Pepsin A, aspartic protease produced in gastric mucosa of mammals | Back alignment and domain information |
|---|
| >cd05477 gastricsin Gastricsins, asparate proteases produced in gastric mucosa | Back alignment and domain information |
|---|
| >cd05485 Cathepsin_D_like Cathepsin_D_like, pepsin family of proteinases | Back alignment and domain information |
|---|
| >PTZ00147 plasmepsin-1; Provisional | Back alignment and domain information |
|---|
| >cd05488 Proteinase_A_fungi Fungal Proteinase A , aspartic proteinase superfamily | Back alignment and domain information |
|---|
| >PTZ00013 plasmepsin 4 (PM4); Provisional | Back alignment and domain information |
|---|
| >PF03723 Hemocyanin_C: Hemocyanin, ig-like domain; InterPro: IPR005203 Haemocyanins are copper-containing oxygen transport proteins found in the haemolymph of many invertebrates | Back alignment and domain information |
|---|
| >cd06097 Aspergillopepsin_like Aspergillopepsin_like, aspartic proteases of fungal origin | Back alignment and domain information |
|---|
| >PF00026 Asp: Eukaryotic aspartyl protease The Prosite entry also includes Pfam:PF00077 | Back alignment and domain information |
|---|
| >cd05473 beta_secretase_like Beta-secretase, aspartic-acid protease important in the pathogenesis of Alzheimer's disease | Back alignment and domain information |
|---|
| >cd05471 pepsin_like Pepsin-like aspartic proteases, bilobal enzymes that cleave bonds in peptides at acidic pH | Back alignment and domain information |
|---|
| >cd06096 Plasmepsin_5 Plasmepsins are a class of aspartic proteinases produced by the plasmodium parasite | Back alignment and domain information |
|---|
| >KOG1339|consensus | Back alignment and domain information |
|---|
| >cd05474 SAP_like SAPs, pepsin-like proteinases secreted from pathogens to degrade host proteins | Back alignment and domain information |
|---|
| >cd05476 pepsin_A_like_plant Chroloplast Nucleoids DNA-binding Protease and Nucellin, pepsin-like aspartic proteases from plants | Back alignment and domain information |
|---|
| >cd05472 cnd41_like Chloroplast Nucleoids DNA-binding Protease, catalyzes the degradation of ribulose-1,5-bisphosphate carboxylase/oxygenase | Back alignment and domain information |
|---|
| >cd05475 nucellin_like Nucellins, plant aspartic proteases specifically expressed in nucellar cells during degradation | Back alignment and domain information |
|---|
| >PLN03146 aspartyl protease family protein; Provisional | Back alignment and domain information |
|---|
| >cd05470 pepsin_retropepsin_like Cellular and retroviral pepsin-like aspartate proteases | Back alignment and domain information |
|---|
| >PF14543 TAXi_N: Xylanase inhibitor N-terminal; PDB: 3HD8_A 3VLB_A 3VLA_A 3AUP_D 1T6G_A 1T6E_X 2B42_A | Back alignment and domain information |
|---|
| >cd05489 xylanase_inhibitor_I_like TAXI-I inhibits degradation of xylan in the cell wall | Back alignment and domain information |
|---|
| >cd05483 retropepsin_like_bacteria Bacterial aspartate proteases, retropepsin-like protease family | Back alignment and domain information |
|---|
| >cd06098 phytepsin Phytepsin, a plant homolog of mammalian lysosomal pepsins | Back alignment and domain information |
|---|
| >cd05490 Cathepsin_D2 Cathepsin_D2, pepsin family of proteinases | Back alignment and domain information |
|---|
| >cd05486 Cathespin_E Cathepsin E, non-lysosomal aspartic protease | Back alignment and domain information |
|---|
| >PTZ00165 aspartyl protease; Provisional | Back alignment and domain information |
|---|
| >cd05487 renin_like Renin stimulates production of angiotensin and thus affects blood pressure | Back alignment and domain information |
|---|
| >cd05485 Cathepsin_D_like Cathepsin_D_like, pepsin family of proteinases | Back alignment and domain information |
|---|
| >PTZ00147 plasmepsin-1; Provisional | Back alignment and domain information |
|---|
| >cd05488 Proteinase_A_fungi Fungal Proteinase A , aspartic proteinase superfamily | Back alignment and domain information |
|---|
| >PTZ00013 plasmepsin 4 (PM4); Provisional | Back alignment and domain information |
|---|
| >PF00026 Asp: Eukaryotic aspartyl protease The Prosite entry also includes Pfam:PF00077 | Back alignment and domain information |
|---|
| >PF13650 Asp_protease_2: Aspartyl protease | Back alignment and domain information |
|---|
| >cd05478 pepsin_A Pepsin A, aspartic protease produced in gastric mucosa of mammals | Back alignment and domain information |
|---|
| >cd05477 gastricsin Gastricsins, asparate proteases produced in gastric mucosa | Back alignment and domain information |
|---|
| >TIGR02281 clan_AA_DTGA clan AA aspartic protease, TIGR02281 family | Back alignment and domain information |
|---|
| >cd05489 xylanase_inhibitor_I_like TAXI-I inhibits degradation of xylan in the cell wall | Back alignment and domain information |
|---|
| >cd05474 SAP_like SAPs, pepsin-like proteinases secreted from pathogens to degrade host proteins | Back alignment and domain information |
|---|
| >KOG1339|consensus | Back alignment and domain information |
|---|
| >cd05475 nucellin_like Nucellins, plant aspartic proteases specifically expressed in nucellar cells during degradation | Back alignment and domain information |
|---|
| >cd05479 RP_DDI RP_DDI; retropepsin-like domain of DNA damage inducible protein | Back alignment and domain information |
|---|
| >cd05472 cnd41_like Chloroplast Nucleoids DNA-binding Protease, catalyzes the degradation of ribulose-1,5-bisphosphate carboxylase/oxygenase | Back alignment and domain information |
|---|
| >cd05476 pepsin_A_like_plant Chroloplast Nucleoids DNA-binding Protease and Nucellin, pepsin-like aspartic proteases from plants | Back alignment and domain information |
|---|
| >PF11925 DUF3443: Protein of unknown function (DUF3443); InterPro: IPR021847 This family of proteins are functionally uncharacterised | Back alignment and domain information |
|---|
| >cd06096 Plasmepsin_5 Plasmepsins are a class of aspartic proteinases produced by the plasmodium parasite | Back alignment and domain information |
|---|
| >cd05484 retropepsin_like_LTR_2 Retropepsins_like_LTR, pepsin-like aspartate proteases | Back alignment and domain information |
|---|
| >cd06095 RP_RTVL_H_like Retropepsin of the RTVL_H family of human endogenous retrovirus-like elements | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 336 | ||||
| 1g0v_A | 329 | The Structure Of Proteinase A Complexed With A Ia3 | 9e-30 | ||
| 2jxr_A | 329 | Structure Of Yeast Proteinase A Length = 329 | 1e-29 | ||
| 1dp5_A | 329 | The Structure Of Proteinase A Complexed With A Ia3 | 1e-29 | ||
| 1lya_B | 241 | Crystal Structures Of Native And Inhibited Forms Of | 6e-24 | ||
| 1lya_B | 241 | Crystal Structures Of Native And Inhibited Forms Of | 7e-18 | ||
| 1qdm_A | 478 | Crystal Structure Of Prophytepsin, A Zymogen Of A B | 7e-24 | ||
| 2x0b_A | 383 | Crystal Structure Of Human Angiotensinogen Complexe | 4e-21 | ||
| 3d91_A | 341 | Human Renin In Complex With Remikiren Length = 341 | 4e-21 | ||
| 2bks_A | 340 | Crystal Structure Of Renin-Pf00074777 Complex Lengt | 4e-21 | ||
| 2i4q_A | 336 | Human ReninPF02342674 COMPLEX Length = 336 | 4e-21 | ||
| 1hrn_A | 337 | High Resolution Crystal Structures Of Recombinant H | 4e-21 | ||
| 2g24_A | 333 | Ketopiperazine-Based Renin Inhibitors: Optimization | 4e-21 | ||
| 3vcm_A | 335 | Crystal Structure Of Human Prorenin Length = 335 | 3e-20 | ||
| 3oad_A | 166 | Design And Optimization Of New Piperidines As Renin | 4e-20 | ||
| 1smr_A | 335 | The 3-D Structure Of Mouse Submaxillary Renin Compl | 6e-19 | ||
| 1tzs_A | 351 | Crystal Structure Of An Activation Intermediate Of | 1e-18 | ||
| 1b5f_A | 239 | Native Cardosin A From Cynara Cardunculus L. Length | 2e-16 | ||
| 3oad_B | 176 | Design And Optimization Of New Piperidines As Renin | 1e-15 | ||
| 1am5_A | 324 | The Crystal Structure And Proposed Amino Acid Seque | 5e-15 | ||
| 1pso_E | 326 | The Crystal Structure Of Human Pepsin And Its Compl | 2e-14 | ||
| 1flh_A | 326 | Crystal Structure Of Human Uropepsin At 2.45 A Reso | 2e-14 | ||
| 1htr_B | 329 | Crystal And Molecular Structures Of Human Progastri | 2e-14 | ||
| 5pep_A | 326 | X-Ray Analyses Of Aspartic Proteases. Ii. Three-Dim | 4e-14 | ||
| 3psg_A | 370 | The High Resolution Crystal Structure Of Porcine Pe | 4e-14 | ||
| 3pep_A | 326 | Revised 2.3 Angstroms Structure Of Porcine Pepsin. | 4e-14 | ||
| 1psa_A | 326 | Structure Of A Pepsin(Slash)renin Inhibitor Complex | 4e-14 | ||
| 1f34_A | 326 | Crystal Structure Of Ascaris Pepsin Inhibitor-3 Bou | 4e-14 | ||
| 4pep_A | 326 | The Molecular And Crystal Structures Of Monoclinic | 4e-14 | ||
| 2psg_A | 370 | Refined Structure Of Porcine Pepsinogen At 1.8 Angs | 4e-14 | ||
| 1b5f_B | 87 | Native Cardosin A From Cynara Cardunculus L. Length | 5e-14 | ||
| 1czi_E | 323 | Chymosin Complex With The Inhibitor Cp-113972 Lengt | 1e-12 | ||
| 4aa9_A | 320 | Camel Chymosin At 1.6a Resolution Length = 320 | 2e-12 | ||
| 3cms_A | 323 | Engineering Enzyme Sub-Site Specificity: Preparatio | 2e-12 | ||
| 2bju_A | 453 | Plasmepsin Ii Complexed With A Highly Active Achira | 5e-12 | ||
| 1sme_A | 329 | Plasmepsin Ii, A Hemoglobin-Degrading Enzyme From P | 5e-12 | ||
| 1pfz_A | 380 | Proplasmepsin Ii From Plasmodium Falciparum Length | 6e-12 | ||
| 3f9q_A | 329 | Re-Refinement Of Uncomplexed Plasmepsin Ii From Pla | 6e-12 | ||
| 1m43_A | 331 | Crystal Structure Of Pmii In Complex With Pepstatin | 6e-12 | ||
| 1lf3_A | 331 | Crystal Structure Of Plasmepsin Ii From P Falciparu | 6e-12 | ||
| 1uh7_A | 325 | Crystal Structure Of Rhizopuspepsin At Ph 4.6 Lengt | 1e-11 | ||
| 3apr_E | 325 | Binding Of A Reduced Peptide Inhibitor To The Aspar | 1e-11 | ||
| 1ls5_A | 328 | Crystal Structure Of Plasmepsin Iv From P. Falcipar | 2e-10 | ||
| 2anl_A | 327 | X-Ray Crystal Structure Of The Aspartic Protease Pl | 5e-10 | ||
| 3qrv_A | 336 | Crystal Structure Of Plasmepsin I (Pmi) From Plasmo | 1e-09 | ||
| 1qs8_B | 329 | Crystal Structure Of The P. Vivax Aspartic Proteina | 2e-09 | ||
| 3ixv_A | 626 | Scorpion Hemocyanin Resting State Pseudo Atomic Mod | 3e-09 | ||
| 1miq_A | 375 | Crystal Structure Of Proplasmepsin From The Human M | 9e-09 | ||
| 3hhs_B | 684 | Crystal Structure Of Manduca Sexta Prophenoloxidase | 1e-08 | ||
| 3hhs_A | 694 | Crystal Structure Of Manduca Sexta Prophenoloxidase | 2e-08 | ||
| 1oxy_A | 628 | Crystallographic Analysis Of Oxygenated And Deoxyge | 4e-08 | ||
| 1ll1_A | 628 | Hydroxo Bridge Met Form Hemocyanin From Limulus Len | 4e-08 | ||
| 1lla_A | 628 | Crystal Structure Of Deoxygenated Limulus Polyphemu | 4e-08 | ||
| 1wkr_A | 340 | Crystal Structure Of Aspartic Proteinase From Irpex | 1e-06 | ||
| 3fns_A | 332 | Crystal Structure Of Histo-Aspartic Protease (Hap) | 5e-05 | ||
| 3qvc_A | 451 | Crystal Structure Of Histo-Aspartic Protease (Hap) | 1e-04 | ||
| 1lyw_A | 97 | Cathepsin D At Ph 7.5 Length = 97 | 2e-04 | ||
| 1hc1_A | 657 | Crystal Structure Of Hexameric Haemocyanin From Pan | 2e-04 | ||
| 2qzw_A | 341 | Secreted Aspartic Proteinase (Sap) 1 From Candida A | 3e-04 |
| >pdb|1G0V|A Chain A, The Structure Of Proteinase A Complexed With A Ia3 Mutant, Mvv Length = 329 | Back alignment and structure |
|
| >pdb|2JXR|A Chain A, Structure Of Yeast Proteinase A Length = 329 | Back alignment and structure |
| >pdb|1DP5|A Chain A, The Structure Of Proteinase A Complexed With A Ia3 Mutant Inhibitor Length = 329 | Back alignment and structure |
| >pdb|1LYA|B Chain B, Crystal Structures Of Native And Inhibited Forms Of Human Cathepsin D: Implications For Lysosomal Targeting And Drug Design Length = 241 | Back alignment and structure |
| >pdb|1LYA|B Chain B, Crystal Structures Of Native And Inhibited Forms Of Human Cathepsin D: Implications For Lysosomal Targeting And Drug Design Length = 241 | Back alignment and structure |
| >pdb|1QDM|A Chain A, Crystal Structure Of Prophytepsin, A Zymogen Of A Barley Vacuolar Aspartic Proteinase. Length = 478 | Back alignment and structure |
| >pdb|2X0B|A Chain A, Crystal Structure Of Human Angiotensinogen Complexed With Renin Length = 383 | Back alignment and structure |
| >pdb|3D91|A Chain A, Human Renin In Complex With Remikiren Length = 341 | Back alignment and structure |
| >pdb|2BKS|A Chain A, Crystal Structure Of Renin-Pf00074777 Complex Length = 340 | Back alignment and structure |
| >pdb|2I4Q|A Chain A, Human ReninPF02342674 COMPLEX Length = 336 | Back alignment and structure |
| >pdb|1HRN|A Chain A, High Resolution Crystal Structures Of Recombinant Human Renin In Complex With Polyhydroxymonoamide Inhibitors Length = 337 | Back alignment and structure |
| >pdb|2G24|A Chain A, Ketopiperazine-Based Renin Inhibitors: Optimization Of The "c" Ring Length = 333 | Back alignment and structure |
| >pdb|3VCM|A Chain A, Crystal Structure Of Human Prorenin Length = 335 | Back alignment and structure |
| >pdb|3OAD|A Chain A, Design And Optimization Of New Piperidines As Renin Inhibitors Length = 166 | Back alignment and structure |
| >pdb|1SMR|A Chain A, The 3-D Structure Of Mouse Submaxillary Renin Complexed With A Decapeptide Inhibitor Ch-66 Based On The 4-16 Fragment Of Rat Angiotensinogen Length = 335 | Back alignment and structure |
| >pdb|1TZS|A Chain A, Crystal Structure Of An Activation Intermediate Of Cathepsin E Length = 351 | Back alignment and structure |
| >pdb|1B5F|A Chain A, Native Cardosin A From Cynara Cardunculus L. Length = 239 | Back alignment and structure |
| >pdb|3OAD|B Chain B, Design And Optimization Of New Piperidines As Renin Inhibitors Length = 176 | Back alignment and structure |
| >pdb|1AM5|A Chain A, The Crystal Structure And Proposed Amino Acid Sequence Of A Pepsin From Atlantic Cod (Gadus Morhua) Length = 324 | Back alignment and structure |
| >pdb|1PSO|E Chain E, The Crystal Structure Of Human Pepsin And Its Complex With Pepstatin Length = 326 | Back alignment and structure |
| >pdb|1FLH|A Chain A, Crystal Structure Of Human Uropepsin At 2.45 A Resolution Length = 326 | Back alignment and structure |
| >pdb|1HTR|B Chain B, Crystal And Molecular Structures Of Human Progastricsin At 1.62 Angstroms Resolution Length = 329 | Back alignment and structure |
| >pdb|5PEP|A Chain A, X-Ray Analyses Of Aspartic Proteases. Ii. Three-Dimensional Structure Of The Hexagonal Crystal Form Of Porcine Pepsin At 2.3 Angstroms Resolution Length = 326 | Back alignment and structure |
| >pdb|3PSG|A Chain A, The High Resolution Crystal Structure Of Porcine Pepsinogen Length = 370 | Back alignment and structure |
| >pdb|3PEP|A Chain A, Revised 2.3 Angstroms Structure Of Porcine Pepsin. Evidence For A Flexible Subdomain Length = 326 | Back alignment and structure |
| >pdb|1PSA|A Chain A, Structure Of A Pepsin(Slash)renin Inhibitor Complex Reveals A Novel Crystal Packing Induced By Minor Chemical Alterations In The Inhibitor Length = 326 | Back alignment and structure |
| >pdb|1F34|A Chain A, Crystal Structure Of Ascaris Pepsin Inhibitor-3 Bound To Porcine Pepsin Length = 326 | Back alignment and structure |
| >pdb|4PEP|A Chain A, The Molecular And Crystal Structures Of Monoclinic Porcine Pepsin Refined At 1.8 Angstroms Resolution Length = 326 | Back alignment and structure |
| >pdb|2PSG|A Chain A, Refined Structure Of Porcine Pepsinogen At 1.8 Angstroms Resolution Length = 370 | Back alignment and structure |
| >pdb|1B5F|B Chain B, Native Cardosin A From Cynara Cardunculus L. Length = 87 | Back alignment and structure |
| >pdb|1CZI|E Chain E, Chymosin Complex With The Inhibitor Cp-113972 Length = 323 | Back alignment and structure |
| >pdb|4AA9|A Chain A, Camel Chymosin At 1.6a Resolution Length = 320 | Back alignment and structure |
| >pdb|3CMS|A Chain A, Engineering Enzyme Sub-Site Specificity: Preparation, Kinetic Characterization And X-Ray Analysis At 2.0-Angstroms Resolution Of Val111phe Site-Mutated Calf Chymosin Length = 323 | Back alignment and structure |
| >pdb|2BJU|A Chain A, Plasmepsin Ii Complexed With A Highly Active Achiral Inhibitor Length = 453 | Back alignment and structure |
| >pdb|1SME|A Chain A, Plasmepsin Ii, A Hemoglobin-Degrading Enzyme From Plasmodium Falciparum, In Complex With Pepstatin A Length = 329 | Back alignment and structure |
| >pdb|1PFZ|A Chain A, Proplasmepsin Ii From Plasmodium Falciparum Length = 380 | Back alignment and structure |
| >pdb|3F9Q|A Chain A, Re-Refinement Of Uncomplexed Plasmepsin Ii From Plasmodium Falciparum Length = 329 | Back alignment and structure |
| >pdb|1M43|A Chain A, Crystal Structure Of Pmii In Complex With Pepstatin A To 2.4 A Length = 331 | Back alignment and structure |
| >pdb|1LF3|A Chain A, Crystal Structure Of Plasmepsin Ii From P Falciparum In Complex With Inhibitor Eh58 Length = 331 | Back alignment and structure |
| >pdb|1UH7|A Chain A, Crystal Structure Of Rhizopuspepsin At Ph 4.6 Length = 325 | Back alignment and structure |
| >pdb|3APR|E Chain E, Binding Of A Reduced Peptide Inhibitor To The Aspartic Proteinase From Rhizopus Chinensis. Implications For A Mechanism Of Action Length = 325 | Back alignment and structure |
| >pdb|1LS5|A Chain A, Crystal Structure Of Plasmepsin Iv From P. Falciparum In Complex With Pepstatin A Length = 328 | Back alignment and structure |
| >pdb|2ANL|A Chain A, X-Ray Crystal Structure Of The Aspartic Protease Plasmepsin 4 From The Malarial Parasite Plasmodium Malariae Bound To An Allophenylnorstatine Based Inhibitor Length = 327 | Back alignment and structure |
| >pdb|3QRV|A Chain A, Crystal Structure Of Plasmepsin I (Pmi) From Plasmodium Falciparum Length = 336 | Back alignment and structure |
| >pdb|3IXV|A Chain A, Scorpion Hemocyanin Resting State Pseudo Atomic Model Built Cryo-Em Density Map Length = 626 | Back alignment and structure |
| >pdb|1MIQ|A Chain A, Crystal Structure Of Proplasmepsin From The Human Malarial Pathogen Plasmodium Vivax Length = 375 | Back alignment and structure |
| >pdb|3HHS|B Chain B, Crystal Structure Of Manduca Sexta Prophenoloxidase Length = 684 | Back alignment and structure |
| >pdb|3HHS|A Chain A, Crystal Structure Of Manduca Sexta Prophenoloxidase Length = 694 | Back alignment and structure |
| >pdb|1OXY|A Chain A, Crystallographic Analysis Of Oxygenated And Deoxygenated States Of Arthropod Hemocyanin Shows Unusual Differences Length = 628 | Back alignment and structure |
| >pdb|1LL1|A Chain A, Hydroxo Bridge Met Form Hemocyanin From Limulus Length = 628 | Back alignment and structure |
| >pdb|1LLA|A Chain A, Crystal Structure Of Deoxygenated Limulus Polyphemus Subunit Ii Hemocyanin At 2.18 Angstroms Resolution: Clues For A Mechanism For Allosteric Regulation Length = 628 | Back alignment and structure |
| >pdb|1WKR|A Chain A, Crystal Structure Of Aspartic Proteinase From Irpex Lacteus Length = 340 | Back alignment and structure |
| >pdb|3FNS|A Chain A, Crystal Structure Of Histo-Aspartic Protease (Hap) From Plasmodium Falciparum Length = 332 | Back alignment and structure |
| >pdb|3QVC|A Chain A, Crystal Structure Of Histo-Aspartic Protease (Hap) Zymogen From Plasmodium Falciparum Length = 451 | Back alignment and structure |
| >pdb|1LYW|A Chain A, Cathepsin D At Ph 7.5 Length = 97 | Back alignment and structure |
| >pdb|1HC1|A Chain A, Crystal Structure Of Hexameric Haemocyanin From Panulirus Interruptus Refined At 3.2 Angstroms Resolution Length = 657 | Back alignment and structure |
| >pdb|2QZW|A Chain A, Secreted Aspartic Proteinase (Sap) 1 From Candida Albicans Length = 341 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 336 | |||
| 1dpj_A | 329 | Proteinase A; proteinase A, hydrolase-hydrolase in | 2e-50 | |
| 1dpj_A | 329 | Proteinase A; proteinase A, hydrolase-hydrolase in | 9e-28 | |
| 1tzs_A | 351 | Cathepsin E; hydrolase, aspartic protease, activat | 1e-48 | |
| 1tzs_A | 351 | Cathepsin E; hydrolase, aspartic protease, activat | 6e-29 | |
| 1htr_B | 329 | Gastricsin; aspartyl protease; 1.62A {Homo sapiens | 2e-48 | |
| 1htr_B | 329 | Gastricsin; aspartyl protease; 1.62A {Homo sapiens | 2e-26 | |
| 1am5_A | 324 | Pepsin, acid proteinase; aspartyl protease, hydrol | 2e-47 | |
| 1am5_A | 324 | Pepsin, acid proteinase; aspartyl protease, hydrol | 3e-26 | |
| 3psg_A | 370 | Pepsinogen; hydrolase(acid proteinase zymogen); 1. | 4e-47 | |
| 3psg_A | 370 | Pepsinogen; hydrolase(acid proteinase zymogen); 1. | 5e-28 | |
| 3cms_A | 323 | Chymosin B; hydrolase, acid proteinase; 2.00A {Bos | 1e-46 | |
| 3cms_A | 323 | Chymosin B; hydrolase, acid proteinase; 2.00A {Bos | 8e-22 | |
| 1qdm_A | 478 | Prophytepsin; aspartic proteinases, saposin-like d | 3e-46 | |
| 1qdm_A | 478 | Prophytepsin; aspartic proteinases, saposin-like d | 2e-27 | |
| 1b5f_A | 239 | Protein (cardosin A); hydrolase, aspartic proteina | 4e-46 | |
| 2x0b_A | 383 | Renin; hydrolase-hormone complex, hydrolase hormon | 8e-45 | |
| 2x0b_A | 383 | Renin; hydrolase-hormone complex, hydrolase hormon | 6e-29 | |
| 3k1w_A | 341 | Renin; protease, alternative splicing, aspartyl pr | 4e-44 | |
| 3k1w_A | 341 | Renin; protease, alternative splicing, aspartyl pr | 8e-29 | |
| 1miq_A | 375 | Plasmepsin; aspartic proteinase zymogen, domain op | 5e-43 | |
| 1miq_A | 375 | Plasmepsin; aspartic proteinase zymogen, domain op | 6e-25 | |
| 1wkr_A | 340 | Polyporopepsin; hydrolase, hydrolase-hydrolase inh | 6e-43 | |
| 1wkr_A | 340 | Polyporopepsin; hydrolase, hydrolase-hydrolase inh | 1e-23 | |
| 2apr_A | 325 | Rhizopuspepsin; hydrolase (aspartic proteinase); 1 | 2e-42 | |
| 2apr_A | 325 | Rhizopuspepsin; hydrolase (aspartic proteinase); 1 | 7e-20 | |
| 2bju_A | 453 | Plasmepsin II; aspartic proteinase, drug design, m | 1e-41 | |
| 2bju_A | 453 | Plasmepsin II; aspartic proteinase, drug design, m | 2e-26 | |
| 3qvc_A | 451 | Histo-aspartic protease; HAP, plasmepsin, zymogen, | 1e-41 | |
| 3qvc_A | 451 | Histo-aspartic protease; HAP, plasmepsin, zymogen, | 3e-24 | |
| 1mpp_A | 361 | Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomu | 2e-41 | |
| 1mpp_A | 361 | Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomu | 8e-21 | |
| 1yg9_A | 330 | Aspartic protease BLA G 2; allegren, hydrolase, al | 3e-41 | |
| 1yg9_A | 330 | Aspartic protease BLA G 2; allegren, hydrolase, al | 4e-21 | |
| 2ewy_A | 383 | Beta-secretase 2; BACE2, aspartic protease, hydrol | 1e-38 | |
| 2ewy_A | 383 | Beta-secretase 2; BACE2, aspartic protease, hydrol | 1e-18 | |
| 3c9x_A | 329 | Trichoderma reesei aspartic protease; aspartic pro | 2e-37 | |
| 3c9x_A | 329 | Trichoderma reesei aspartic protease; aspartic pro | 5e-20 | |
| 1izd_A | 323 | Aspartic proteinase; sugar binding, acid protease, | 2e-36 | |
| 1izd_A | 323 | Aspartic proteinase; sugar binding, acid protease, | 7e-19 | |
| 1bxo_A | 323 | Protein (penicillopepsin); hydrolase, phosphonate | 5e-36 | |
| 1bxo_A | 323 | Protein (penicillopepsin); hydrolase, phosphonate | 2e-20 | |
| 1ibq_A | 325 | Aspergillopepsin; aspartic proteinase, hydrolase; | 5e-36 | |
| 1ibq_A | 325 | Aspergillopepsin; aspartic proteinase, hydrolase; | 1e-21 | |
| 1oew_A | 329 | Endothiapepsin; hydrolase, aspartic proteinase mec | 7e-36 | |
| 1oew_A | 329 | Endothiapepsin; hydrolase, aspartic proteinase mec | 1e-19 | |
| 2qzx_A | 342 | Candidapepsin-5; aspartic proteinase, aspartyl pro | 3e-34 | |
| 2qzx_A | 342 | Candidapepsin-5; aspartic proteinase, aspartyl pro | 4e-21 | |
| 3pvk_A | 342 | Candidapepsin-2; hydrolase; 1.27A {Candida albican | 4e-34 | |
| 3pvk_A | 342 | Candidapepsin-2; hydrolase; 1.27A {Candida albican | 8e-21 | |
| 1j71_A | 334 | Candidapepsin, aspartic proteinase; candida tropic | 1e-33 | |
| 1j71_A | 334 | Candidapepsin, aspartic proteinase; candida tropic | 8e-18 | |
| 3lpj_A | 455 | Beta-secretase 1; alzheimer'S, aspartyl protease, | 5e-33 | |
| 3lpj_A | 455 | Beta-secretase 1; alzheimer'S, aspartyl protease, | 9e-18 | |
| 2qp8_A | 395 | Beta-secretase 1; BACE1, protease, alternative spl | 6e-33 | |
| 2qp8_A | 395 | Beta-secretase 1; BACE1, protease, alternative spl | 1e-17 | |
| 1lya_B | 241 | Cathepsin D; lysosomal aspartic protease; HET: NAG | 2e-32 | |
| 1lya_B | 241 | Cathepsin D; lysosomal aspartic protease; HET: NAG | 1e-29 | |
| 3fv3_A | 339 | SAPP1P-secreted aspartic protease 1; secreted aspa | 1e-31 | |
| 3fv3_A | 339 | SAPP1P-secreted aspartic protease 1; secreted aspa | 4e-19 | |
| 1b5f_B | 87 | Protein (cardosin A); hydrolase, aspartic proteina | 6e-30 | |
| 3ixv_A | 626 | Hemocyanin AA6 chain; HC, phenolxoidase activity, | 2e-20 | |
| 3hhs_B | 684 | Propo-P1, phenoloxidase subunit 1; alpha helix, be | 3e-20 | |
| 3hhs_B | 684 | Propo-P1, phenoloxidase subunit 1; alpha helix, be | 5e-04 | |
| 1lla_A | 628 | Hemocyanin (subunit type II); oxygen transport; 2. | 7e-20 | |
| 3hhs_A | 694 | Propo-P2, phenoloxidase subunit 2; alpha helix, be | 3e-19 | |
| 3hhs_A | 694 | Propo-P2, phenoloxidase subunit 2; alpha helix, be | 2e-04 | |
| 1hc1_A | 657 | Arthropodan hemocyanin; oxygen transport; 3.20A {P | 1e-18 | |
| 3gwj_A | 674 | Arylphorin; mono-glucosylated N-glycan, stability, | 2e-16 | |
| 1lya_A | 97 | Cathepsin D; lysosomal aspartic protease; HET: NAG | 3e-10 | |
| 3aup_A | 403 | SBG7S, BG, basic 7S globulin; pepsin-like fold, pl | 3e-06 | |
| 3aup_A | 403 | SBG7S, BG, basic 7S globulin; pepsin-like fold, pl | 2e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-05 |
| >1dpj_A Proteinase A; proteinase A, hydrolase-hydrolase inhibitor COM; HET: BMA MAN NAG; 1.80A {Saccharomyces cerevisiae} SCOP: b.50.1.2 PDB: 1dp5_A* 1fmu_A* 1fmx_A* 1fq5_A* 1fq4_A* 1fq6_A* 1fq7_A* 1fq8_A* 2jxr_A* 1g0v_A* Length = 329 | Back alignment and structure |
|---|
Score = 169 bits (431), Expect = 2e-50
Identities = 61/104 (58%), Positives = 74/104 (71%)
Query: 69 QKNGTQFAIRYGSGAVSGYLSQDTLRIGDLTIKNQVFGEAIKEPGFTFVAAKFDGILGMG 128
+ NGT+FAI+YG+G++ GY+SQDTL IGDLTI Q F EA EPG TF KFDGILG+G
Sbjct: 66 KANGTEFAIQYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGLG 125
Query: 129 YDNIAVDGVEPPFYNIIQQKLLEKNVFGFYLNRYNTEKLANGEV 172
YD I+VD V PPFYN IQQ LL++ F FYL + + GE
Sbjct: 126 YDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEA 169
|
| >1dpj_A Proteinase A; proteinase A, hydrolase-hydrolase inhibitor COM; HET: BMA MAN NAG; 1.80A {Saccharomyces cerevisiae} SCOP: b.50.1.2 PDB: 1dp5_A* 1fmu_A* 1fmx_A* 1fq5_A* 1fq4_A* 1fq6_A* 1fq7_A* 1fq8_A* 2jxr_A* 1g0v_A* Length = 329 | Back alignment and structure |
|---|
| >1tzs_A Cathepsin E; hydrolase, aspartic protease, activation intermediate; 2.35A {Homo sapiens} Length = 351 | Back alignment and structure |
|---|
| >1tzs_A Cathepsin E; hydrolase, aspartic protease, activation intermediate; 2.35A {Homo sapiens} Length = 351 | Back alignment and structure |
|---|
| >1htr_B Gastricsin; aspartyl protease; 1.62A {Homo sapiens} SCOP: b.50.1.2 PDB: 1avf_A Length = 329 | Back alignment and structure |
|---|
| >1htr_B Gastricsin; aspartyl protease; 1.62A {Homo sapiens} SCOP: b.50.1.2 PDB: 1avf_A Length = 329 | Back alignment and structure |
|---|
| >1am5_A Pepsin, acid proteinase; aspartyl protease, hydrolase; 2.16A {Gadus morhua} SCOP: b.50.1.2 Length = 324 | Back alignment and structure |
|---|
| >1am5_A Pepsin, acid proteinase; aspartyl protease, hydrolase; 2.16A {Gadus morhua} SCOP: b.50.1.2 Length = 324 | Back alignment and structure |
|---|
| >3psg_A Pepsinogen; hydrolase(acid proteinase zymogen); 1.65A {Sus scrofa} SCOP: b.50.1.2 PDB: 2psg_A 4pep_A* 3pep_A* 1f34_A* 1psa_A* 1yx9_A 5pep_A 1flh_A 1qrp_E* 1psn_A* 1pso_E* 3utl_A Length = 370 | Back alignment and structure |
|---|
| >3psg_A Pepsinogen; hydrolase(acid proteinase zymogen); 1.65A {Sus scrofa} SCOP: b.50.1.2 PDB: 2psg_A 4pep_A* 3pep_A* 1f34_A* 1psa_A* 1yx9_A 5pep_A 1flh_A 1qrp_E* 1psn_A* 1pso_E* 3utl_A Length = 370 | Back alignment and structure |
|---|
| >3cms_A Chymosin B; hydrolase, acid proteinase; 2.00A {Bos taurus} SCOP: b.50.1.2 PDB: 4cms_A 1czi_E* 1cms_A Length = 323 | Back alignment and structure |
|---|
| >3cms_A Chymosin B; hydrolase, acid proteinase; 2.00A {Bos taurus} SCOP: b.50.1.2 PDB: 4cms_A 1czi_E* 1cms_A Length = 323 | Back alignment and structure |
|---|
| >1qdm_A Prophytepsin; aspartic proteinases, saposin-like domain, zymogen structure, hydrolase; 2.30A {Hordeum vulgare} SCOP: a.64.1.2 b.50.1.2 Length = 478 | Back alignment and structure |
|---|
| >1qdm_A Prophytepsin; aspartic proteinases, saposin-like domain, zymogen structure, hydrolase; 2.30A {Hordeum vulgare} SCOP: a.64.1.2 b.50.1.2 Length = 478 | Back alignment and structure |
|---|
| >1b5f_A Protein (cardosin A); hydrolase, aspartic proteinase; HET: NAG FUC BMA MAN; 1.72A {Cynara cardunculus} SCOP: b.50.1.2 Length = 239 | Back alignment and structure |
|---|
| >2x0b_A Renin; hydrolase-hormone complex, hydrolase hormone complex, vasoconstrictor, glycoprotein, hypertension, serpins; 4.33A {Homo sapiens} Length = 383 | Back alignment and structure |
|---|
| >2x0b_A Renin; hydrolase-hormone complex, hydrolase hormone complex, vasoconstrictor, glycoprotein, hypertension, serpins; 4.33A {Homo sapiens} Length = 383 | Back alignment and structure |
|---|
| >3k1w_A Renin; protease, alternative splicing, aspartyl protease, cleavage on PAIR of basic residues, disease mutation, disulfide bond, glycoprotein; HET: BFX NDG HSQ; 1.50A {Homo sapiens} PDB: 3d91_A* 3g70_A* 3g6z_A* 3own_A* 2iko_A* 1bbs_A* 1rne_A* 2bkt_A* 2bks_A* 2iku_A* 2il2_A* 2ren_A* 2v0z_C* 2v10_C* 2v11_C* 2v12_C* 2v13_A* 2v16_C* 3g72_A* 3oot_A* ... Length = 341 | Back alignment and structure |
|---|
| >3k1w_A Renin; protease, alternative splicing, aspartyl protease, cleavage on PAIR of basic residues, disease mutation, disulfide bond, glycoprotein; HET: BFX NDG HSQ; 1.50A {Homo sapiens} PDB: 3d91_A* 3g70_A* 3g6z_A* 3own_A* 2iko_A* 1bbs_A* 1rne_A* 2bkt_A* 2bks_A* 2iku_A* 2il2_A* 2ren_A* 2v0z_C* 2v10_C* 2v11_C* 2v12_C* 2v13_A* 2v16_C* 3g72_A* 3oot_A* ... Length = 341 | Back alignment and structure |
|---|
| >1miq_A Plasmepsin; aspartic proteinase zymogen, domain opening, hydrolase; 2.50A {Plasmodium vivax} SCOP: b.50.1.2 PDB: 1ls5_A* Length = 375 | Back alignment and structure |
|---|
| >1miq_A Plasmepsin; aspartic proteinase zymogen, domain opening, hydrolase; 2.50A {Plasmodium vivax} SCOP: b.50.1.2 PDB: 1ls5_A* Length = 375 | Back alignment and structure |
|---|
| >1wkr_A Polyporopepsin; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.30A {Irpex lacteus} SCOP: b.50.1.2 Length = 340 | Back alignment and structure |
|---|
| >1wkr_A Polyporopepsin; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.30A {Irpex lacteus} SCOP: b.50.1.2 Length = 340 | Back alignment and structure |
|---|
| >2apr_A Rhizopuspepsin; hydrolase (aspartic proteinase); 1.80A {Rhizopus microsporus var} SCOP: b.50.1.2 PDB: 3apr_E* 4apr_E* 5apr_E* 6apr_E* 1uh9_A 1uh8_A 1uh7_A Length = 325 | Back alignment and structure |
|---|
| >2apr_A Rhizopuspepsin; hydrolase (aspartic proteinase); 1.80A {Rhizopus microsporus var} SCOP: b.50.1.2 PDB: 3apr_E* 4apr_E* 5apr_E* 6apr_E* 1uh9_A 1uh8_A 1uh7_A Length = 325 | Back alignment and structure |
|---|
| >2bju_A Plasmepsin II; aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen; HET: IH4; 1.56A {Plasmodium falciparum} SCOP: b.50.1.2 PDB: 1pfz_A 1xdh_A* 1lf3_A 1w6h_A* 1w6i_A* 1lf4_A* 1lf2_A* 1lee_A* 1m43_A* 2igx_A* 1sme_A* 1me6_A* 1xe6_A* 1xe5_A* 2igy_A* 2r9b_A 3f9q_A 3qrv_A 3qs1_A* 2anl_A* ... Length = 453 | Back alignment and structure |
|---|
| >2bju_A Plasmepsin II; aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen; HET: IH4; 1.56A {Plasmodium falciparum} SCOP: b.50.1.2 PDB: 1pfz_A 1xdh_A* 1lf3_A 1w6h_A* 1w6i_A* 1lf4_A* 1lf2_A* 1lee_A* 1m43_A* 2igx_A* 1sme_A* 1me6_A* 1xe6_A* 1xe5_A* 2igy_A* 2r9b_A 3f9q_A 3qrv_A 3qs1_A* 2anl_A* ... Length = 453 | Back alignment and structure |
|---|
| >3qvc_A Histo-aspartic protease; HAP, plasmepsin, zymogen, hydrolase; 2.10A {Plasmodium falciparum} PDB: 3qvi_A* 3fns_A 3fnt_A* 3fnu_A* Length = 451 | Back alignment and structure |
|---|
| >3qvc_A Histo-aspartic protease; HAP, plasmepsin, zymogen, hydrolase; 2.10A {Plasmodium falciparum} PDB: 3qvi_A* 3fns_A 3fnt_A* 3fnu_A* Length = 451 | Back alignment and structure |
|---|
| >1mpp_A Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomucor pusillus} SCOP: b.50.1.2 PDB: 2asi_A* 2rmp_A* Length = 361 | Back alignment and structure |
|---|
| >1mpp_A Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomucor pusillus} SCOP: b.50.1.2 PDB: 2asi_A* 2rmp_A* Length = 361 | Back alignment and structure |
|---|
| >1yg9_A Aspartic protease BLA G 2; allegren, hydrolase, allergen; HET: NAG; 1.30A {Blattella germanica} PDB: 2nr6_A* 3liz_A* Length = 330 | Back alignment and structure |
|---|
| >1yg9_A Aspartic protease BLA G 2; allegren, hydrolase, allergen; HET: NAG; 1.30A {Blattella germanica} PDB: 2nr6_A* 3liz_A* Length = 330 | Back alignment and structure |
|---|
| >2ewy_A Beta-secretase 2; BACE2, aspartic protease, hydrolase; HET: DBO; 3.10A {Homo sapiens} Length = 383 | Back alignment and structure |
|---|
| >2ewy_A Beta-secretase 2; BACE2, aspartic protease, hydrolase; HET: DBO; 3.10A {Homo sapiens} Length = 383 | Back alignment and structure |
|---|
| >3c9x_A Trichoderma reesei aspartic protease; aspartic proteinase, aspartyl protease, hydrolase; 1.70A {Trichoderma reesei} PDB: 3c9y_A* 3emy_A* Length = 329 | Back alignment and structure |
|---|
| >3c9x_A Trichoderma reesei aspartic protease; aspartic proteinase, aspartyl protease, hydrolase; 1.70A {Trichoderma reesei} PDB: 3c9y_A* 3emy_A* Length = 329 | Back alignment and structure |
|---|
| >1izd_A Aspartic proteinase; sugar binding, acid protease, hydrolase; HET: MAN; 1.90A {Aspergillus oryzae} SCOP: b.50.1.2 PDB: 1ize_A* Length = 323 | Back alignment and structure |
|---|
| >1izd_A Aspartic proteinase; sugar binding, acid protease, hydrolase; HET: MAN; 1.90A {Aspergillus oryzae} SCOP: b.50.1.2 PDB: 1ize_A* Length = 323 | Back alignment and structure |
|---|
| >1bxo_A Protein (penicillopepsin); hydrolase, phosphonate inhibitors, macrocycle; HET: MAN PP7; 0.95A {Penicillium janthinellum} SCOP: b.50.1.2 PDB: 1apu_E* 1apv_E* 1apw_E* 1apt_E* 1bxq_A* 1ppk_E* 1ppl_E* 1ppm_E* 2wea_A* 2web_A* 2wec_A* 2wed_A* 3app_A Length = 323 | Back alignment and structure |
|---|
| >1bxo_A Protein (penicillopepsin); hydrolase, phosphonate inhibitors, macrocycle; HET: MAN PP7; 0.95A {Penicillium janthinellum} SCOP: b.50.1.2 PDB: 1apu_E* 1apv_E* 1apw_E* 1apt_E* 1bxq_A* 1ppk_E* 1ppl_E* 1ppm_E* 2wea_A* 2web_A* 2wec_A* 2wed_A* 3app_A Length = 323 | Back alignment and structure |
|---|
| >1ibq_A Aspergillopepsin; aspartic proteinase, hydrolase; HET: MAN; 2.14A {Aspergillus phoenicis} SCOP: b.50.1.2 Length = 325 | Back alignment and structure |
|---|
| >1ibq_A Aspergillopepsin; aspartic proteinase, hydrolase; HET: MAN; 2.14A {Aspergillus phoenicis} SCOP: b.50.1.2 Length = 325 | Back alignment and structure |
|---|
| >1oew_A Endothiapepsin; hydrolase, aspartic proteinase mechanism, atomic resolution, succinimide, anisotropic refinement; HET: SUI; 0.9A {Cryphonectria parasitica} SCOP: b.50.1.2 PDB: 1gkt_A* 1gvt_A* 1gvv_A* 1gvw_A* 1gvx_A* 1gvu_A* 1oex_A* 2jji_A* 2jjj_A* 2vs2_A* 3uri_A* 3urj_A* 3url_A* 3pww_A* 1e80_E* 1e81_E* 1e82_E* 1e5o_E* 1eed_P* 1epl_E* ... Length = 329 | Back alignment and structure |
|---|
| >1oew_A Endothiapepsin; hydrolase, aspartic proteinase mechanism, atomic resolution, succinimide, anisotropic refinement; HET: SUI; 0.9A {Cryphonectria parasitica} SCOP: b.50.1.2 PDB: 1gkt_A* 1gvt_A* 1gvv_A* 1gvw_A* 1gvx_A* 1gvu_A* 1oex_A* 2jji_A* 2jjj_A* 2vs2_A* 3uri_A* 3urj_A* 3url_A* 3pww_A* 1e80_E* 1e81_E* 1e82_E* 1e5o_E* 1eed_P* 1epl_E* ... Length = 329 | Back alignment and structure |
|---|
| >2qzx_A Candidapepsin-5; aspartic proteinase, aspartyl protease, CL PAIR of basic residues, glycoprotein, protease, secreted; HET: STA; 2.50A {Candida albicans} Length = 342 | Back alignment and structure |
|---|
| >2qzx_A Candidapepsin-5; aspartic proteinase, aspartyl protease, CL PAIR of basic residues, glycoprotein, protease, secreted; HET: STA; 2.50A {Candida albicans} Length = 342 | Back alignment and structure |
|---|
| >3pvk_A Candidapepsin-2; hydrolase; 1.27A {Candida albicans} PDB: 1eag_A 3q70_A* 1zap_A* 2qzw_A 2h6t_A* 2h6s_A* Length = 342 | Back alignment and structure |
|---|
| >3pvk_A Candidapepsin-2; hydrolase; 1.27A {Candida albicans} PDB: 1eag_A 3q70_A* 1zap_A* 2qzw_A 2h6t_A* 2h6s_A* Length = 342 | Back alignment and structure |
|---|
| >1j71_A Candidapepsin, aspartic proteinase; candida tropicalis aspartic protease, SAPT1, hydrolase; 1.80A {Candida tropicalis} SCOP: b.50.1.2 Length = 334 | Back alignment and structure |
|---|
| >1j71_A Candidapepsin, aspartic proteinase; candida tropicalis aspartic protease, SAPT1, hydrolase; 1.80A {Candida tropicalis} SCOP: b.50.1.2 Length = 334 | Back alignment and structure |
|---|
| >3lpj_A Beta-secretase 1; alzheimer'S, aspartyl protease, hydrolase; HET: TLA Z75; 1.79A {Homo sapiens} PDB: 3lpi_A* 3lpk_A* 3ohf_A* 3ohh_A* 3r2f_A* 3skf_A* 3skg_A* 2hiz_A* 2p83_A* 2va7_A* 2va5_A* 2va6_A* Length = 455 | Back alignment and structure |
|---|
| >3lpj_A Beta-secretase 1; alzheimer'S, aspartyl protease, hydrolase; HET: TLA Z75; 1.79A {Homo sapiens} PDB: 3lpi_A* 3lpk_A* 3ohf_A* 3ohh_A* 3r2f_A* 3skf_A* 3skg_A* 2hiz_A* 2p83_A* 2va7_A* 2va5_A* 2va6_A* Length = 455 | Back alignment and structure |
|---|
| >2qp8_A Beta-secretase 1; BACE1, protease, alternative splicing, aspartyl protease, glycoprotein, hydrolase, membrane, transmembrane, zymogen; HET: TAR SC7; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 2qk5_A* 2qmf_A* 2qmg_A* 2qmd_A* 4djx_A* 3l59_A* 3l5b_A* 3l5c_A* 3l58_A* 3l5d_A* 3l5f_A* 4dju_A* 4djv_A* 4djw_A* 3l5e_A* 4djy_A* 2zhv_A 2zhs_A 2zhr_A 2zhu_A ... Length = 395 | Back alignment and structure |
|---|
| >2qp8_A Beta-secretase 1; BACE1, protease, alternative splicing, aspartyl protease, glycoprotein, hydrolase, membrane, transmembrane, zymogen; HET: TAR SC7; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 2qk5_A* 2qmf_A* 2qmg_A* 2qmd_A* 4djx_A* 3l59_A* 3l5b_A* 3l5c_A* 3l58_A* 3l5d_A* 3l5f_A* 4dju_A* 4djv_A* 4djw_A* 3l5e_A* 4djy_A* 2zhv_A 2zhs_A 2zhr_A 2zhu_A ... Length = 395 | Back alignment and structure |
|---|
| >1lya_B Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_B* 1lyw_B* Length = 241 | Back alignment and structure |
|---|
| >1lya_B Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_B* 1lyw_B* Length = 241 | Back alignment and structure |
|---|
| >3fv3_A SAPP1P-secreted aspartic protease 1; secreted aspartic protease, virulence factor, H; HET: STA; 1.85A {Candida parapsilosis} PDB: 3tne_A* Length = 339 | Back alignment and structure |
|---|
| >3fv3_A SAPP1P-secreted aspartic protease 1; secreted aspartic protease, virulence factor, H; HET: STA; 1.85A {Candida parapsilosis} PDB: 3tne_A* Length = 339 | Back alignment and structure |
|---|
| >1b5f_B Protein (cardosin A); hydrolase, aspartic proteinase; HET: NAG FUC BMA MAN; 1.72A {Cynara cardunculus} SCOP: b.50.1.2 Length = 87 | Back alignment and structure |
|---|
| >3ixv_A Hemocyanin AA6 chain; HC, phenolxoidase activity, tyrosinase (TY), catecholoxidase (CO), enzyme, SDS, cryo-EM, single particle analysis; 6.80A {Androctonus australis} PDB: 3ixw_A Length = 626 | Back alignment and structure |
|---|
| >3hhs_B Propo-P1, phenoloxidase subunit 1; alpha helix, beta strand, melanin biosynthesis, metal-bindin monooxygenase, oxidoreductase, secreted; 1.97A {Manduca sexta} Length = 684 | Back alignment and structure |
|---|
| >3hhs_B Propo-P1, phenoloxidase subunit 1; alpha helix, beta strand, melanin biosynthesis, metal-bindin monooxygenase, oxidoreductase, secreted; 1.97A {Manduca sexta} Length = 684 | Back alignment and structure |
|---|
| >1lla_A Hemocyanin (subunit type II); oxygen transport; 2.18A {Limulus polyphemus} SCOP: a.85.1.1 a.86.1.1 b.1.18.3 PDB: 1nol_A 1ll1_A 1oxy_A Length = 628 | Back alignment and structure |
|---|
| >3hhs_A Propo-P2, phenoloxidase subunit 2; alpha helix, beta strand, melanin biosynthesis, metal-bindin monooxygenase, oxidoreductase, secreted; 1.97A {Manduca sexta} Length = 694 | Back alignment and structure |
|---|
| >3hhs_A Propo-P2, phenoloxidase subunit 2; alpha helix, beta strand, melanin biosynthesis, metal-bindin monooxygenase, oxidoreductase, secreted; 1.97A {Manduca sexta} Length = 694 | Back alignment and structure |
|---|
| >1hc1_A Arthropodan hemocyanin; oxygen transport; 3.20A {Panulirus interruptus} SCOP: a.85.1.1 a.86.1.1 b.1.18.3 PDB: 1hc2_A 1hc3_A 1hc4_A 1hc5_A 1hc6_A 1hcy_A* Length = 657 | Back alignment and structure |
|---|
| >3gwj_A Arylphorin; mono-glucosylated N-glycan, stability, glycosyla glycoprotein, secreted, storage protein, oxygen transport; HET: NAG BMA MAN GLC; 2.43A {Antheraea pernyi} Length = 674 | Back alignment and structure |
|---|
| >1lya_A Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_A* 1lyw_A* Length = 97 | Back alignment and structure |
|---|
| >3aup_A SBG7S, BG, basic 7S globulin; pepsin-like fold, plant protein; 1.91A {Glycine max} Length = 403 | Back alignment and structure |
|---|
| >3aup_A SBG7S, BG, basic 7S globulin; pepsin-like fold, plant protein; 1.91A {Glycine max} Length = 403 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 336 | |||
| 3psg_A | 370 | Pepsinogen; hydrolase(acid proteinase zymogen); 1. | 100.0 | |
| 2x0b_A | 383 | Renin; hydrolase-hormone complex, hydrolase hormon | 100.0 | |
| 1tzs_A | 351 | Cathepsin E; hydrolase, aspartic protease, activat | 100.0 | |
| 1b5f_A | 239 | Protein (cardosin A); hydrolase, aspartic proteina | 100.0 | |
| 4aa9_A | 320 | Chymosin; hydrolase, aspartic peptidase, rennet; H | 99.98 | |
| 3k1w_A | 341 | Renin; protease, alternative splicing, aspartyl pr | 99.98 | |
| 1qdm_A | 478 | Prophytepsin; aspartic proteinases, saposin-like d | 99.97 | |
| 3ixv_A | 626 | Hemocyanin AA6 chain; HC, phenolxoidase activity, | 99.97 | |
| 3cms_A | 323 | Chymosin B; hydrolase, acid proteinase; 2.00A {Bos | 99.97 | |
| 1am5_A | 324 | Pepsin, acid proteinase; aspartyl protease, hydrol | 99.97 | |
| 1htr_B | 329 | Gastricsin; aspartyl protease; 1.62A {Homo sapiens | 99.97 | |
| 3qvc_A | 451 | Histo-aspartic protease; HAP, plasmepsin, zymogen, | 99.97 | |
| 1dpj_A | 329 | Proteinase A; proteinase A, hydrolase-hydrolase in | 99.97 | |
| 3hhs_A | 694 | Propo-P2, phenoloxidase subunit 2; alpha helix, be | 99.97 | |
| 3hhs_B | 684 | Propo-P1, phenoloxidase subunit 1; alpha helix, be | 99.97 | |
| 2bju_A | 453 | Plasmepsin II; aspartic proteinase, drug design, m | 99.97 | |
| 1mpp_A | 361 | Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomu | 99.97 | |
| 1lla_A | 628 | Hemocyanin (subunit type II); oxygen transport; 2. | 99.97 | |
| 1miq_A | 375 | Plasmepsin; aspartic proteinase zymogen, domain op | 99.97 | |
| 2apr_A | 325 | Rhizopuspepsin; hydrolase (aspartic proteinase); 1 | 99.97 | |
| 1yg9_A | 330 | Aspartic protease BLA G 2; allegren, hydrolase, al | 99.97 | |
| 1hc1_A | 657 | Arthropodan hemocyanin; oxygen transport; 3.20A {P | 99.97 | |
| 3gwj_A | 674 | Arylphorin; mono-glucosylated N-glycan, stability, | 99.96 | |
| 1oew_A | 329 | Endothiapepsin; hydrolase, aspartic proteinase mec | 99.96 | |
| 3c9x_A | 329 | Trichoderma reesei aspartic protease; aspartic pro | 99.96 | |
| 3fv3_A | 339 | SAPP1P-secreted aspartic protease 1; secreted aspa | 99.96 | |
| 1j71_A | 334 | Candidapepsin, aspartic proteinase; candida tropic | 99.96 | |
| 2qzx_A | 342 | Candidapepsin-5; aspartic proteinase, aspartyl pro | 99.96 | |
| 3pvk_A | 342 | Candidapepsin-2; hydrolase; 1.27A {Candida albican | 99.96 | |
| 1bxo_A | 323 | Protein (penicillopepsin); hydrolase, phosphonate | 99.96 | |
| 1wkr_A | 340 | Polyporopepsin; hydrolase, hydrolase-hydrolase inh | 99.96 | |
| 1ibq_A | 325 | Aspergillopepsin; aspartic proteinase, hydrolase; | 99.96 | |
| 1izd_A | 323 | Aspartic proteinase; sugar binding, acid protease, | 99.96 | |
| 3vf3_A | 402 | Beta-secretase 1; structure-based drug design, hyd | 99.95 | |
| 2ewy_A | 383 | Beta-secretase 2; BACE2, aspartic protease, hydrol | 99.95 | |
| 3lpj_A | 455 | Beta-secretase 1; alzheimer'S, aspartyl protease, | 99.95 | |
| 2qp8_A | 395 | Beta-secretase 1; BACE1, protease, alternative spl | 99.95 | |
| 3aup_A | 403 | SBG7S, BG, basic 7S globulin; pepsin-like fold, pl | 99.89 | |
| 3vla_A | 413 | EDGP; extracellular, inhibitor, plant protein; HET | 99.88 | |
| 1t6e_X | 381 | Xylanase inhibitor; two beta-barrel domain structu | 99.85 | |
| 1lya_B | 241 | Cathepsin D; lysosomal aspartic protease; HET: NAG | 99.68 | |
| 1lya_A | 97 | Cathepsin D; lysosomal aspartic protease; HET: NAG | 99.66 | |
| 1b5f_B | 87 | Protein (cardosin A); hydrolase, aspartic proteina | 98.54 | |
| 1lya_B | 241 | Cathepsin D; lysosomal aspartic protease; HET: NAG | 97.66 | |
| 1qdm_A | 478 | Prophytepsin; aspartic proteinases, saposin-like d | 97.64 | |
| 2x0b_A | 383 | Renin; hydrolase-hormone complex, hydrolase hormon | 97.6 | |
| 3psg_A | 370 | Pepsinogen; hydrolase(acid proteinase zymogen); 1. | 97.33 | |
| 1tzs_A | 351 | Cathepsin E; hydrolase, aspartic protease, activat | 97.11 | |
| 1dpj_A | 329 | Proteinase A; proteinase A, hydrolase-hydrolase in | 97.08 | |
| 3k1w_A | 341 | Renin; protease, alternative splicing, aspartyl pr | 97.06 | |
| 1am5_A | 324 | Pepsin, acid proteinase; aspartyl protease, hydrol | 96.82 | |
| 1wkr_A | 340 | Polyporopepsin; hydrolase, hydrolase-hydrolase inh | 96.8 | |
| 1htr_B | 329 | Gastricsin; aspartyl protease; 1.62A {Homo sapiens | 96.58 | |
| 1yg9_A | 330 | Aspartic protease BLA G 2; allegren, hydrolase, al | 96.51 | |
| 1miq_A | 375 | Plasmepsin; aspartic proteinase zymogen, domain op | 96.41 | |
| 3qvc_A | 451 | Histo-aspartic protease; HAP, plasmepsin, zymogen, | 96.27 | |
| 3cms_A | 323 | Chymosin B; hydrolase, acid proteinase; 2.00A {Bos | 96.25 | |
| 4aa9_A | 320 | Chymosin; hydrolase, aspartic peptidase, rennet; H | 95.99 | |
| 1bxo_A | 323 | Protein (penicillopepsin); hydrolase, phosphonate | 95.87 | |
| 2bju_A | 453 | Plasmepsin II; aspartic proteinase, drug design, m | 95.86 | |
| 1ibq_A | 325 | Aspergillopepsin; aspartic proteinase, hydrolase; | 95.82 | |
| 1izd_A | 323 | Aspartic proteinase; sugar binding, acid protease, | 95.76 | |
| 3c9x_A | 329 | Trichoderma reesei aspartic protease; aspartic pro | 95.74 | |
| 1oew_A | 329 | Endothiapepsin; hydrolase, aspartic proteinase mec | 95.69 | |
| 1mpp_A | 361 | Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomu | 95.19 | |
| 2apr_A | 325 | Rhizopuspepsin; hydrolase (aspartic proteinase); 1 | 95.14 | |
| 3vla_A | 413 | EDGP; extracellular, inhibitor, plant protein; HET | 95.07 | |
| 1t6e_X | 381 | Xylanase inhibitor; two beta-barrel domain structu | 94.74 | |
| 3aup_A | 403 | SBG7S, BG, basic 7S globulin; pepsin-like fold, pl | 94.67 | |
| 3fv3_A | 339 | SAPP1P-secreted aspartic protease 1; secreted aspa | 94.18 | |
| 1j71_A | 334 | Candidapepsin, aspartic proteinase; candida tropic | 92.89 | |
| 2qzx_A | 342 | Candidapepsin-5; aspartic proteinase, aspartyl pro | 92.88 | |
| 3pvk_A | 342 | Candidapepsin-2; hydrolase; 1.27A {Candida albican | 92.22 | |
| 2qp8_A | 395 | Beta-secretase 1; BACE1, protease, alternative spl | 91.24 | |
| 2ewy_A | 383 | Beta-secretase 2; BACE2, aspartic protease, hydrol | 90.0 | |
| 3lpj_A | 455 | Beta-secretase 1; alzheimer'S, aspartyl protease, | 89.55 | |
| 2i1a_A | 148 | DNA damage-inducible protein DDI1; acid protease f | 88.72 | |
| 3vf3_A | 402 | Beta-secretase 1; structure-based drug design, hyd | 87.9 |
| >3psg_A Pepsinogen; hydrolase(acid proteinase zymogen); 1.65A {Sus scrofa} SCOP: b.50.1.2 PDB: 2psg_A 4pep_A* 3pep_A* 1f34_A* 1psa_A* 1yx9_A 5pep_A 1flh_A 1qrp_E* 1psn_A* 1pso_E* 3utl_A | Back alignment and structure |
|---|
Probab=100.00 E-value=2.4e-34 Score=275.31 Aligned_cols=200 Identities=24% Similarity=0.392 Sum_probs=168.7
Q ss_pred ccCceeEeccCCccceecccccCcCCCCCCCcEEEcc------ccccceeeeecccCccCCCcEEEEEeCCceEEEEEeE
Q psy3214 17 PTDYVLKVSIASSSMCLSGFAGMDIPPPAGPIWILGD------VFIGKFYTVFDMDNNQKNGTQFAIRYGSGAVSGYLSQ 90 (336)
Q Consensus 17 ~~~y~~~~~~g~~~~c~~~~~~~~~dtGS~~~Wv~~~------c~~~~~y~~~~Sst~~~~~~~~~i~Yg~Gs~~G~~~~ 90 (336)
...|..++.+|+|+|.. .+.+||||+++||++. |..|+.|+|++|+||+..++.|++.||+|+++|.+++
T Consensus 55 d~~Y~~~i~iGTPpQ~~----~v~~DTGSs~lWV~s~~C~~~~C~~~~~y~~~~SsT~~~~~~~~~i~Yg~Gs~~G~~~~ 130 (370)
T 3psg_A 55 DTEYFGTIGIGTPAQDF----TVIFDTGSSNLWVPSVYCSSLACSDHNQFNPDDSSTFEATSQELSITYGTGSMTGILGY 130 (370)
T ss_dssp TCCEEEEEEETTTTEEE----EEEEETTCCCEEEEBTTCCSGGGTTSCCBCGGGCTTCEEEEEEEEEESSSCEEEEEEEE
T ss_pred CCEEEEEEEEcCCCCEE----EEEEeCCCCccEEECCCCCCcccCCCCCCCCccCcCcEECCcEEEEEeCCceEEEEEEE
Confidence 45799999999999864 7889999999999974 4568899999999999999999999999999999999
Q ss_pred EEEEECCeEEeceEEEEEEeeCCcccccccccccccCcccccccCCCCchHHHHHHhcccCCCeEEEEeecCCCCCCCCc
Q psy3214 91 DTLRIGDLTIKNQVFGEAIKEPGFTFVAAKFDGILGMGYDNIAVDGVEPPFYNIIQQKLLEKNVFGFYLNRYNTEKLANG 170 (336)
Q Consensus 91 D~v~ig~~~v~~~~fg~~~~~~~~~~~~~~~dGIlGLg~~~~s~~~~~~~~~~l~~q~~i~~~~Fs~~l~~~~~~~~~~G 170 (336)
|+|+++++++++|.||++...++..|...++|||||||++.++..+..|++++|++||+|++++||+||++ + ...+|
T Consensus 131 Dtv~ig~~~v~~~~Fg~a~~~~~~~~~~~~~dGIlGLg~~~~s~~~~~~~~~~l~~qg~i~~~~FS~~L~~-~--~~~~G 207 (370)
T 3psg_A 131 DTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISASGATPVFDNLWDQGLVSQDLFSVYLSS-N--DDSGS 207 (370)
T ss_dssp EEEEETTEEEEEEEEEEECSCCCGGGGGCSCSEEEECSCGGGCGGGCCCHHHHHHHTTCSSSSEEEEEEC--------CE
T ss_pred EEEeeCCcccCCeEEEEEEeecccccccCCccceeccCCccccccCCCCHHHHHHHCCCCCCCEEEEEEcc-C--CCCCe
Confidence 99999999999999999998877677888899999999999988888899999999999999999999999 4 34689
Q ss_pred eEEecCCCCCcccccccceeEecCC-cc------c--------cCCC---ccccchhhhhhhHHHHHHHhcc
Q psy3214 171 EVPIPSAHDPKELESRIENKYQLPE-YD------H--------VGDG---CSASYTEMQQWTNNIIEAINQG 224 (336)
Q Consensus 171 ~l~f~GGiD~~~~~G~l~~~~~~~~-~~------~--------~~~~---~~~s~t~l~~w~~~i~~~i~~g 224 (336)
+|+| ||+|+++|+|+++|++.... +| . +..+ ..++++++...+..+++++.+.
T Consensus 208 ~l~f-Gg~D~~~y~g~l~~~pv~~~~~w~v~l~~i~v~g~~~~~~~~~~aiiDTGTs~~~lP~~~~~~i~~~ 278 (370)
T 3psg_A 208 VVLL-GGIDSSYYTGSLNWVPVSVEGYWQITLDSITMDGETIACSGGCQAIVDTGTSLLTGPTSAIANIQSD 278 (370)
T ss_dssp EEEE-TCCCGGGBSSCCEEEECSEETTEEEEECEEESSSSEEECTTCEEEEECTTCCSEEEEHHHHHHHHHH
T ss_pred EEEE-EeeChHhcCCcceeecccccceeEEEEeEEEECCEEEecCCCceEEEcCCCCcEECCHHHHHHHHHH
Confidence 9999 99999999999999743321 11 1 1111 2336788888888888777765
|
| >2x0b_A Renin; hydrolase-hormone complex, hydrolase hormone complex, vasoconstrictor, glycoprotein, hypertension, serpins; 4.33A {Homo sapiens} | Back alignment and structure |
|---|
| >1tzs_A Cathepsin E; hydrolase, aspartic protease, activation intermediate; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1b5f_A Protein (cardosin A); hydrolase, aspartic proteinase; HET: NAG FUC BMA MAN; 1.72A {Cynara cardunculus} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >4aa9_A Chymosin; hydrolase, aspartic peptidase, rennet; HET: NAG; 1.60A {Camelus dromedarius} PDB: 4aa8_A 1czi_E* 1cms_A 4cms_A 3cms_A | Back alignment and structure |
|---|
| >3k1w_A Renin; protease, alternative splicing, aspartyl protease, cleavage on PAIR of basic residues, disease mutation, disulfide bond, glycoprotein; HET: BFX NDG HSQ; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 3d91_A* 3g70_A* 3g6z_A* 3own_A* 2iko_A* 1bbs_A* 1rne_A* 2bkt_A* 2bks_A* 2iku_A* 2il2_A* 2ren_A* 2v0z_C* 2v10_C* 2v11_C* 2v12_C* 2v13_A* 2v16_C* 3g72_A* 3oot_A* ... | Back alignment and structure |
|---|
| >1qdm_A Prophytepsin; aspartic proteinases, saposin-like domain, zymogen structure, hydrolase; 2.30A {Hordeum vulgare} SCOP: a.64.1.2 b.50.1.2 | Back alignment and structure |
|---|
| >3ixv_A Hemocyanin AA6 chain; HC, phenolxoidase activity, tyrosinase (TY), catecholoxidase (CO), enzyme, SDS, cryo-EM, single particle analysis; 6.80A {Androctonus australis} PDB: 3ixw_A | Back alignment and structure |
|---|
| >3cms_A Chymosin B; hydrolase, acid proteinase; 2.00A {Bos taurus} SCOP: b.50.1.2 PDB: 4cms_A 1czi_E* 1cms_A | Back alignment and structure |
|---|
| >1am5_A Pepsin, acid proteinase; aspartyl protease, hydrolase; 2.16A {Gadus morhua} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >1htr_B Gastricsin; aspartyl protease; 1.62A {Homo sapiens} SCOP: b.50.1.2 PDB: 1avf_A | Back alignment and structure |
|---|
| >3qvc_A Histo-aspartic protease; HAP, plasmepsin, zymogen, hydrolase; 2.10A {Plasmodium falciparum} PDB: 3qvi_A* 3fns_A 3fnt_A* 3fnu_A* | Back alignment and structure |
|---|
| >1dpj_A Proteinase A; proteinase A, hydrolase-hydrolase inhibitor COM; HET: BMA MAN NAG; 1.80A {Saccharomyces cerevisiae} SCOP: b.50.1.2 PDB: 1dp5_A* 1fmu_A* 1fmx_A* 1fq5_A* 1fq4_A* 1fq6_A* 1fq7_A* 1fq8_A* 2jxr_A* 1g0v_A* | Back alignment and structure |
|---|
| >3hhs_A Propo-P2, phenoloxidase subunit 2; alpha helix, beta strand, melanin biosynthesis, metal-bindin monooxygenase, oxidoreductase, secreted; 1.97A {Manduca sexta} | Back alignment and structure |
|---|
| >3hhs_B Propo-P1, phenoloxidase subunit 1; alpha helix, beta strand, melanin biosynthesis, metal-bindin monooxygenase, oxidoreductase, secreted; 1.97A {Manduca sexta} | Back alignment and structure |
|---|
| >2bju_A Plasmepsin II; aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen; HET: IH4; 1.56A {Plasmodium falciparum} SCOP: b.50.1.2 PDB: 1pfz_A 1xdh_A* 1lf3_A 1w6h_A* 1w6i_A* 1lf4_A* 1lf2_A* 1lee_A* 1m43_A* 2igx_A* 1sme_A* 1me6_A* 1xe6_A* 1xe5_A* 2igy_A* 2r9b_A 3f9q_A 3qrv_A 3qs1_A* 2anl_A* ... | Back alignment and structure |
|---|
| >1mpp_A Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomucor pusillus} SCOP: b.50.1.2 PDB: 2asi_A* 2rmp_A* | Back alignment and structure |
|---|
| >1lla_A Hemocyanin (subunit type II); oxygen transport; 2.18A {Limulus polyphemus} SCOP: a.85.1.1 a.86.1.1 b.1.18.3 PDB: 1nol_A 1ll1_A 1oxy_A | Back alignment and structure |
|---|
| >1miq_A Plasmepsin; aspartic proteinase zymogen, domain opening, hydrolase; 2.50A {Plasmodium vivax} SCOP: b.50.1.2 PDB: 1ls5_A* | Back alignment and structure |
|---|
| >2apr_A Rhizopuspepsin; hydrolase (aspartic proteinase); 1.80A {Rhizopus microsporus var} SCOP: b.50.1.2 PDB: 3apr_E* 4apr_E* 5apr_E* 6apr_E* 1uh9_A 1uh8_A 1uh7_A | Back alignment and structure |
|---|
| >1yg9_A Aspartic protease BLA G 2; allegren, hydrolase, allergen; HET: NAG; 1.30A {Blattella germanica} PDB: 2nr6_A* 3liz_A* | Back alignment and structure |
|---|
| >1hc1_A Arthropodan hemocyanin; oxygen transport; 3.20A {Panulirus interruptus} SCOP: a.85.1.1 a.86.1.1 b.1.18.3 PDB: 1hc2_A 1hc3_A 1hc4_A 1hc5_A 1hc6_A 1hcy_A* | Back alignment and structure |
|---|
| >3gwj_A Arylphorin; mono-glucosylated N-glycan, stability, glycosyla glycoprotein, secreted, storage protein, oxygen transport; HET: NAG BMA MAN GLC; 2.43A {Antheraea pernyi} | Back alignment and structure |
|---|
| >1oew_A Endothiapepsin; hydrolase, aspartic proteinase mechanism, atomic resolution, succinimide, anisotropic refinement; HET: SUI; 0.9A {Cryphonectria parasitica} SCOP: b.50.1.2 PDB: 1gkt_A* 1gvt_A* 1gvv_A* 1gvw_A* 1gvx_A* 1gvu_A* 1oex_A* 2jji_A* 2jjj_A* 2vs2_A* 3uri_A* 3urj_A* 3url_A* 3pww_A* 1e80_E* 1e81_E* 1e82_E* 1e5o_E* 1eed_P* 1epl_E* ... | Back alignment and structure |
|---|
| >3c9x_A Trichoderma reesei aspartic protease; aspartic proteinase, aspartyl protease, hydrolase; 1.70A {Trichoderma reesei} PDB: 3c9y_A* 3emy_A* | Back alignment and structure |
|---|
| >3fv3_A SAPP1P-secreted aspartic protease 1; secreted aspartic protease, virulence factor, H; HET: STA; 1.85A {Candida parapsilosis} SCOP: b.50.1.0 PDB: 3tne_A* | Back alignment and structure |
|---|
| >1j71_A Candidapepsin, aspartic proteinase; candida tropicalis aspartic protease, SAPT1, hydrolase; 1.80A {Candida tropicalis} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >2qzx_A Candidapepsin-5; aspartic proteinase, aspartyl protease, CL PAIR of basic residues, glycoprotein, protease, secreted; HET: STA; 2.50A {Candida albicans} | Back alignment and structure |
|---|
| >3pvk_A Candidapepsin-2; hydrolase; 1.27A {Candida albicans} SCOP: b.50.1.2 PDB: 1eag_A 3q70_A* 1zap_A* 2qzw_A 2h6t_A* 2h6s_A* | Back alignment and structure |
|---|
| >1bxo_A Protein (penicillopepsin); hydrolase, phosphonate inhibitors, macrocycle; HET: MAN PP7; 0.95A {Penicillium janthinellum} SCOP: b.50.1.2 PDB: 1apu_E* 1apv_E* 1apw_E* 1apt_E* 1bxq_A* 1ppk_E* 1ppl_E* 1ppm_E* 2wea_A* 2web_A* 2wec_A* 2wed_A* 3app_A | Back alignment and structure |
|---|
| >1wkr_A Polyporopepsin; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.30A {Irpex lacteus} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >1ibq_A Aspergillopepsin; aspartic proteinase, hydrolase; HET: MAN; 2.14A {Aspergillus phoenicis} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >1izd_A Aspartic proteinase; sugar binding, acid protease, hydrolase; HET: MAN; 1.90A {Aspergillus oryzae} SCOP: b.50.1.2 PDB: 1ize_A* | Back alignment and structure |
|---|
| >3vf3_A Beta-secretase 1; structure-based drug design, hydrolase-hydrolase inhibitor C; HET: 0GS; 1.48A {Homo sapiens} PDB: 2f3e_A* 2f3f_A* 1ym2_A* 3dv1_A* 3dv5_A* 3k5c_A* 3k5f_A* 3k5g_A* 3pi5_A* 3qbh_A* 3duy_A* 3veu_A* 3vg1_A* 4d83_A* 4d88_A* 4d89_A* 4d8c_A* 3msk_A* 3k5d_A* 1ym4_A* ... | Back alignment and structure |
|---|
| >2ewy_A Beta-secretase 2; BACE2, aspartic protease, hydrolase; HET: DBO; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3lpj_A Beta-secretase 1; alzheimer'S, aspartyl protease, hydrolase; HET: TLA Z75; 1.79A {Homo sapiens} PDB: 3lpi_A* 3lpk_A* 3ohf_A* 3ohh_A* 3r2f_A* 3skf_A* 3skg_A* 4fse_A* 2hiz_A* 2p83_A* 2va7_A* 2va5_A* 2va6_A* | Back alignment and structure |
|---|
| >2qp8_A Beta-secretase 1; BACE1, protease, alternative splicing, aspartyl protease, glycoprotein, hydrolase, membrane, transmembrane, zymogen; HET: TAR SC7; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 2qk5_A* 2qmf_A* 2qmg_A* 2qmd_A* 4djx_A* 3l59_A* 3l5b_A* 3l5c_A* 3l58_A* 3l5d_A* 3l5f_A* 4dju_A* 4djv_A* 4djw_A* 3l5e_A* 4djy_A* 2zhv_A 2zhs_A 2zhr_A 2zhu_A ... | Back alignment and structure |
|---|
| >3aup_A SBG7S, BG, basic 7S globulin; pepsin-like fold, plant protein; 1.91A {Glycine max} | Back alignment and structure |
|---|
| >3vla_A EDGP; extracellular, inhibitor, plant protein; HET: NAG; 0.95A {Daucus carota} PDB: 3vlb_A | Back alignment and structure |
|---|
| >1t6e_X Xylanase inhibitor; two beta-barrel domain structure, hydrolase inhibitor; 1.70A {Triticum aestivum} SCOP: b.50.1.2 PDB: 1t6g_A 2b42_A 3hd8_A | Back alignment and structure |
|---|
| >1lya_B Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_B* 1lyw_B* | Back alignment and structure |
|---|
| >1lya_A Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_A* 1lyw_A* | Back alignment and structure |
|---|
| >1b5f_B Protein (cardosin A); hydrolase, aspartic proteinase; HET: NAG FUC BMA MAN; 1.72A {Cynara cardunculus} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >1lya_B Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_B* 1lyw_B* | Back alignment and structure |
|---|
| >1qdm_A Prophytepsin; aspartic proteinases, saposin-like domain, zymogen structure, hydrolase; 2.30A {Hordeum vulgare} SCOP: a.64.1.2 b.50.1.2 | Back alignment and structure |
|---|
| >2x0b_A Renin; hydrolase-hormone complex, hydrolase hormone complex, vasoconstrictor, glycoprotein, hypertension, serpins; 4.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3psg_A Pepsinogen; hydrolase(acid proteinase zymogen); 1.65A {Sus scrofa} SCOP: b.50.1.2 PDB: 2psg_A 4pep_A* 3pep_A* 1f34_A* 1psa_A* 1yx9_A 5pep_A 1flh_A 1qrp_E* 1psn_A* 1pso_E* 3utl_A | Back alignment and structure |
|---|
| >1tzs_A Cathepsin E; hydrolase, aspartic protease, activation intermediate; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1dpj_A Proteinase A; proteinase A, hydrolase-hydrolase inhibitor COM; HET: BMA MAN NAG; 1.80A {Saccharomyces cerevisiae} SCOP: b.50.1.2 PDB: 1dp5_A* 1fmu_A* 1fmx_A* 1fq5_A* 1fq4_A* 1fq6_A* 1fq7_A* 1fq8_A* 2jxr_A* 1g0v_A* | Back alignment and structure |
|---|
| >3k1w_A Renin; protease, alternative splicing, aspartyl protease, cleavage on PAIR of basic residues, disease mutation, disulfide bond, glycoprotein; HET: BFX NDG HSQ; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 3d91_A* 3g70_A* 3g6z_A* 3own_A* 2iko_A* 1bbs_A* 1rne_A* 2bkt_A* 2bks_A* 2iku_A* 2il2_A* 2ren_A* 2v0z_C* 2v10_C* 2v11_C* 2v12_C* 2v13_A* 2v16_C* 3g72_A* 3oot_A* ... | Back alignment and structure |
|---|
| >1am5_A Pepsin, acid proteinase; aspartyl protease, hydrolase; 2.16A {Gadus morhua} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >1wkr_A Polyporopepsin; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.30A {Irpex lacteus} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >1htr_B Gastricsin; aspartyl protease; 1.62A {Homo sapiens} SCOP: b.50.1.2 PDB: 1avf_A | Back alignment and structure |
|---|
| >1yg9_A Aspartic protease BLA G 2; allegren, hydrolase, allergen; HET: NAG; 1.30A {Blattella germanica} PDB: 2nr6_A* 3liz_A* | Back alignment and structure |
|---|
| >1miq_A Plasmepsin; aspartic proteinase zymogen, domain opening, hydrolase; 2.50A {Plasmodium vivax} SCOP: b.50.1.2 PDB: 1ls5_A* | Back alignment and structure |
|---|
| >3qvc_A Histo-aspartic protease; HAP, plasmepsin, zymogen, hydrolase; 2.10A {Plasmodium falciparum} PDB: 3qvi_A* 3fns_A 3fnt_A* 3fnu_A* | Back alignment and structure |
|---|
| >3cms_A Chymosin B; hydrolase, acid proteinase; 2.00A {Bos taurus} SCOP: b.50.1.2 PDB: 4cms_A 1czi_E* 1cms_A | Back alignment and structure |
|---|
| >4aa9_A Chymosin; hydrolase, aspartic peptidase, rennet; HET: NAG; 1.60A {Camelus dromedarius} PDB: 4aa8_A 1czi_E* 1cms_A 4cms_A 3cms_A | Back alignment and structure |
|---|
| >1bxo_A Protein (penicillopepsin); hydrolase, phosphonate inhibitors, macrocycle; HET: MAN PP7; 0.95A {Penicillium janthinellum} SCOP: b.50.1.2 PDB: 1apu_E* 1apv_E* 1apw_E* 1apt_E* 1bxq_A* 1ppk_E* 1ppl_E* 1ppm_E* 2wea_A* 2web_A* 2wec_A* 2wed_A* 3app_A | Back alignment and structure |
|---|
| >2bju_A Plasmepsin II; aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen; HET: IH4; 1.56A {Plasmodium falciparum} SCOP: b.50.1.2 PDB: 1pfz_A 1xdh_A* 1lf3_A 1w6h_A* 1w6i_A* 1lf4_A* 1lf2_A* 1lee_A* 1m43_A* 2igx_A* 1sme_A* 1me6_A* 1xe6_A* 1xe5_A* 2igy_A* 2r9b_A 3f9q_A 3qrv_A 3qs1_A* 2anl_A* ... | Back alignment and structure |
|---|
| >1ibq_A Aspergillopepsin; aspartic proteinase, hydrolase; HET: MAN; 2.14A {Aspergillus phoenicis} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >1izd_A Aspartic proteinase; sugar binding, acid protease, hydrolase; HET: MAN; 1.90A {Aspergillus oryzae} SCOP: b.50.1.2 PDB: 1ize_A* | Back alignment and structure |
|---|
| >3c9x_A Trichoderma reesei aspartic protease; aspartic proteinase, aspartyl protease, hydrolase; 1.70A {Trichoderma reesei} PDB: 3c9y_A* 3emy_A* | Back alignment and structure |
|---|
| >1oew_A Endothiapepsin; hydrolase, aspartic proteinase mechanism, atomic resolution, succinimide, anisotropic refinement; HET: SUI; 0.9A {Cryphonectria parasitica} SCOP: b.50.1.2 PDB: 1gkt_A* 1gvt_A* 1gvv_A* 1gvw_A* 1gvx_A* 1gvu_A* 1oex_A* 2jji_A* 2jjj_A* 2vs2_A* 3uri_A* 3urj_A* 3url_A* 3pww_A* 1e80_E* 1e81_E* 1e82_E* 1e5o_E* 1eed_P* 1epl_E* ... | Back alignment and structure |
|---|
| >1mpp_A Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomucor pusillus} SCOP: b.50.1.2 PDB: 2asi_A* 2rmp_A* | Back alignment and structure |
|---|
| >2apr_A Rhizopuspepsin; hydrolase (aspartic proteinase); 1.80A {Rhizopus microsporus var} SCOP: b.50.1.2 PDB: 3apr_E* 4apr_E* 5apr_E* 6apr_E* 1uh9_A 1uh8_A 1uh7_A | Back alignment and structure |
|---|
| >3vla_A EDGP; extracellular, inhibitor, plant protein; HET: NAG; 0.95A {Daucus carota} PDB: 3vlb_A | Back alignment and structure |
|---|
| >1t6e_X Xylanase inhibitor; two beta-barrel domain structure, hydrolase inhibitor; 1.70A {Triticum aestivum} SCOP: b.50.1.2 PDB: 1t6g_A 2b42_A 3hd8_A | Back alignment and structure |
|---|
| >3aup_A SBG7S, BG, basic 7S globulin; pepsin-like fold, plant protein; 1.91A {Glycine max} | Back alignment and structure |
|---|
| >3fv3_A SAPP1P-secreted aspartic protease 1; secreted aspartic protease, virulence factor, H; HET: STA; 1.85A {Candida parapsilosis} SCOP: b.50.1.0 PDB: 3tne_A* | Back alignment and structure |
|---|
| >1j71_A Candidapepsin, aspartic proteinase; candida tropicalis aspartic protease, SAPT1, hydrolase; 1.80A {Candida tropicalis} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >2qzx_A Candidapepsin-5; aspartic proteinase, aspartyl protease, CL PAIR of basic residues, glycoprotein, protease, secreted; HET: STA; 2.50A {Candida albicans} | Back alignment and structure |
|---|
| >3pvk_A Candidapepsin-2; hydrolase; 1.27A {Candida albicans} SCOP: b.50.1.2 PDB: 1eag_A 3q70_A* 1zap_A* 2qzw_A 2h6t_A* 2h6s_A* | Back alignment and structure |
|---|
| >2qp8_A Beta-secretase 1; BACE1, protease, alternative splicing, aspartyl protease, glycoprotein, hydrolase, membrane, transmembrane, zymogen; HET: TAR SC7; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 2qk5_A* 2qmf_A* 2qmg_A* 2qmd_A* 4djx_A* 3l59_A* 3l5b_A* 3l5c_A* 3l58_A* 3l5d_A* 3l5f_A* 4dju_A* 4djv_A* 4djw_A* 3l5e_A* 4djy_A* 2zhv_A 2zhs_A 2zhr_A 2zhu_A ... | Back alignment and structure |
|---|
| >2ewy_A Beta-secretase 2; BACE2, aspartic protease, hydrolase; HET: DBO; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3lpj_A Beta-secretase 1; alzheimer'S, aspartyl protease, hydrolase; HET: TLA Z75; 1.79A {Homo sapiens} PDB: 3lpi_A* 3lpk_A* 3ohf_A* 3ohh_A* 3r2f_A* 3skf_A* 3skg_A* 4fse_A* 2hiz_A* 2p83_A* 2va7_A* 2va5_A* 2va6_A* | Back alignment and structure |
|---|
| >2i1a_A DNA damage-inducible protein DDI1; acid protease fold, dimer, retroviral protease domain, protein turnover; HET: DNA; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vf3_A Beta-secretase 1; structure-based drug design, hydrolase-hydrolase inhibitor C; HET: 0GS; 1.48A {Homo sapiens} PDB: 2f3e_A* 2f3f_A* 1ym2_A* 3dv1_A* 3dv5_A* 3k5c_A* 3k5f_A* 3k5g_A* 3pi5_A* 3qbh_A* 3duy_A* 3veu_A* 3vg1_A* 4d83_A* 4d88_A* 4d89_A* 4d8c_A* 3msk_A* 3k5d_A* 1ym4_A* ... | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 336 | ||||
| d1hc1a3 | 255 | b.1.18.3 (A:399-653) Arthropod hemocyanin, C-termi | 1e-22 | |
| d1dpja_ | 329 | b.50.1.2 (A:) Acid protease {Baker's yeast (Saccha | 6e-22 | |
| d1dpja_ | 329 | b.50.1.2 (A:) Acid protease {Baker's yeast (Saccha | 3e-18 | |
| d1hrna_ | 337 | b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Ho | 4e-21 | |
| d1hrna_ | 337 | b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Ho | 2e-18 | |
| d1smra_ | 335 | b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mu | 2e-20 | |
| d1smra_ | 335 | b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mu | 2e-15 | |
| d1llaa3 | 249 | b.1.18.3 (A:380-628) Arthropod hemocyanin, C-termi | 3e-20 | |
| g1lya.1 | 338 | b.50.1.2 (A:,B:) Cathepsin D {Human (Homo sapiens) | 4e-20 | |
| g1lya.1 | 338 | b.50.1.2 (A:,B:) Cathepsin D {Human (Homo sapiens) | 2e-15 | |
| d1qdma2 | 337 | b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase | 1e-19 | |
| d1qdma2 | 337 | b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase | 7e-15 | |
| d3psga_ | 370 | b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxI | 1e-18 | |
| d3psga_ | 370 | b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxI | 1e-15 | |
| g1b5f.1 | 326 | b.50.1.2 (A:,B:) Plant acid proteinase, phytepsin | 2e-18 | |
| g1b5f.1 | 326 | b.50.1.2 (A:,B:) Plant acid proteinase, phytepsin | 2e-13 | |
| d1wkra_ | 340 | b.50.1.2 (A:) Acid protease {Irpex lacteus (Polypo | 2e-17 | |
| d1wkra_ | 340 | b.50.1.2 (A:) Acid protease {Irpex lacteus (Polypo | 2e-14 | |
| d1miqa_ | 373 | b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading e | 2e-17 | |
| d1miqa_ | 373 | b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading e | 8e-11 | |
| g1htr.1 | 372 | b.50.1.2 (P:,B:) Pepsin(ogen) {Human (Homo sapiens | 1e-16 | |
| g1htr.1 | 372 | b.50.1.2 (P:,B:) Pepsin(ogen) {Human (Homo sapiens | 2e-16 | |
| d1am5a_ | 324 | b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus mo | 1e-16 | |
| d1am5a_ | 324 | b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus mo | 8e-16 | |
| d2bjua1 | 329 | b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrad | 5e-16 | |
| d2qp8a1 | 387 | b.50.1.2 (A:60-446) beta-secretase (memapsin) {Hum | 3e-15 | |
| d2qp8a1 | 387 | b.50.1.2 (A:60-446) beta-secretase (memapsin) {Hum | 2e-11 | |
| d1oewa_ | 330 | b.50.1.2 (A:) Endothiapepsin {Chestnut blight fung | 3e-15 | |
| d1oewa_ | 330 | b.50.1.2 (A:) Endothiapepsin {Chestnut blight fung | 4e-10 | |
| d1t6ex_ | 381 | b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Tr | 1e-14 | |
| d1t6ex_ | 381 | b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Tr | 7e-11 | |
| d1bxoa_ | 323 | b.50.1.2 (A:) Acid protease {Fungus (Penicillium j | 2e-14 | |
| d1bxoa_ | 323 | b.50.1.2 (A:) Acid protease {Fungus (Penicillium j | 5e-09 | |
| d2apra_ | 325 | b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus | 5e-14 | |
| d2apra_ | 325 | b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus | 4e-10 | |
| d3cmsa_ | 323 | b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos | 1e-13 | |
| d3cmsa_ | 323 | b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos | 5e-13 | |
| d1mppa_ | 357 | b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840] | 2e-13 | |
| d1mppa_ | 357 | b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840] | 9e-13 | |
| d1izea_ | 323 | b.50.1.2 (A:) Acid protease {Fungus (Aspergillus o | 1e-12 | |
| d1izea_ | 323 | b.50.1.2 (A:) Acid protease {Fungus (Aspergillus o | 2e-09 | |
| d1j71a_ | 334 | b.50.1.2 (A:) Acid protease {Yeast (Candida tropic | 1e-12 | |
| d1j71a_ | 334 | b.50.1.2 (A:) Acid protease {Yeast (Candida tropic | 3e-08 | |
| d1eaga_ | 342 | b.50.1.2 (A:) Acid protease {Yeast (Candida albica | 4e-12 | |
| d1eaga_ | 342 | b.50.1.2 (A:) Acid protease {Yeast (Candida albica | 1e-10 | |
| d1hc1a2 | 263 | a.86.1.1 (A:136-398) Arthropod hemocyanin {Spiny l | 3e-04 |
| >d1hc1a3 b.1.18.3 (A:399-653) Arthropod hemocyanin, C-terminal domain {Spiny lobster (Panulirus interruptus) [TaxId: 6735]} Length = 255 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: E set domains family: Arthropod hemocyanin, C-terminal domain domain: Arthropod hemocyanin, C-terminal domain species: Spiny lobster (Panulirus interruptus) [TaxId: 6735]
Score = 93.0 bits (231), Expect = 1e-22
Identities = 33/112 (29%), Positives = 50/112 (44%), Gaps = 10/112 (8%)
Query: 229 LEYPGVELKSLRILNKQGPTDQLETFWQLIRMDEV-YVRDKELTEEYNI---PYHIQHED 284
LE+ G+ + + I + L TF+ + + V E E+ I + + H +
Sbjct: 8 LEFSGMVVNGVAIDGE------LITFFDEFQYSLINAVDSGENIEDVEINARVHRLNHNE 61
Query: 285 FKYEITIENNSNETKTGIMRIFLGAKNDIEGNELPLSAQRSLFIELDKFRVH 336
F Y+IT+ NN++ + RIFL D G L L R IELDKF
Sbjct: 62 FTYKITMSNNNDGERLATFRIFLCPIEDNNGITLTLDEARWFCIELDKFFQK 113
|
| >d1dpja_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]} Length = 329 | Back information, alignment and structure |
|---|
| >d1dpja_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]} Length = 329 | Back information, alignment and structure |
|---|
| >d1hrna_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1hrna_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1smra_ b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mus musculus) [TaxId: 10090]} Length = 335 | Back information, alignment and structure |
|---|
| >d1smra_ b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mus musculus) [TaxId: 10090]} Length = 335 | Back information, alignment and structure |
|---|
| >d1llaa3 b.1.18.3 (A:380-628) Arthropod hemocyanin, C-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]} Length = 249 | Back information, alignment and structure |
|---|
| >d1qdma2 b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase, phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 337 | Back information, alignment and structure |
|---|
| >d1qdma2 b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase, phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 337 | Back information, alignment and structure |
|---|
| >d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} Length = 370 | Back information, alignment and structure |
|---|
| >d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} Length = 370 | Back information, alignment and structure |
|---|
| >d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]} Length = 340 | Back information, alignment and structure |
|---|
| >d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]} Length = 340 | Back information, alignment and structure |
|---|
| >d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} Length = 373 | Back information, alignment and structure |
|---|
| >d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} Length = 373 | Back information, alignment and structure |
|---|
| >d1am5a_ b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 8049]} Length = 324 | Back information, alignment and structure |
|---|
| >d1am5a_ b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 8049]} Length = 324 | Back information, alignment and structure |
|---|
| >d2bjua1 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} Length = 329 | Back information, alignment and structure |
|---|
| >d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} Length = 387 | Back information, alignment and structure |
|---|
| >d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} Length = 387 | Back information, alignment and structure |
|---|
| >d1oewa_ b.50.1.2 (A:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]} Length = 330 | Back information, alignment and structure |
|---|
| >d1oewa_ b.50.1.2 (A:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]} Length = 330 | Back information, alignment and structure |
|---|
| >d1t6ex_ b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 381 | Back information, alignment and structure |
|---|
| >d1t6ex_ b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 381 | Back information, alignment and structure |
|---|
| >d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} Length = 323 | Back information, alignment and structure |
|---|
| >d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} Length = 323 | Back information, alignment and structure |
|---|
| >d2apra_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]} Length = 325 | Back information, alignment and structure |
|---|
| >d2apra_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]} Length = 325 | Back information, alignment and structure |
|---|
| >d3cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]} Length = 323 | Back information, alignment and structure |
|---|
| >d3cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]} Length = 323 | Back information, alignment and structure |
|---|
| >d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]} Length = 357 | Back information, alignment and structure |
|---|
| >d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]} Length = 357 | Back information, alignment and structure |
|---|
| >d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} Length = 323 | Back information, alignment and structure |
|---|
| >d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} Length = 323 | Back information, alignment and structure |
|---|
| >d1j71a_ b.50.1.2 (A:) Acid protease {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 334 | Back information, alignment and structure |
|---|
| >d1j71a_ b.50.1.2 (A:) Acid protease {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 334 | Back information, alignment and structure |
|---|
| >d1eaga_ b.50.1.2 (A:) Acid protease {Yeast (Candida albicans) [TaxId: 5476]} Length = 342 | Back information, alignment and structure |
|---|
| >d1eaga_ b.50.1.2 (A:) Acid protease {Yeast (Candida albicans) [TaxId: 5476]} Length = 342 | Back information, alignment and structure |
|---|
| >d1hc1a2 a.86.1.1 (A:136-398) Arthropod hemocyanin {Spiny lobster (Panulirus interruptus) [TaxId: 6735]} Length = 263 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 336 | |||
| d1hc1a3 | 255 | Arthropod hemocyanin, C-terminal domain {Spiny lob | 99.97 | |
| d1llaa3 | 249 | Arthropod hemocyanin, C-terminal domain {Horseshoe | 99.97 | |
| d3psga_ | 370 | Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} | 99.96 | |
| g1htr.1 | 372 | Pepsin(ogen) {Human (Homo sapiens), progastricsin | 99.95 | |
| d1dpja_ | 329 | Acid protease {Baker's yeast (Saccharomyces cerevi | 99.95 | |
| d1miqa_ | 373 | Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo | 99.94 | |
| d2apra_ | 325 | Acid protease {Bread mold (Rhizopus chinensis) [Ta | 99.94 | |
| d1am5a_ | 324 | Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: | 99.94 | |
| d1oewa_ | 330 | Endothiapepsin {Chestnut blight fungus (Endothia p | 99.94 | |
| d1smra_ | 335 | Chymosin (synonym: renin) {Mouse (Mus musculus) [T | 99.94 | |
| d1j71a_ | 334 | Acid protease {Yeast (Candida tropicalis) [TaxId: | 99.93 | |
| d1mppa_ | 357 | Pepsin {Mucor pusillus [TaxId: 4840]} | 99.93 | |
| d1wkra_ | 340 | Acid protease {Irpex lacteus (Polyporus tulipifera | 99.92 | |
| d1hrna_ | 337 | Chymosin (synonym: renin) {Human (Homo sapiens) [T | 99.92 | |
| d2qp8a1 | 387 | beta-secretase (memapsin) {Human (Homo sapiens) [T | 99.91 | |
| d1eaga_ | 342 | Acid protease {Yeast (Candida albicans) [TaxId: 54 | 99.91 | |
| d1izea_ | 323 | Acid protease {Fungus (Aspergillus oryzae) [TaxId: | 99.91 | |
| d2bjua1 | 329 | Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo | 99.9 | |
| g1lya.1 | 338 | Cathepsin D {Human (Homo sapiens) [TaxId: 9606]} | 99.9 | |
| d1qdma2 | 337 | Plant acid proteinase, phytepsin {Barley (Hordeum | 99.89 | |
| g1b5f.1 | 326 | Plant acid proteinase, phytepsin {Cynara carduncul | 99.88 | |
| d1bxoa_ | 323 | Acid protease {Fungus (Penicillium janthinellum), | 99.88 | |
| d3cmsa_ | 323 | Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId | 99.86 | |
| d1t6ex_ | 381 | Xylanase inhibitor TAXI-I {Wheat (Triticum aestivu | 99.7 | |
| d1miqa_ | 373 | Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo | 97.11 | |
| d1hrna_ | 337 | Chymosin (synonym: renin) {Human (Homo sapiens) [T | 97.07 | |
| d3psga_ | 370 | Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} | 97.02 | |
| d1smra_ | 335 | Chymosin (synonym: renin) {Mouse (Mus musculus) [T | 96.77 | |
| g1lya.1 | 338 | Cathepsin D {Human (Homo sapiens) [TaxId: 9606]} | 96.75 | |
| d1dpja_ | 329 | Acid protease {Baker's yeast (Saccharomyces cerevi | 96.32 | |
| d1qdma2 | 337 | Plant acid proteinase, phytepsin {Barley (Hordeum | 96.26 | |
| g1htr.1 | 372 | Pepsin(ogen) {Human (Homo sapiens), progastricsin | 96.15 | |
| g1b5f.1 | 326 | Plant acid proteinase, phytepsin {Cynara carduncul | 96.01 | |
| d2bjua1 | 329 | Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo | 95.26 | |
| d1oewa_ | 330 | Endothiapepsin {Chestnut blight fungus (Endothia p | 94.82 | |
| d1am5a_ | 324 | Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: | 94.61 | |
| d1bxoa_ | 323 | Acid protease {Fungus (Penicillium janthinellum), | 94.58 | |
| d1wkra_ | 340 | Acid protease {Irpex lacteus (Polyporus tulipifera | 94.21 | |
| d2apra_ | 325 | Acid protease {Bread mold (Rhizopus chinensis) [Ta | 93.36 | |
| d1izea_ | 323 | Acid protease {Fungus (Aspergillus oryzae) [TaxId: | 92.46 | |
| d3cmsa_ | 323 | Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId | 92.43 | |
| d1j71a_ | 334 | Acid protease {Yeast (Candida tropicalis) [TaxId: | 90.64 | |
| d1t6ex_ | 381 | Xylanase inhibitor TAXI-I {Wheat (Triticum aestivu | 90.52 |
| >d1hc1a3 b.1.18.3 (A:399-653) Arthropod hemocyanin, C-terminal domain {Spiny lobster (Panulirus interruptus) [TaxId: 6735]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: E set domains family: Arthropod hemocyanin, C-terminal domain domain: Arthropod hemocyanin, C-terminal domain species: Spiny lobster (Panulirus interruptus) [TaxId: 6735]
Probab=99.97 E-value=1.1e-32 Score=245.80 Aligned_cols=104 Identities=32% Similarity=0.496 Sum_probs=92.1
Q ss_pred eeecCCCeEEeEEEEeccCCCCCcceeeeeeeeccccccccc-cccccccc---ccccCCCCcEEEEEEecCCCceeeEE
Q psy3214 227 VTLEYPGVELKSLRILNKQGPTDQLETFWQLIRMDEVYVRDK-ELTEEYNI---PYHIQHEDFKYEITIENNSNETKTGI 302 (336)
Q Consensus 227 ~~L~~pgv~i~~v~v~~~~gp~~~l~T~~~~~~~dl~~~~~~-~~~~~~~~---~~~L~h~pF~y~i~v~n~s~~~~~~~ 302 (336)
++|.+|||+|++|+|. ++|.|||+.+++|++|+.+. +...++.+ ++|||||||+|+|+|+|+|+++++|+
T Consensus 6 eeL~fpGV~I~~V~Vd------~~L~Tyf~~~~~dl~n~~~~~~~~~~~~v~ar~~rLnHkpF~Y~i~V~~~s~~~~~~v 79 (255)
T d1hc1a3 6 DNLEFSGMVVNGVAID------GELITFFDEFQYSLINAVDSGENIEDVEINARVHRLNHNEFTYKITMSNNNDGERLAT 79 (255)
T ss_dssp HHHCCSSEEEEEEEEE------SCCEEEECCEEEEGGGGSCCCSSCCCCCCEEEECCEEECCCEEEEEEEECSSSCCEEE
T ss_pred HHCcCCCEEEEEEEEC------CeeeeeeeeeecchhhcccccccccceEEEEEEeecCCCCEEEEEEEEeCCCCceEEE
Confidence 7899999999999992 38999999999999986432 22233333 89999999999999999999999999
Q ss_pred EEEEEceecCCCCCcccccccccceEEeeeeeeC
Q psy3214 303 MRIFLGAKNDIEGNELPLSAQRSLFIELDKFRVH 336 (336)
Q Consensus 303 vrifl~Pk~d~~g~~~~~~~~r~~~ielD~f~~~ 336 (336)
|||||||||||+|++|+|+|||++|||||||+++
T Consensus 80 VRIFL~PkyD~~G~~l~l~e~r~~~iElDkF~~~ 113 (255)
T d1hc1a3 80 FRIFLCPIEDNNGITLTLDEARWFCIELDKFFQK 113 (255)
T ss_dssp EEEEEECCCCSSSCCCCSSTTTTTCEEEEEEEEE
T ss_pred EEEEeCccccCCCCCCCHHHhhhheEEeeEEEEE
Confidence 9999999999999999999999999999999974
|
| >d1llaa3 b.1.18.3 (A:380-628) Arthropod hemocyanin, C-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]} | Back information, alignment and structure |
|---|
| >d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1dpja_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d2apra_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]} | Back information, alignment and structure |
|---|
| >d1am5a_ b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 8049]} | Back information, alignment and structure |
|---|
| >d1smra_ b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j71a_ b.50.1.2 (A:) Acid protease {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]} | Back information, alignment and structure |
|---|
| >d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]} | Back information, alignment and structure |
|---|
| >d1hrna_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eaga_ b.50.1.2 (A:) Acid protease {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} | Back information, alignment and structure |
|---|
| >d2bjua1 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1qdma2 b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase, phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} | Back information, alignment and structure |
|---|
| >d3cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1t6ex_ b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]} | Back information, alignment and structure |
|---|
| >d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d1hrna_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1smra_ b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dpja_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qdma2 b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase, phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d2bjua1 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1oewa_ b.50.1.2 (A:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]} | Back information, alignment and structure |
|---|
| >d1am5a_ b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 8049]} | Back information, alignment and structure |
|---|
| >d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} | Back information, alignment and structure |
|---|
| >d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]} | Back information, alignment and structure |
|---|
| >d2apra_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]} | Back information, alignment and structure |
|---|
| >d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} | Back information, alignment and structure |
|---|
| >d3cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1j71a_ b.50.1.2 (A:) Acid protease {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d1t6ex_ b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]} | Back information, alignment and structure |
|---|