Psyllid ID: psy3368

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MASCGALFTGLLLLLLLQVTMSSKEYTNIIELKQGRLRGVVRSPVHNGNLNNIHMYLGIPYAAPPVGQLRFMAPQSPQPWPGLMIADSFSPVCPQKLPNLDDDDFSKKMSKGRLQYYQALMPYLKNQSEDCLYLNIYTPLQEEEEEKKEEREEKKKEEKKKEEGEEKKK
cccHHHHHHHHHHHHHHHHHHcccccccEEEcccEEEEEEEEccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccc
ccHHHHHHHHHHHHHHHHHHccccccccEEEccccEEEEEEEEEccccccccEEEEEEEEccccccHHHcccccccccccccEEEcEccccEccccHHHccccccccccccHHHHccccccccccccEccccEEEEEEccccccccccccccccccccccccccccccc
MASCGALFTGLLLLLLLQVTMSSKEYTNIIELkqgrlrgvvrspvhngnlnnihmylgipyaappvgqlrfmapqspqpwpglmiadsfspvcpqklpnlddddfskkmsKGRLQYYQALMPYlknqsedclylniytplqeeeEEKKEEREEKKKEEKKKEEGEEKKK
MASCGALFTGLLLLLLLQVTMSSKEYTNIIelkqgrlrgVVRSPVHNGNLNNIHMYLGIPYAAPPVGQLRFMAPQSPQPWPGLMIADSFSPVCPQKLPNLDDDDFSKKMSKGRLQYYQALMPYLKNQSEDCLYLNIYtplqeeeeekkeereekkkeekkkeegeekkk
MASCGALFTGlllllllQVTMSSKEYTNIIELKQGRLRGVVRSPVHNGNLNNIHMYLGIPYAAPPVGQLRFMAPQSPQPWPGLMIADSFSPVCPQKLPNLDDDDFSKKMSKGRLQYYQALMPYLKNQSEDCLYLNIYTPLQeeeeekkeereekkkeekkkeegeekkk
***CGALFTGLLLLLLLQVTMSSKEYTNIIELKQGRLRGVVRSPVHNGNLNNIHMYLGIPYAAPPVGQLRFMA*****PWPGLMIADSFSPVC*******************RLQYYQALMPYLKNQSEDCLYLNIYT*******************************
*ASCGALFTGLLLLLLLQVTMSSKEYTNIIELKQGRLRGVVRSPVHNGNLNNIHMYLGIPYAAPPVGQLRFMAPQSPQPWPGLMIADSFSPVCPQKLPNLDDDDFSKKMSKGRLQYYQALMPYLKNQSEDCLYLNIY********************************
MASCGALFTGLLLLLLLQVTMSSKEYTNIIELKQGRLRGVVRSPVHNGNLNNIHMYLGIPYAAPPVGQLRFMAPQSPQPWPGLMIADSFSPVCPQKLPNLDDDDFSKKMSKGRLQYYQALMPYLKNQSEDCLYLNIYTPLQ****************************
*ASCGALFTGLLLLLLLQVTMSSKEYTNIIELKQGRLRGVVRSPVHNGNLNNIHMYLGIPYAAPPVGQLRFMAPQSPQPWPGLMIADSFSPVCPQKLPNLDDDDFSKKMSKGRLQYYQALMPYLKNQSEDCLYLNIYTPLQ****************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASCGALFTGLLLLLLLQVTMSSKEYTNIIELKQGRLRGVVRSPVHNGNLNNIHMYLGIPYAAPPVGQLRFMAPQSPQPWPGLMIADSFSPVCPQKLPNLDDDDFSKKMSKGRLQYYQALMPYLKNQSEDCLYLNIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query169 2.2.26 [Sep-21-2011]
Q8NFZ3 816 Neuroligin-4, Y-linked OS no N/A 0.828 0.171 0.345 2e-19
Q8N0W4 816 Neuroligin-4, X-linked OS no N/A 0.751 0.155 0.340 3e-18
B0F2B4 945 Neuroligin 4-like OS=Mus yes N/A 0.633 0.113 0.392 5e-18
Q62889 848 Neuroligin-3 OS=Rattus no yes N/A 0.911 0.181 0.333 6e-18
Q9NZ94 848 Neuroligin-3 OS=Homo sapi no N/A 0.905 0.180 0.335 7e-18
Q8NFZ4 835 Neuroligin-2 OS=Homo sapi no N/A 0.698 0.141 0.377 9e-18
Q8N2Q7 840 Neuroligin-1 OS=Homo sapi no N/A 0.840 0.169 0.357 9e-18
Q62765 843 Neuroligin-1 OS=Rattus no no N/A 0.704 0.141 0.385 9e-18
Q69ZK9 836 Neuroligin-2 OS=Mus muscu yes N/A 0.698 0.141 0.377 1e-17
Q62888 836 Neuroligin-2 OS=Rattus no no N/A 0.698 0.141 0.377 1e-17
>sp|Q8NFZ3|NLGNY_HUMAN Neuroligin-4, Y-linked OS=Homo sapiens GN=NLGN4Y PE=2 SV=1 Back     alignment and function desciption
 Score = 95.1 bits (235), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 55/159 (34%), Positives = 89/159 (55%), Gaps = 19/159 (11%)

Query: 7   LFTGLLLLL----LLQVTMSSKEYTNI--------IELKQGRLRGVVRSPVHNGNLNNIH 54
           LFT + ++L    LL +T  + ++T I        +    G+++G+ R+P+ +  L  + 
Sbjct: 13  LFTSVCVMLNSNVLLWITALAIKFTLIDSQAQYPVVNTNYGKIQGL-RTPLPSEILGPVE 71

Query: 55  MYLGIPYAAPPVGQLRFMAPQSPQPWPGLMIADSFSPVCPQKLPNLDDDDF--SKKMSKG 112
            YLG+PYA+PP G+ RF  P+SP  W G+  A  FS VCPQ L    D+ F     +   
Sbjct: 72  QYLGVPYASPPTGERRFQPPESPSSWTGIRNATQFSAVCPQHL----DERFLLHDMLPIW 127

Query: 113 RLQYYQALMPYLKNQSEDCLYLNIYTPLQEEEEEKKEER 151
                  LM Y+++Q+EDCLYLNIY P++++  E+  ++
Sbjct: 128 FTTSLDTLMTYVQDQNEDCLYLNIYVPMEDDIHEQNSKK 166
Putative neuronal cell surface protein involved in cell-cell-interactions.
Homo sapiens (taxid: 9606)
>sp|Q8N0W4|NLGNX_HUMAN Neuroligin-4, X-linked OS=Homo sapiens GN=NLGN4X PE=1 SV=1 Back     alignment and function description
>sp|B0F2B4|NLGN4_MOUSE Neuroligin 4-like OS=Mus musculus GN=Nlgn4l PE=1 SV=1 Back     alignment and function description
>sp|Q62889|NLGN3_RAT Neuroligin-3 OS=Rattus norvegicus GN=Nlgn3 PE=1 SV=1 Back     alignment and function description
>sp|Q9NZ94|NLGN3_HUMAN Neuroligin-3 OS=Homo sapiens GN=NLGN3 PE=1 SV=2 Back     alignment and function description
>sp|Q8NFZ4|NLGN2_HUMAN Neuroligin-2 OS=Homo sapiens GN=NLGN2 PE=1 SV=1 Back     alignment and function description
>sp|Q8N2Q7|NLGN1_HUMAN Neuroligin-1 OS=Homo sapiens GN=NLGN1 PE=1 SV=2 Back     alignment and function description
>sp|Q62765|NLGN1_RAT Neuroligin-1 OS=Rattus norvegicus GN=Nlgn1 PE=1 SV=1 Back     alignment and function description
>sp|Q69ZK9|NLGN2_MOUSE Neuroligin-2 OS=Mus musculus GN=Nlgn2 PE=1 SV=2 Back     alignment and function description
>sp|Q62888|NLGN2_RAT Neuroligin-2 OS=Rattus norvegicus GN=Nlgn2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query169
332016820 298 Neuroligin-1 [Acromyrmex echinatior] 0.775 0.439 0.429 7e-30
193697635192 PREDICTED: neuroligin-4, Y-linked-like [ 0.769 0.677 0.454 3e-29
345494661 849 PREDICTED: neuroligin-4, Y-linked [Nason 0.727 0.144 0.515 3e-29
322789407161 hypothetical protein SINV_09966 [Solenop 0.786 0.826 0.424 4e-29
195111062 745 GI22718 [Drosophila mojavensis] gi|19391 0.704 0.159 0.475 5e-29
340718726 805 PREDICTED: neuroligin-4, Y-linked-like [ 0.680 0.142 0.508 7e-29
195389176 663 GJ23445 [Drosophila virilis] gi|19415133 0.704 0.179 0.475 9e-29
307175317183 Neuroligin-4, X-linked [Camponotus flori 0.674 0.622 0.529 1e-28
242008356 943 Neuroligin-3 precursor, putative [Pedicu 0.775 0.138 0.449 1e-28
350405055 913 PREDICTED: neuroligin-4, X-linked-like [ 0.727 0.134 0.483 1e-28
>gi|332016820|gb|EGI57631.1| Neuroligin-1 [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  135 bits (340), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 67/156 (42%), Positives = 90/156 (57%), Gaps = 25/156 (16%)

Query: 8   FTGLLLLLLLQVTMSSKEY--------------------TNIIELKQGRLRGVVRSPVHN 47
             GLLLL   Q+    +++                    T  + +K+GRLRG+V  P  N
Sbjct: 6   LVGLLLLACTQILTEHRDHRESRDQYGYHHRFHDLQERITREVRVKEGRLRGMVIQPRTN 65

Query: 48  GNLNNIHMYLGIPYAAPPVGQLRFMAPQSPQPWPGLMIADSFSPVCPQKLPNLDDDDFSK 107
            NL  + ++LG+PYA PPVG  RF  P+SPQPW G+  +  F+PVCPQ LPNL ++    
Sbjct: 66  YNLQLVDVFLGVPYAEPPVGSFRFSPPRSPQPWRGVRQSQEFAPVCPQVLPNLREE---- 121

Query: 108 KMSKGRLQYYQALMPYLKNQSEDCLYLNIYTPLQEE 143
            +  GR +Y +  +PYL+NQSEDCLYLNIY P Q E
Sbjct: 122 -VKPGRYEYLERHLPYLRNQSEDCLYLNIYAPHQAE 156

Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|193697635|ref|XP_001944497.1| PREDICTED: neuroligin-4, Y-linked-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|345494661|ref|XP_001604741.2| PREDICTED: neuroligin-4, Y-linked [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|322789407|gb|EFZ14712.1| hypothetical protein SINV_09966 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|195111062|ref|XP_002000098.1| GI22718 [Drosophila mojavensis] gi|193916692|gb|EDW15559.1| GI22718 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|340718726|ref|XP_003397814.1| PREDICTED: neuroligin-4, Y-linked-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|195389176|ref|XP_002053253.1| GJ23445 [Drosophila virilis] gi|194151339|gb|EDW66773.1| GJ23445 [Drosophila virilis] Back     alignment and taxonomy information
>gi|307175317|gb|EFN65345.1| Neuroligin-4, X-linked [Camponotus floridanus] Back     alignment and taxonomy information
>gi|242008356|ref|XP_002424972.1| Neuroligin-3 precursor, putative [Pediculus humanus corporis] gi|212508601|gb|EEB12234.1| Neuroligin-3 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|350405055|ref|XP_003487310.1| PREDICTED: neuroligin-4, X-linked-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query169
FB|FBgn0083963 1159 CG34127 [Drosophila melanogast 0.674 0.098 0.508 6.8e-27
FB|FBgn0083975 1281 CG34139 [Drosophila melanogast 0.656 0.086 0.464 3.4e-26
FB|FBgn0051146 1354 Nlg1 "Neuroligin 1" [Drosophil 0.674 0.084 0.486 4.3e-25
FB|FBgn0031866 1248 neuroligin "neuroligin" [Droso 0.650 0.088 0.465 1.2e-20
UNIPROTKB|F1NRD5 812 NLGN3 "Uncharacterized protein 0.704 0.146 0.406 4e-19
ZFIN|ZDB-GENE-060526-197 846 nlgn3b "neuroligin 3b" [Danio 0.686 0.137 0.425 5.4e-19
ZFIN|ZDB-GENE-100309-2 843 nlgn4a "neuroligin 4a" [Danio 0.639 0.128 0.417 1.5e-18
UNIPROTKB|F1SG28 816 LOC100624109 "Uncharacterized 0.680 0.140 0.388 6e-18
UNIPROTKB|F1Q335 816 NLGN4X "Uncharacterized protei 0.680 0.140 0.388 7.7e-18
UNIPROTKB|Q8NFZ3 816 NLGN4Y "Neuroligin-4, Y-linked 0.674 0.139 0.385 7.7e-18
FB|FBgn0083963 CG34127 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 315 (115.9 bits), Expect = 6.8e-27, P = 6.8e-27
 Identities = 59/116 (50%), Positives = 82/116 (70%)

Query:    27 TNIIELKQGRLRGVVRSPVHNGNLNNIHMYLGIPYAAPPVGQLRFMAPQSPQPWPGLMIA 86
             + II  + G + GV+   +   +L+ +  Y GIPYA+PPVG LRFM P S   W G+  A
Sbjct:   155 SRIINTRNGAISGVIVQ-LDGRHLDPVEAYRGIPYASPPVGNLRFMPPVSAAMWSGVKKA 213

Query:    87 DSFSPVCPQKLPNLDDDDFS-KKMSKGRLQYYQALMPYLKNQSEDCLYLNIYTPLQ 141
             D FSPVCPQ+LP++ ++  + ++M KGRL+Y + L+PYL+NQSEDCLYLNIY P+Q
Sbjct:   214 DRFSPVCPQRLPDIHNETAALERMPKGRLEYLKRLLPYLQNQSEDCLYLNIYVPIQ 269
GO:0004091 "carboxylesterase activity" evidence=IKR;NAS
GO:0042043 "neurexin family protein binding" evidence=ISS;IBA
GO:0006911 "phagocytosis, engulfment" evidence=IMP
GO:0022008 "neurogenesis" evidence=IMP
GO:0009986 "cell surface" evidence=IBA
GO:0045202 "synapse" evidence=IBA
GO:0005887 "integral to plasma membrane" evidence=IBA
GO:0007416 "synapse assembly" evidence=IBA
GO:0004872 "receptor activity" evidence=IBA
FB|FBgn0083975 CG34139 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0051146 Nlg1 "Neuroligin 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0031866 neuroligin "neuroligin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1NRD5 NLGN3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060526-197 nlgn3b "neuroligin 3b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-100309-2 nlgn4a "neuroligin 4a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1SG28 LOC100624109 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q335 NLGN4X "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NFZ3 NLGN4Y "Neuroligin-4, Y-linked" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query169
pfam00135 510 pfam00135, COesterase, Carboxylesterase family 1e-31
cd00312 493 cd00312, Esterase_lipase, Esterases and lipases (i 1e-24
COG2272 491 COG2272, PnbA, Carboxylesterase type B [Lipid meta 4e-24
cd05832106 cd05832, Ribosomal_L12p, Ribosomal protein L12p 0.001
>gnl|CDD|215741 pfam00135, COesterase, Carboxylesterase family Back     alignment and domain information 
 Score =  117 bits (296), Expect = 1e-31
 Identities = 43/111 (38%), Positives = 60/111 (54%), Gaps = 21/111 (18%)

Query: 29  IIELKQGRLRGVVRSPVHNGNLNNIHMYLGIPYAAPPVGQLRFMAPQSPQPWPGLMIADS 88
           ++E   G++RG+    V  G    ++ +LGIPYA PPVG+LRF  PQ P+PW G++ A  
Sbjct: 2   VVETSYGKVRGLRV-TVDGGP---VYAFLGIPYAKPPVGELRFKKPQPPEPWTGVLDATK 57

Query: 89  FSPVCPQKLPNLDDDDFSKKMSKGRLQYYQALMPYLKNQSEDCLYLNIYTP 139
           + P CPQ      ++D   +M                  SEDCLYLN+YTP
Sbjct: 58  YGPACPQ------NNDLGSEMWNKNT-----------GMSEDCLYLNVYTP 91

Length = 510
>gnl|CDD|238191 cd00312, Esterase_lipase, Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>gnl|CDD|225181 COG2272, PnbA, Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 169
PF00135 535 COesterase: Carboxylesterase family The prints ent 99.95
KOG4389|consensus 601 99.94
COG2272 491 PnbA Carboxylesterase type B [Lipid metabolism] 99.93
cd00312 493 Esterase_lipase Esterases and lipases (includes fu 99.92
KOG1516|consensus 545 99.88
>PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases Back     alignment and domain information 
Probab=99.95  E-value=2.3e-29  Score=220.90  Aligned_cols=107  Identities=38%  Similarity=0.735  Sum_probs=70.2

Q ss_pred             hccCCCCceEEccceEEEeEEecccCCCCccceeeecccccCCCCCCCCCCCCCCCCCCCCCceeccccCCCCCCCCCCC
Q psy3368          21 MSSKEYTNIIELKQGRLRGVVRSPVHNGNLNNIHMYLGIPYAAPPVGQLRFMAPQSPQPWPGLMIADSFSPVCPQKLPNL  100 (169)
Q Consensus        21 ~~~~~~~p~V~t~~G~i~G~~~~~~~~~~~~~v~~F~GIPYA~~PvG~~RF~~P~p~~~w~g~~dAt~~gp~CpQ~~~~~  100 (169)
                      .....+.++|+|.+|+|+|+.....   ...+|++|+|||||+||+|++||++|+++.+|.+++|||++|+.|||.....
T Consensus        17 ~~~~~~~~~v~~~~g~i~G~~~~~~---~~~~v~~f~gIpYA~pP~g~~Rf~~p~~~~~~~~~~~a~~~~~~C~Q~~~~~   93 (535)
T PF00135_consen   17 SQAQASSPVVTTSYGKIRGIRVNTD---DGKGVYSFLGIPYAQPPVGELRFRPPQPPPPWSGVRDATKYGPACPQPPPPG   93 (535)
T ss_dssp             -ECCSTCCEEEETTEEEEEEEEEES---TCCEEEEEEEEESSE---GGGTTS--EB--S-SSEEETBS---BESCECTTS
T ss_pred             hcccCCCCEEEECCeEEEeEEEecC---CCcceEEEeCcccCCCCCCCcccccccccccchhhhhhhhcccccccccccc
Confidence            3344456899999999999776543   1147999999999999999999999999999999999999999999986543


Q ss_pred             CCchhhhhhchhhhhhhhhhCCCCCCCCCCceEEEEEccCCCCchh
Q psy3368         101 DDDDFSKKMSKGRLQYYQALMPYLKNQSEDCLYLNIYTPLQEEEEE  146 (169)
Q Consensus       101 ~~~~~~~~~~~~~~~~~~~~~~~~~~~sEDCL~LNI~tP~~~~~~~  146 (169)
                      ...                .......+||||||||||+|.....++
T Consensus        94 ~~~----------------~~~~~~~~sEDCL~LnI~~P~~~~~~~  123 (535)
T PF00135_consen   94 PSP----------------GFNPPVGQSEDCLYLNIYTPSNASSNS  123 (535)
T ss_dssp             SHH----------------HCSHSSHBES---EEEEEEETSSSSTT
T ss_pred             ccc----------------ccccccCCCchHHHHhhhhcccccccc
Confidence            100                000012369999999999999887664

Among the different types are those which act on carboxylic esters (3.1.1 from EC). Carboxyl-esterases have been classified into three categories (A, B and C) on the basis of differential patterns of inhibition by organophosphates. The sequence of a number of type-B carboxylesterases indicates [, , ] that the majority are evolutionary related. As is the case for lipases and serine proteases, the catalytic apparatus of esterases involves three residues (catalytic triad): a serine, a glutamate or aspartate and a histidine.; PDB: 3B3Q_A 1CLE_B 1GQS_A 2VJD_A 1HBJ_A 2C5G_A 1U65_A 2WG1_A 1FSS_A 3M3D_A ....
>KOG4389|consensus Back     alignment and domain information
>COG2272 PnbA Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>KOG1516|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query169
3be8_A 588 Crystal Structure Of The Synaptic Protein Neuroligi 1e-17
3bl8_A 580 Crystal Structure Of The Extracellular Domain Of Ne 4e-17
3vkf_A 585 Crystal Structure Of Neurexin 1betaNEUROLIGIN 1 COM 2e-16
3biw_A 574 Crystal Structure Of The Neuroligin-1NEUREXIN-1beta 2e-16
3b3q_A 577 Crystal Structure Of A Synaptic Adhesion Complex Le 2e-16
1c7j_A 489 Pnb Esterase 56c8 Length = 489 1e-14
1qe3_A 489 Pnb Esterase Length = 489 2e-14
1c7i_A 489 Thermophylic Pnb Esterase Length = 489 3e-14
2x8b_A 583 Crystal Structure Of Human Acetylcholinesterase Inh 4e-12
1f8u_A 583 Crystal Structure Of Mutant E202q Of Human Acetylch 4e-12
4ey4_A 542 Crystal Structure Of Recombinant Human Acetylcholin 6e-12
2jge_A 536 Crystal Structure Of Mouse Acetylcholinesterase Inh 6e-12
3lii_A 540 Recombinant Human Acetylcholinesterase Length = 540 6e-12
3dl7_B 534 Aged Form Of Mouse Acetylcholinesterase Inhibited B 6e-12
2jgj_B 535 Crystal Structure Of Mouse Acetylcholinesterase Inh 6e-12
1ku6_A 549 Fasciculin 2-Mouse Acetylcholinesterase Complex Len 6e-12
2jge_B 533 Crystal Structure Of Mouse Acetylcholinesterase Inh 6e-12
1maa_A 547 Mouse Acetylcholinesterase Catalytic Domain, Glycos 6e-12
2xuf_A 544 Crystal Structure Of Mache-Y337a-Tz2pa6 Anti Comple 6e-12
1b41_A 539 Human Acetylcholinesterase Complexed With Fasciculi 6e-12
2xud_A 543 Crystal Structure Of The Y337a Mutant Of Mouse Acet 6e-12
3dl7_A 538 Aged Form Of Mouse Acetylcholinesterase Inhibited B 6e-12
2ha4_A 543 Crystal Structure Of Mutant S203a Of Mouse Acetylch 6e-12
1mah_A 543 Fasciculin2-Mouse Acetylcholinesterase Complex Leng 7e-12
2whp_B 548 Crystal Structure Of Acetylcholinesterase, Phosphon 7e-12
2jgf_A 548 Crystal Structure Of Mouse Acetylcholinesterase Inh 7e-12
1n5m_A 541 Crystal Structure Of The Mouse Acetylcholinesterase 7e-12
2c0p_A 548 Aged Form Of Mouse Acetylcholinesterase Inhibited B 7e-12
1c2b_A 540 Electrophorus Electricus Acetylcholinesterase Lengt 7e-12
4a16_A 545 Structure Of Mouse Acetylcholinesterase Complex Wit 7e-12
1c2o_A 539 Electrophorus Electricus Acetylcholinesterase Lengt 7e-12
1q83_A 580 Crystal Structure Of The Mouse Acetylcholinesterase 1e-11
1ya4_A 532 Crystal Structure Of Human Liver Carboxylesterase 1 3e-11
3k9b_A 529 Crystal Structure Of Human Liver Carboxylesterase 1 3e-11
1mx1_A 548 Crystal Structure Of Human Liver Carboxylesterase I 3e-11
2dqy_A 542 Crystal Structure Of Human Carboxylesterase In Comp 4e-11
1dx4_A 585 Ache From Drosophila Melanogaster Complex With Tacr 6e-11
2ogs_A 498 Crystal Structure Of The Geobacillus Stearothermoph 7e-11
2ogt_A 498 Crystal Structure Of The Geobacillus Stearothermoph 8e-11
1k4y_A 534 Crystal Structure Of Rabbit Liver Carboxylesterase 1e-10
1som_A 543 Torpedo Californica Acetylcholinesterase Inhibited 1e-10
1fss_A 537 Acetylcholinesterase (E.C. 3.1.1.7) Complexed With 1e-10
2c58_A 537 Torpedo Californica Acetylcholinesterase In Complex 1e-10
1ut6_A 537 Structure Of Acetylcholinesterase (E.C. 3.1.1.7) Co 1e-10
2dfp_A 534 X-Ray Structure Of Aged Di-Isopropyl-Phosphoro-Fluo 1e-10
2cek_A 535 Conformational Flexibility In The Peripheral Site O 1e-10
1gqr_A 532 Acetylcholinesterase (E.C. 3.1.1.7) Complexed With 1e-10
3gel_A 532 O-Methylphosphorylated Torpedo Acetylcholinesterase 1e-10
3i6m_A 534 3d Structure Of Torpedo Californica Acetylcholinest 1e-10
1eea_A 534 Acetylcholinesterase Length = 534 1e-10
2w6c_X 586 Ache In Complex With A Bis-(-)-Nor-Meptazinol Deriv 4e-10
2pm8_A 574 Crystal Structure Of Recombinant Full Length Human 2e-09
2j4c_A 529 Structure Of Human Butyrylcholinesterase In Complex 2e-09
2wsl_A 529 Aged Form Of Human Butyrylcholinesterase Inhibited 2e-09
3o9m_A 574 Co-Crystallization Studies Of Full Length Recombina 2e-09
2wil_A 529 Aged Form Of Human Butyrylcholinesterase Inhibited 2e-09
2y1k_A 529 Structure Of Human Butyrylcholinesterase Inhibited 3e-09
2wif_A 529 Aged Form Of Human Butyrylcholinesterase Inhibited 3e-09
4b0o_A 529 Crystal Structure Of Soman-Aged Human Butyrylcholin 3e-09
4axb_A 527 Crystal Structure Of Soman-aged Human Butyrylcholin 3e-09
2xqf_A 527 X-Ray Structure Of Human Butyrylcholinesterase Inhi 3e-09
2xmb_A 529 G117h Mutant Of Human Butyrylcholinesterase In Comp 3e-09
3djy_A 529 Nonaged Form Of Human Butyrylcholinesterase Inhibit 3e-09
1p0i_A 529 Crystal Structure Of Human Butyryl Cholinesterase L 3e-09
2wid_A 529 Nonaged Form Of Human Butyrylcholinesterase Inhibit 3e-09
4aqd_A 531 Crystal Structure Of Fully Glycosylated Human Butyr 3e-09
1llf_A 534 Cholesterol Esterase (Candida Cylindracea) Crystal 5e-08
1cle_A 534 Structure Of Uncomplexed And Linoleate-Bound Candid 5e-08
1ukc_A 522 Crystal Structure Of Aspergillus Niger Esta Length 2e-07
1lpm_A 549 A Structural Basis For The Chiral Preferences Of Li 3e-06
1crl_A 534 Insights Into Interfacial Activation From An 'open' 3e-06
2fj0_A 551 Crystal Structure Of Juvenile Hormone Esterase From 6e-06
1thg_A 544 1.8 Angstroms Refined Structure Of The Lipase From 1e-05
1gz7_A 534 Crystal Structure Of The Closed State Of Lipase 2 F 5e-04
>pdb|3BE8|A Chain A, Crystal Structure Of The Synaptic Protein Neuroligin 4 Length = 588 Back     alignment and structure 
Iteration: 1

 Score = 85.5 bits (210), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 44/114 (38%), Positives = 65/114 (57%), Gaps = 5/114 (4%)
Query: 29  IIELKQGRLRGVVRSPVHNGNLNNIHMYLGIPYAAPPVGQLRFMAPQSPQPWPGLMIADS 88
           ++    G++RG+ R+P+ N  L  +  YLG+PYA+PP G+ RF  P+ P  W G+     
Sbjct: 16  VVNTNYGKIRGL-RTPLPNEILGPVEQYLGVPYASPPTGERRFQPPEPPSSWTGIRNTTQ 74
Query: 89  FSPVCPQKLPNLDDDDFSKKMSKGRLQY-YQALMPYLKNQSEDCLYLNIYTPLQ 141
           F+ VCPQ   +LD+      M           LM Y+++Q+EDCLYLNIY P +
Sbjct: 75  FAAVCPQ---HLDERSLLHDMLPIWFTANLDTLMTYVQDQNEDCLYLNIYVPTE 125
>pdb|3BL8|A Chain A, Crystal Structure Of The Extracellular Domain Of Neuroligin 2a From Mouse Length = 580 Back     alignment and structure
>pdb|3VKF|A Chain A, Crystal Structure Of Neurexin 1betaNEUROLIGIN 1 COMPLEX Length = 585 Back     alignment and structure
>pdb|3BIW|A Chain A, Crystal Structure Of The Neuroligin-1NEUREXIN-1beta Synaptic Adhesion Complex Length = 574 Back     alignment and structure
>pdb|3B3Q|A Chain A, Crystal Structure Of A Synaptic Adhesion Complex Length = 577 Back     alignment and structure
>pdb|1C7J|A Chain A, Pnb Esterase 56c8 Length = 489 Back     alignment and structure
>pdb|1QE3|A Chain A, Pnb Esterase Length = 489 Back     alignment and structure
>pdb|1C7I|A Chain A, Thermophylic Pnb Esterase Length = 489 Back     alignment and structure
>pdb|2X8B|A Chain A, Crystal Structure Of Human Acetylcholinesterase Inhibited By Aged Tabun And Complexed With Fasciculin-Ii Length = 583 Back     alignment and structure
>pdb|1F8U|A Chain A, Crystal Structure Of Mutant E202q Of Human Acetylcholinesterase Complexed With Green Mamba Venom Peptide Fasciculin-ii Length = 583 Back     alignment and structure
>pdb|4EY4|A Chain A, Crystal Structure Of Recombinant Human Acetylcholinesterase In The Apo State Length = 542 Back     alignment and structure
>pdb|2JGE|A Chain A, Crystal Structure Of Mouse Acetylcholinesterase Inhibited By Non-Aged Methamidophos Length = 536 Back     alignment and structure
>pdb|3LII|A Chain A, Recombinant Human Acetylcholinesterase Length = 540 Back     alignment and structure
>pdb|1KU6|A Chain A, Fasciculin 2-Mouse Acetylcholinesterase Complex Length = 549 Back     alignment and structure
>pdb|1MAA|A Chain A, Mouse Acetylcholinesterase Catalytic Domain, Glycosylated Protein Length = 547 Back     alignment and structure
>pdb|2XUF|A Chain A, Crystal Structure Of Mache-Y337a-Tz2pa6 Anti Complex (1 Mth) Length = 544 Back     alignment and structure
>pdb|1B41|A Chain A, Human Acetylcholinesterase Complexed With Fasciculin-Ii, Glycosylated Protein Length = 539 Back     alignment and structure
>pdb|2XUD|A Chain A, Crystal Structure Of The Y337a Mutant Of Mouse Acetylcholinesterase Length = 543 Back     alignment and structure
>pdb|3DL7|A Chain A, Aged Form Of Mouse Acetylcholinesterase Inhibited By Tabun- Update Length = 538 Back     alignment and structure
>pdb|2HA4|A Chain A, Crystal Structure Of Mutant S203a Of Mouse Acetylcholinesterase Complexed With Acetylcholine Length = 543 Back     alignment and structure
>pdb|1MAH|A Chain A, Fasciculin2-Mouse Acetylcholinesterase Complex Length = 543 Back     alignment and structure
>pdb|2WHP|B Chain B, Crystal Structure Of Acetylcholinesterase, Phosphonylated By Sarin And In Complex With Hi-6 Length = 548 Back     alignment and structure
>pdb|2JGF|A Chain A, Crystal Structure Of Mouse Acetylcholinesterase Inhibited By Non-Aged Fenamiphos Length = 548 Back     alignment and structure
>pdb|1N5M|A Chain A, Crystal Structure Of The Mouse Acetylcholinesterase-Gallamine Complex Length = 541 Back     alignment and structure
>pdb|2C0P|A Chain A, Aged Form Of Mouse Acetylcholinesterase Inhibited By Tabun Length = 548 Back     alignment and structure
>pdb|1C2B|A Chain A, Electrophorus Electricus Acetylcholinesterase Length = 540 Back     alignment and structure
>pdb|4A16|A Chain A, Structure Of Mouse Acetylcholinesterase Complex With Huprine Derivative Length = 545 Back     alignment and structure
>pdb|1C2O|A Chain A, Electrophorus Electricus Acetylcholinesterase Length = 539 Back     alignment and structure
>pdb|1Q83|A Chain A, Crystal Structure Of The Mouse Acetylcholinesterase-Tz2pa6 Syn Complex Length = 580 Back     alignment and structure
>pdb|1YA4|A Chain A, Crystal Structure Of Human Liver Carboxylesterase 1 In Complex With Tamoxifen Length = 532 Back     alignment and structure
>pdb|3K9B|A Chain A, Crystal Structure Of Human Liver Carboxylesterase 1 (Hce1) In Covalent Complex With The Nerve Agent Cyclosarin (Gf) Length = 529 Back     alignment and structure
>pdb|1MX1|A Chain A, Crystal Structure Of Human Liver Carboxylesterase In Complex With Tacrine Length = 548 Back     alignment and structure
>pdb|2DQY|A Chain A, Crystal Structure Of Human Carboxylesterase In Complex With Cholate And Palmitate Length = 542 Back     alignment and structure
>pdb|1DX4|A Chain A, Ache From Drosophila Melanogaster Complex With Tacrine Derivative 9-(3-Phenylmethylamino)-1,2,3,4-Tetrahydroacridine Length = 585 Back     alignment and structure
>pdb|2OGS|A Chain A, Crystal Structure Of The Geobacillus Stearothermophilus Carboxylesterase Est55 At Ph 6.2 Length = 498 Back     alignment and structure
>pdb|2OGT|A Chain A, Crystal Structure Of The Geobacillus Stearothermophilus Carboxylesterase Est55 At Ph 6.8 Length = 498 Back     alignment and structure
>pdb|1K4Y|A Chain A, Crystal Structure Of Rabbit Liver Carboxylesterase In Complex With 4- Piperidino-Piperidine Length = 534 Back     alignment and structure
>pdb|1SOM|A Chain A, Torpedo Californica Acetylcholinesterase Inhibited By Nerve Agent Gd (Soman). Length = 543 Back     alignment and structure
>pdb|1FSS|A Chain A, Acetylcholinesterase (E.C. 3.1.1.7) Complexed With Fasciculin-Ii Length = 537 Back     alignment and structure
>pdb|2C58|A Chain A, Torpedo Californica Acetylcholinesterase In Complex With 20mm Acetylthiocholine Length = 537 Back     alignment and structure
>pdb|1UT6|A Chain A, Structure Of Acetylcholinesterase (E.C. 3.1.1.7) Complexed With N-9-(1',2',3',4'-Tetrahydroacridinyl)-1,8- Diaminooctane At 2.4 Angstroms Resolution. Length = 537 Back     alignment and structure
>pdb|2DFP|A Chain A, X-Ray Structure Of Aged Di-Isopropyl-Phosphoro-Fluoridate (Dfp) Bound To Acetylcholinesterase Length = 534 Back     alignment and structure
>pdb|2CEK|A Chain A, Conformational Flexibility In The Peripheral Site Of Torpedo Californica Acetylcholinesterase Revealed By The Complex Structure With A Bifunctional Inhibitor Length = 535 Back     alignment and structure
>pdb|1GQR|A Chain A, Acetylcholinesterase (E.C. 3.1.1.7) Complexed With Rivastigmine Length = 532 Back     alignment and structure
>pdb|3GEL|A Chain A, O-Methylphosphorylated Torpedo Acetylcholinesterase Obtained By Reaction With Methyl Paraoxon (Aged) Length = 532 Back     alignment and structure
>pdb|3I6M|A Chain A, 3d Structure Of Torpedo Californica Acetylcholinesterase Complexed With N-Piperidinopropyl-Galanthamine Length = 534 Back     alignment and structure
>pdb|1EEA|A Chain A, Acetylcholinesterase Length = 534 Back     alignment and structure
>pdb|2W6C|X Chain X, Ache In Complex With A Bis-(-)-Nor-Meptazinol Derivative Length = 586 Back     alignment and structure
>pdb|2PM8|A Chain A, Crystal Structure Of Recombinant Full Length Human Butyrylcholinesterase Length = 574 Back     alignment and structure
>pdb|2J4C|A Chain A, Structure Of Human Butyrylcholinesterase In Complex With 10mm Hgcl2 Length = 529 Back     alignment and structure
>pdb|2WSL|A Chain A, Aged Form Of Human Butyrylcholinesterase Inhibited By Tabun Analogue Ta4 Length = 529 Back     alignment and structure
>pdb|3O9M|A Chain A, Co-Crystallization Studies Of Full Length Recombinant Bche With Cocaine Offers Insights Into Cocaine Detoxification Length = 574 Back     alignment and structure
>pdb|2WIL|A Chain A, Aged Form Of Human Butyrylcholinesterase Inhibited By Tabun Analogue Ta5 Length = 529 Back     alignment and structure
>pdb|2Y1K|A Chain A, Structure Of Human Butyrylcholinesterase Inhibited By Cbdp ( 12h Soak): Phosphoserine Adduct Length = 529 Back     alignment and structure
>pdb|2WIF|A Chain A, Aged Form Of Human Butyrylcholinesterase Inhibited By Tabun Analogue Ta1 Length = 529 Back     alignment and structure
>pdb|4B0O|A Chain A, Crystal Structure Of Soman-Aged Human Butyrylcholinesterase In Complex With Benzyl Pyridinium-4-Methyltrichloroacetimidate Length = 529 Back     alignment and structure
>pdb|4AXB|A Chain A, Crystal Structure Of Soman-aged Human Butyrylcholinesterase In Complex With 2-pam Length = 527 Back     alignment and structure
>pdb|2XQF|A Chain A, X-Ray Structure Of Human Butyrylcholinesterase Inhibited By Racemic Vx Length = 527 Back     alignment and structure
>pdb|2XMB|A Chain A, G117h Mutant Of Human Butyrylcholinesterase In Complex With Sulfate Length = 529 Back     alignment and structure
>pdb|3DJY|A Chain A, Nonaged Form Of Human Butyrylcholinesterase Inhibited By Tabun Length = 529 Back     alignment and structure
>pdb|1P0I|A Chain A, Crystal Structure Of Human Butyryl Cholinesterase Length = 529 Back     alignment and structure
>pdb|2WID|A Chain A, Nonaged Form Of Human Butyrylcholinesterase Inhibited By Tabun Analogue Ta1 Length = 529 Back     alignment and structure
>pdb|4AQD|A Chain A, Crystal Structure Of Fully Glycosylated Human Butyrylcholinesterase Length = 531 Back     alignment and structure
>pdb|1LLF|A Chain A, Cholesterol Esterase (Candida Cylindracea) Crystal Structure At 1.4a Resolution Length = 534 Back     alignment and structure
>pdb|1CLE|A Chain A, Structure Of Uncomplexed And Linoleate-Bound Candida Cylindracea Cholesterol Esterase Length = 534 Back     alignment and structure
>pdb|1UKC|A Chain A, Crystal Structure Of Aspergillus Niger Esta Length = 522 Back     alignment and structure
>pdb|1LPM|A Chain A, A Structural Basis For The Chiral Preferences Of Lipases Length = 549 Back     alignment and structure
>pdb|1CRL|A Chain A, Insights Into Interfacial Activation From An 'open' Structure Of Candida Rugosa Lipase Length = 534 Back     alignment and structure
>pdb|2FJ0|A Chain A, Crystal Structure Of Juvenile Hormone Esterase From Manduca Sexta, With Otfp Covalently Attached Length = 551 Back     alignment and structure
>pdb|1THG|A Chain A, 1.8 Angstroms Refined Structure Of The Lipase From Geotrichum Candidum Length = 544 Back     alignment and structure
>pdb|1GZ7|A Chain A, Crystal Structure Of The Closed State Of Lipase 2 From Candida Rugosa Length = 534 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query169
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 2e-40
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 2e-35
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 3e-35
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 6e-35
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 8e-35
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 8e-35
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 1e-34
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 2e-33
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 2e-32
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 4e-32
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 2e-31
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 3e-31
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 9e-29
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 4e-07
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Length = 574 Back     alignment and structure
 Score =  142 bits (359), Expect = 2e-40
 Identities = 40/123 (32%), Positives = 68/123 (55%), Gaps = 3/123 (2%)

Query: 29  IIELKQGRLRGVVRSPVHNGNLNNIHMYLGIPYAAPPVGQLRFMAPQSPQPWPGLMIADS 88
           ++    G++RG+ +  ++N  L  +  +LG+PYAAPP G+ RF  P+ P PW  +  A  
Sbjct: 12  LVTTNFGKIRGIKKE-LNNEILGPVIQFLGVPYAAPPTGEHRFQPPEPPSPWSDIRNATQ 70

Query: 89  FSPVCPQKLPNLDDDDFSKKMSKGRLQYYQALMPYLKNQSEDCLYLNIYTPLQEEEEEKK 148
           F+PVCPQ + +    +    +          +  Y+++QSEDCLYLNIY P +++  +  
Sbjct: 71  FAPVCPQNIIDGRLPEVM--LPVWFTNNLDVVSSYVQDQSEDCLYLNIYVPTEDDIRDSG 128

Query: 149 EER 151
             +
Sbjct: 129 GPK 131
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Length = 543 Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Length = 498 Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Length = 529 Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Length = 537 Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Length = 542 Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Length = 489 Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Length = 534 Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Length = 551 Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Length = 585 Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Length = 522 Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Length = 544 Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Length = 579 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query169
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 99.93
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 99.92
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 99.92
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 99.91
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 99.91
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 99.91
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 99.91
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 99.91
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 99.9
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 99.9
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 99.9
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 99.89
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 99.86
1jkm_A 361 Brefeldin A esterase; serine hydrolase, degradatio 97.57
2zsh_A 351 Probable gibberellin receptor GID1L1; plant hormon 96.35
3doh_A 380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 87.21
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure
Probab=99.93  E-value=1.8e-26  Score=206.66  Aligned_cols=102  Identities=32%  Similarity=0.617  Sum_probs=77.4

Q ss_pred             CCceEEccceEEEeEEecccCCCCccceeeecccccCCCCCCCCCCCCCCCCCCCCCceeccccCCCCCCCCCCCCCchh
Q psy3368          26 YTNIIELKQGRLRGVVRSPVHNGNLNNIHMYLGIPYAAPPVGQLRFMAPQSPQPWPGLMIADSFSPVCPQKLPNLDDDDF  105 (169)
Q Consensus        26 ~~p~V~t~~G~i~G~~~~~~~~~~~~~v~~F~GIPYA~~PvG~~RF~~P~p~~~w~g~~dAt~~gp~CpQ~~~~~~~~~~  105 (169)
                      +.++|+|.+|+|+|......    ..+|++|+|||||+||+|++||++|+|+.+|++++|||++|+.|||........  
T Consensus         3 ~~~~V~t~~G~v~G~~~~~~----~~~v~~F~GIPYA~pPvG~lRF~~P~p~~~w~gv~dAt~~g~~C~Q~~~~~~~~--   76 (585)
T 1dx4_A            3 DRLVVQTSSGPVRGRSVTVQ----GREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATGLSATCVQERYEYFPG--   76 (585)
T ss_dssp             CCSEEEETTEEEECEEEEET----TEEEEEEEEEECSCCCCGGGTTSCCCCCCCCSSCEECSSCCCBCSCCCCCSSTT--
T ss_pred             CCcEEEeCCEEEEeEEEecC----CceEEEEccCccCCCCCCccCCCCCcCCCCCcCceeeeecCCCCCCCCcccccc--
Confidence            46899999999999864321    257999999999999999999999999999999999999999999974321110  


Q ss_pred             hhhhchhhhhhhhhhCCCCCCCCCCceEEEEEccCCC
Q psy3368         106 SKKMSKGRLQYYQALMPYLKNQSEDCLYLNIYTPLQE  142 (169)
Q Consensus       106 ~~~~~~~~~~~~~~~~~~~~~~sEDCL~LNI~tP~~~  142 (169)
                         +    ..  .........+||||||||||+|...
T Consensus        77 ---~----~~--~~~~~~~~~~sEDCL~LNV~~P~~~  104 (585)
T 1dx4_A           77 ---F----SG--EEIWNPNTNVSEDCLYINVWAPAKA  104 (585)
T ss_dssp             ---C----HH--HHTTSCSSCBCSCCCEEEEEEEC--
T ss_pred             ---c----cc--cccccCCCCCCCcCCeEEEEecCcc
Confidence               0    00  0001112457999999999999753
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 169
d2ha2a1 542 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mu 1e-32
d1dx4a_ 571 c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Dro 1e-32
d1p0ia_ 526 c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo 2e-32
d2h7ca1 532 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase 7e-32
d1ea5a_ 532 c.69.1.1 (A:) Acetylcholinesterase {Pacific electr 8e-32
d1qe3a_ 483 c.69.1.1 (A:) Thermophilic para-nitrobenzyl estera 1e-31
d1ukca_ 517 c.69.1.17 (A:) Esterase EstA {Aspergillus niger [T 1e-29
d1thga_ 544 c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fun 2e-29
d1llfa_ 534 c.69.1.17 (A:) Type-B carboxylesterase/lipase {Can 6e-29
d2bcea_ 579 c.69.1.1 (A:) Bile-salt activated lipase (choleste 2e-26
d1k4ta3230 e.15.1.1 (A:201-430) Eukaryotic DNA topoisomerase 0.003
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Length = 542 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Acetylcholinesterase-like
domain: Acetylcholinesterase
species: Mouse (Mus musculus) [TaxId: 10090]

 Score =  119 bits (298), Expect = 1e-32
 Identities = 37/111 (33%), Positives = 56/111 (50%), Gaps = 15/111 (13%)

Query: 29  IIELKQGRLRGVVRSPVHNGNLNNIHMYLGIPYAAPPVGQLRFMAPQSPQPWPGLMIADS 88
           ++ ++ G+LRG+            +  +LGIP+A PPVG  RFM P+  +PW G++ A +
Sbjct: 9   LVRVRGGQLRGIRL----KAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATT 64

Query: 89  FSPVCPQKLPNLDDDDFSKKMSKGRLQYYQALMPYLKNQSEDCLYLNIYTP 139
           F  VC Q +  L       +M               +  SEDCLYLN++TP
Sbjct: 65  FQNVCYQYVDTLYPGFEGTEMWNPN-----------RELSEDCLYLNVWTP 104
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 571 Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Length = 526 Back     information, alignment and structure
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Length = 532 Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Length = 532 Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Length = 483 Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Length = 517 Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Length = 544 Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Length = 534 Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Length = 579 Back     information, alignment and structure
>d1k4ta3 e.15.1.1 (A:201-430) Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment {Human (Homo sapiens) [TaxId: 9606]} Length = 230 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query169
d1ukca_ 517 Esterase EstA {Aspergillus niger [TaxId: 5061]} 99.96
d1qe3a_ 483 Thermophilic para-nitrobenzyl esterase (PNB estera 99.96
d2h7ca1 532 Mammalian carboxylesterase (liver carboxylesterase 99.95
d1ea5a_ 532 Acetylcholinesterase {Pacific electric ray (Torped 99.95
d1dx4a_ 571 Acetylcholinesterase {Fruit fly (Drosophila melano 99.95
d1p0ia_ 526 Butyryl cholinesterase {Human (Homo sapiens) [TaxI 99.95
d2ha2a1 542 Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 99.95
d1llfa_ 534 Type-B carboxylesterase/lipase {Candida cylindrace 99.93
d2bcea_ 579 Bile-salt activated lipase (cholesterol esterase) 99.92
d1thga_ 544 Type-B carboxylesterase/lipase {Fungus (Geotrichum 99.92
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Fungal lipases
domain: Esterase EstA
species: Aspergillus niger [TaxId: 5061]

Probab=99.96  E-value=7.5e-30  Score=221.49  Aligned_cols=92  Identities=33%  Similarity=0.637  Sum_probs=79.7

Q ss_pred             CCCceEEccceEEEeEEecccCCCCccceeeecccccCCCCCCCCCCCCCCCCCCCCCceeccccCCCCCCCCCCCCCch
Q psy3368          25 EYTNIIELKQGRLRGVVRSPVHNGNLNNIHMYLGIPYAAPPVGQLRFMAPQSPQPWPGLMIADSFSPVCPQKLPNLDDDD  104 (169)
Q Consensus        25 ~~~p~V~t~~G~i~G~~~~~~~~~~~~~v~~F~GIPYA~~PvG~~RF~~P~p~~~w~g~~dAt~~gp~CpQ~~~~~~~~~  104 (169)
                      ...|+|+|.+|+|+|+...       .+|++|+|||||+||+|++||++|+|+.+|.+++|||++++.|||......   
T Consensus         3 ~~~p~v~~~~g~~~G~~~~-------~~v~~F~GIPyA~pP~g~~Rf~~p~~~~~~~~~~~at~~~~~C~q~~~~~~---   72 (517)
T d1ukca_           3 NAQPVINLGYARYQGVRLE-------AGVDEFLGMRYASPPIGDLRFRAPQDPPANQTLQSATEYGPICIGLDEEES---   72 (517)
T ss_dssp             TTSCEEECSSCEEECEECT-------TSEEEEEEEESSCCCCGGGTTSCCCCCCCCCSCEECBSCCCEECCTTCCCB---
T ss_pred             CCCCEEEeCCeEEEEEEcc-------CCeEEEcccccCCCCCCccCCCCCCCCCCCCCeeecccCCCCCcCCCCCCC---
Confidence            4579999999999998642       479999999999999999999999999999999999999999999754321   


Q ss_pred             hhhhhchhhhhhhhhhCCCCCCCCCCceEEEEEccCCCCch
Q psy3368         105 FSKKMSKGRLQYYQALMPYLKNQSEDCLYLNIYTPLQEEEE  145 (169)
Q Consensus       105 ~~~~~~~~~~~~~~~~~~~~~~~sEDCL~LNI~tP~~~~~~  145 (169)
                                         ...+||||||||||+|.....+
T Consensus        73 -------------------~~~~sEDCL~LnI~~P~~~~~~   94 (517)
T d1ukca_          73 -------------------PGDISEDCLFINVFKPSTATSQ   94 (517)
T ss_dssp             -------------------TTTEESCCCEEEEEEETTCCTT
T ss_pred             -------------------CCCCCCcCCEEEEEeCCCCCCC
Confidence                               1357899999999999876544
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Back     information, alignment and structure
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Back     information, alignment and structure