Psyllid ID: psy3428
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 682 | ||||||
| 125901787 | 1222 | pol-like protein [Biomphalaria glabrata] | 0.693 | 0.387 | 0.337 | 4e-65 | |
| 427791807 | 1212 | Putative tick transposon, partial [Rhipi | 0.655 | 0.368 | 0.353 | 2e-59 | |
| 427791321 | 1210 | Putative tick transposon, partial [Rhipi | 0.658 | 0.371 | 0.332 | 2e-55 | |
| 427798889 | 1199 | Putative tick transposon, partial [Rhipi | 0.664 | 0.377 | 0.325 | 3e-55 | |
| 427798887 | 1199 | Putative tick transposon, partial [Rhipi | 0.662 | 0.376 | 0.324 | 2e-53 | |
| 427798885 | 1199 | Putative tick transposon, partial [Rhipi | 0.662 | 0.376 | 0.326 | 3e-53 | |
| 427791063 | 1035 | Putative tick transposon, partial [Rhipi | 0.662 | 0.436 | 0.318 | 1e-51 | |
| 427792011 | 1121 | Putative tick transposon, partial [Rhipi | 0.651 | 0.396 | 0.319 | 2e-51 | |
| 427778603 | 1397 | Putative tick transposon [Rhipicephalus | 0.670 | 0.327 | 0.301 | 1e-48 | |
| 427791981 | 1060 | Putative tick transposon, partial [Rhipi | 0.527 | 0.339 | 0.344 | 3e-44 |
| >gi|125901787|gb|ABN58714.1| pol-like protein [Biomphalaria glabrata] | Back alignment and taxonomy information |
|---|
Score = 255 bits (652), Expect = 4e-65, Method: Compositional matrix adjust.
Identities = 166/492 (33%), Positives = 255/492 (51%), Gaps = 19/492 (3%)
Query: 26 GMTCNCDQDYDLLIIGRSKDLDLLLQRFQHTLDEIHKWSDLNGTIFSTDPGKSVCIDFNR 85
G+ C+ D D +I+ K+++ L ++ Q L++I W++ NG FS K+V + F
Sbjct: 656 GIECSLYVD-DFVILTYGKNMNTLERKLQLCLNKIQGWANYNGFKFSD--SKTVSMHFCN 712
Query: 86 LRNSR-SPALSYNGIQLKFVTSTKFLGLTWDAKMNWSLHIQLLKNRALNSLNALKMVSCK 144
LR P L + ++ V +TKFLGLT D+K N+ HI+ LK + SLN L+++S
Sbjct: 713 LRGLHPDPELFIHKKKIPVVKTTKFLGLTLDSKFNFLPHIKELKKKCQKSLNILRVLSHT 772
Query: 145 KWGVRRSMLLRFYKSFTLPILDYGCFIYGSAKDHVLNKLNTVHHAGIRIATGALRSSPVV 204
WG R LL Y+S LDYG IYG+A+ L L + +A +R+ GA R+SP+
Sbjct: 773 DWGADRDTLLLLYRSLIRSKLDYGSIIYGAARKSYLKILEPIQNAALRLCLGAFRTSPIP 832
Query: 205 SLYVDSGIPPLSLRRSKLMLNYVSKVGASPFNPAQKILFD-QDMSGFTFTINKPKPLCVR 263
SL+V++G P+ +R KL + Y+ K+ ++P NPA +F+ ++ + N +PL +R
Sbjct: 833 SLHVEAGELPMDIRMKKLAMQYIVKLKSNPTNPAFDSIFNPTEVELYNRRPNVIQPLGLR 892
Query: 264 YKD-ITAFDNALE--SSTFAPYMRFTPPWSNSPPPVDLSLCDGKKSDSAPVVFQSLFREA 320
++ I ++ S P PPW + P ++LSL + KK ++ P + Q FRE
Sbjct: 893 MREPIQNLTQPIDQISKIETPQ---NPPWLMNKPKLNLSLLNFKKENTDPSILQVHFRE- 948
Query: 321 INTKYTSHTICYTDGSKTPTTTGCAYSVGNVVRSTLLNPVNSIFSAELIAIFLCLEAILD 380
+ Y YTDGSK CA S N S L SIF+AEL AI L L A+
Sbjct: 949 LQESYGDCGTIYTDGSKMEGKVACACSFRNKTISRRLPDGCSIFTAELHAILLALMAVKA 1008
Query: 381 SPSGKFLIVTDSRSSLAALSNVRFINPLITKVYSTWSYLKLCKKDITFMWCPSHCGIKGN 440
S KF+I +DS+S+L AL ++ PL+ K + ++D+TF+W PSH GI+GN
Sbjct: 1009 SERSKFIICSDSKSALQALGRMKTDIPLVHKSLKLLDLITADRRDVTFIWVPSHVGIEGN 1068
Query: 441 EIVDVAAKNPTTGTTPFKLCTPEDFKPFVTALMNSEWQNLWDNVPNTNKLKTIRPSIKKD 500
E D AK D + + + EWQN W+ +KL+ I ++
Sbjct: 1069 EAADREAKRALNHAVSGTQIPYSDLRQSIASATYREWQNRWE-AETHSKLRQIVADVR-- 1125
Query: 501 ITFMWCPSHCGI 512
W P+ G+
Sbjct: 1126 ----WRPTSKGL 1133
|
Source: Biomphalaria glabrata Species: Biomphalaria glabrata Genus: Biomphalaria Family: Planorbidae Order: Class: Gastropoda Phylum: Mollusca Superkingdom: Eukaryota |
| >gi|427791807|gb|JAA61355.1| Putative tick transposon, partial [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|427791321|gb|JAA61112.1| Putative tick transposon, partial [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|427798889|gb|JAA64896.1| Putative tick transposon, partial [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|427798887|gb|JAA64895.1| Putative tick transposon, partial [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|427798885|gb|JAA64894.1| Putative tick transposon, partial [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|427791063|gb|JAA60983.1| Putative tick transposon, partial [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|427792011|gb|JAA61457.1| Putative tick transposon, partial [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|427778603|gb|JAA54753.1| Putative tick transposon [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|427791981|gb|JAA61442.1| Putative tick transposon, partial [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 682 | ||||||
| ASPGD|ASPL0000055652 | 1054 | AN0368 [Emericella nidulans (t | 0.391 | 0.253 | 0.242 | 2.2e-10 | |
| ASPGD|ASPL0000077547 | 1581 | AN8648 [Emericella nidulans (t | 0.677 | 0.292 | 0.222 | 4e-08 | |
| ASPGD|ASPL0000033911 | 686 | AN2796 [Emericella nidulans (t | 0.412 | 0.409 | 0.208 | 4.5e-06 | |
| ASPGD|ASPL0000040226 | 1538 | AN2661 [Emericella nidulans (t | 0.302 | 0.133 | 0.217 | 2.5e-05 | |
| ASPGD|ASPL0000075333 | 486 | AN10625 [Emericella nidulans ( | 0.240 | 0.337 | 0.25 | 0.00039 | |
| ASPGD|ASPL0000037597 | 666 | AN2711 [Emericella nidulans (t | 0.542 | 0.555 | 0.217 | 0.0006 |
| ASPGD|ASPL0000055652 AN0368 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
Score = 148 (57.2 bits), Expect = 2.2e-10, Sum P(2) = 2.2e-10
Identities = 69/285 (24%), Positives = 122/285 (42%)
Query: 12 LMSLLFVGFAVTGV-GMTCNCDQDYDLLIIGRSKDLDLLLQRFQHTLDEIHKWSDLNGTI 70
++ LL+ V+ + G C D D +L+ G + L+ Q+ +I G
Sbjct: 562 ILFLLYAARIVSTLEGSFCYAD-DMGILLTGNT--LEESSQQLVEAYKQITALGTETGLP 618
Query: 71 FSTDPGKSVCIDFNRLRNSRSPALSYNGIQ-LKFVTSTKFLGLTWDAKMNWSLHIQLLKN 129
FS + K+ F+R + P ++ GI + T++LG+ D K+ + HI L+ +
Sbjct: 619 FSIE--KTEIQHFSRKQQQHLPTVTLPGIGGITPSLYTRWLGVLLDTKLTFKAHINLVFS 676
Query: 130 RALNSLNALKMVSCKKWGVRRSMLLRFYKSFTLPILDYGCFIYGSAKDH--VLNKLNTVH 187
LK +S + G + + + LP YG ++ + K V+N L ++
Sbjct: 677 HGKRLAQHLKRLSNTQRGCPVAFMRAAVIQYVLPTALYGAEVFYTGKQQKGVVNSLLSLF 736
Query: 188 HAGIRIATGALRSSPVVSLYVDSGIP-PLSLRRSKLMLNYVSKVGASPFNPAQKILFDQD 246
A +++P +L ++ +P P +L S L VSK G P P ++ +D +
Sbjct: 737 RTAALAIIPAYKTTPTAALLREADLPDPEALLNSILRRAAVSK-GHGPAGPRTEV-YDAE 794
Query: 247 MSGFTFTINKP--KPLCVRYKD--ITAFDNALESSTFAPYMRFTP 287
+ G + +P CV Y + DN +S A Y R TP
Sbjct: 795 IMGAVEGLRTALGQP-CVGYSTQLVILLDNLAAASLLASY-RPTP 837
|
|
| ASPGD|ASPL0000077547 AN8648 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000033911 AN2796 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000040226 AN2661 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000075333 AN10625 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000037597 AN2711 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 682 | |||
| cd09276 | 128 | cd09276, Rnase_HI_RT_non_LTR, non-LTR RNase HI dom | 1e-30 | |
| pfam00075 | 126 | pfam00075, RNase_H, RNase H | 3e-17 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 3e-12 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 4e-12 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 4e-12 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 5e-12 | |
| pfam07133 | 164 | pfam07133, Merozoite_SPAM, Merozoite surface prote | 6e-12 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 1e-11 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 2e-11 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 2e-11 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 2e-11 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 3e-11 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 6e-11 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 6e-11 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 6e-11 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 7e-11 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 8e-11 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 8e-11 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 9e-11 | |
| PRK14891 | 131 | PRK14891, PRK14891, 50S ribosomal protein L24e/unk | 9e-11 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 2e-10 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 2e-10 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 2e-10 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 2e-10 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 2e-10 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 2e-10 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 2e-10 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 3e-10 | |
| PRK14891 | 131 | PRK14891, PRK14891, 50S ribosomal protein L24e/unk | 3e-10 | |
| pfam02029 | 431 | pfam02029, Caldesmon, Caldesmon | 3e-10 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 4e-10 | |
| PRK14891 | 131 | PRK14891, PRK14891, 50S ribosomal protein L24e/unk | 4e-10 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 4e-10 | |
| pfam03247 | 106 | pfam03247, Prothymosin, Prothymosin/parathymosin f | 4e-10 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 5e-10 | |
| PRK14891 | 131 | PRK14891, PRK14891, 50S ribosomal protein L24e/unk | 5e-10 | |
| pfam04050 | 171 | pfam04050, Upf2, Up-frameshift suppressor 2 | 5e-10 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 6e-10 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 6e-10 | |
| PRK14891 | 131 | PRK14891, PRK14891, 50S ribosomal protein L24e/unk | 7e-10 | |
| pfam03247 | 106 | pfam03247, Prothymosin, Prothymosin/parathymosin f | 7e-10 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 8e-10 | |
| pfam04050 | 171 | pfam04050, Upf2, Up-frameshift suppressor 2 | 8e-10 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 9e-10 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 1e-09 | |
| PRK14891 | 131 | PRK14891, PRK14891, 50S ribosomal protein L24e/unk | 1e-09 | |
| PRK14891 | 131 | PRK14891, PRK14891, 50S ribosomal protein L24e/unk | 1e-09 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 1e-09 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 1e-09 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 1e-09 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 2e-09 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 3e-09 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 3e-09 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 3e-09 | |
| pfam04050 | 171 | pfam04050, Upf2, Up-frameshift suppressor 2 | 3e-09 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 3e-09 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 3e-09 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 3e-09 | |
| pfam09747 | 178 | pfam09747, DUF2052, Coiled-coil domain containing | 3e-09 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 3e-09 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 3e-09 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 3e-09 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 4e-09 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 4e-09 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 4e-09 | |
| pfam03247 | 106 | pfam03247, Prothymosin, Prothymosin/parathymosin f | 4e-09 | |
| pfam03247 | 106 | pfam03247, Prothymosin, Prothymosin/parathymosin f | 4e-09 | |
| pfam09747 | 178 | pfam09747, DUF2052, Coiled-coil domain containing | 4e-09 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 4e-09 | |
| pfam07133 | 164 | pfam07133, Merozoite_SPAM, Merozoite surface prote | 5e-09 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 5e-09 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 5e-09 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 5e-09 | |
| pfam05672 | 171 | pfam05672, MAP7, MAP7 (E-MAP-115) family | 5e-09 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 5e-09 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 6e-09 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 6e-09 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 6e-09 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 7e-09 | |
| pfam02029 | 431 | pfam02029, Caldesmon, Caldesmon | 7e-09 | |
| pfam04050 | 171 | pfam04050, Upf2, Up-frameshift suppressor 2 | 8e-09 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 8e-09 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 8e-09 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 9e-09 | |
| pfam03247 | 106 | pfam03247, Prothymosin, Prothymosin/parathymosin f | 9e-09 | |
| pfam04050 | 171 | pfam04050, Upf2, Up-frameshift suppressor 2 | 9e-09 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 9e-09 | |
| PLN03142 | 1033 | PLN03142, PLN03142, Probable chromatin-remodeling | 9e-09 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 1e-08 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 1e-08 | |
| pfam04050 | 171 | pfam04050, Upf2, Up-frameshift suppressor 2 | 1e-08 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 1e-08 | |
| pfam04774 | 106 | pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA bindi | 1e-08 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 1e-08 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 1e-08 | |
| pfam04889 | 241 | pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont | 1e-08 | |
| cd09276 | 128 | cd09276, Rnase_HI_RT_non_LTR, non-LTR RNase HI dom | 2e-08 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 2e-08 | |
| pfam07133 | 164 | pfam07133, Merozoite_SPAM, Merozoite surface prote | 2e-08 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 2e-08 | |
| pfam02029 | 431 | pfam02029, Caldesmon, Caldesmon | 2e-08 | |
| pfam02029 | 431 | pfam02029, Caldesmon, Caldesmon | 2e-08 | |
| pfam09747 | 178 | pfam09747, DUF2052, Coiled-coil domain containing | 2e-08 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 2e-08 | |
| COG5414 | 392 | COG5414, COG5414, TATA-binding protein-associated | 2e-08 | |
| pfam05432 | 291 | pfam05432, BSP_II, Bone sialoprotein II (BSP-II) | 2e-08 | |
| COG5137 | 279 | COG5137, COG5137, Histone chaperone involved in ge | 2e-08 | |
| pfam04874 | 97 | pfam04874, Mak16, Mak16 protein C-terminal region | 2e-08 | |
| cd09273 | 135 | cd09273, RNase_HI_RT_Bel, Bel/Pao family of RNase | 2e-08 | |
| cd06222 | 123 | cd06222, RNase_H, RNase H is an endonuclease that | 2e-08 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 3e-08 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 3e-08 | |
| pfam04774 | 106 | pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA bindi | 3e-08 | |
| COG2811 | 108 | COG2811, NtpF, Archaeal/vacuolar-type H+-ATPase su | 3e-08 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 4e-08 | |
| PRK14891 | 131 | PRK14891, PRK14891, 50S ribosomal protein L24e/unk | 4e-08 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 4e-08 | |
| pfam09747 | 178 | pfam09747, DUF2052, Coiled-coil domain containing | 4e-08 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 4e-08 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 5e-08 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 5e-08 | |
| pfam03247 | 106 | pfam03247, Prothymosin, Prothymosin/parathymosin f | 5e-08 | |
| pfam03247 | 106 | pfam03247, Prothymosin, Prothymosin/parathymosin f | 5e-08 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 5e-08 | |
| pfam04774 | 106 | pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA bindi | 5e-08 | |
| pfam14153 | 185 | pfam14153, Spore_coat_CotO, Spore coat protein Cot | 5e-08 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 5e-08 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 5e-08 | |
| COG3343 | 175 | COG3343, RpoE, DNA-directed RNA polymerase, delta | 5e-08 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 6e-08 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 6e-08 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 6e-08 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 6e-08 | |
| pfam04050 | 171 | pfam04050, Upf2, Up-frameshift suppressor 2 | 6e-08 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 6e-08 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 7e-08 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 7e-08 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 8e-08 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 8e-08 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 8e-08 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 8e-08 | |
| pfam04874 | 97 | pfam04874, Mak16, Mak16 protein C-terminal region | 8e-08 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 8e-08 | |
| pfam05672 | 171 | pfam05672, MAP7, MAP7 (E-MAP-115) family | 9e-08 | |
| pfam04774 | 106 | pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA bindi | 9e-08 | |
| pfam04874 | 97 | pfam04874, Mak16, Mak16 protein C-terminal region | 9e-08 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 9e-08 | |
| pfam04006 | 613 | pfam04006, Mpp10, Mpp10 protein | 9e-08 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 1e-07 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 1e-07 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 1e-07 | |
| pfam02029 | 431 | pfam02029, Caldesmon, Caldesmon | 1e-07 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 1e-07 | |
| pfam05672 | 171 | pfam05672, MAP7, MAP7 (E-MAP-115) family | 1e-07 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 1e-07 | |
| pfam14153 | 185 | pfam14153, Spore_coat_CotO, Spore coat protein Cot | 1e-07 | |
| COG3343 | 175 | COG3343, RpoE, DNA-directed RNA polymerase, delta | 1e-07 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 1e-07 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 1e-07 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 1e-07 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 1e-07 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 1e-07 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 2e-07 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 2e-07 | |
| PRK14891 | 131 | PRK14891, PRK14891, 50S ribosomal protein L24e/unk | 2e-07 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 2e-07 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 2e-07 | |
| pfam04050 | 171 | pfam04050, Upf2, Up-frameshift suppressor 2 | 2e-07 | |
| pfam09747 | 178 | pfam09747, DUF2052, Coiled-coil domain containing | 2e-07 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 2e-07 | |
| pfam05672 | 171 | pfam05672, MAP7, MAP7 (E-MAP-115) family | 2e-07 | |
| pfam05672 | 171 | pfam05672, MAP7, MAP7 (E-MAP-115) family | 2e-07 | |
| pfam04774 | 106 | pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA bindi | 2e-07 | |
| pfam04874 | 97 | pfam04874, Mak16, Mak16 protein C-terminal region | 2e-07 | |
| pfam14153 | 185 | pfam14153, Spore_coat_CotO, Spore coat protein Cot | 2e-07 | |
| pfam14153 | 185 | pfam14153, Spore_coat_CotO, Spore coat protein Cot | 2e-07 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 2e-07 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 2e-07 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 2e-07 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 2e-07 | |
| pfam09805 | 134 | pfam09805, Nop25, Nucleolar protein 12 (25kDa) | 2e-07 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 3e-07 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 3e-07 | |
| pfam02029 | 431 | pfam02029, Caldesmon, Caldesmon | 3e-07 | |
| pfam03247 | 106 | pfam03247, Prothymosin, Prothymosin/parathymosin f | 3e-07 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 3e-07 | |
| pfam05672 | 171 | pfam05672, MAP7, MAP7 (E-MAP-115) family | 3e-07 | |
| pfam04774 | 106 | pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA bindi | 3e-07 | |
| pfam14153 | 185 | pfam14153, Spore_coat_CotO, Spore coat protein Cot | 3e-07 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 3e-07 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 3e-07 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 3e-07 | |
| pfam09805 | 134 | pfam09805, Nop25, Nucleolar protein 12 (25kDa) | 3e-07 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 3e-07 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 3e-07 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 3e-07 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 4e-07 | |
| pfam04050 | 171 | pfam04050, Upf2, Up-frameshift suppressor 2 | 4e-07 | |
| pfam09747 | 178 | pfam09747, DUF2052, Coiled-coil domain containing | 4e-07 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 4e-07 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 4e-07 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 4e-07 | |
| pfam04874 | 97 | pfam04874, Mak16, Mak16 protein C-terminal region | 4e-07 | |
| pfam14153 | 185 | pfam14153, Spore_coat_CotO, Spore coat protein Cot | 4e-07 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 4e-07 | |
| pfam04006 | 613 | pfam04006, Mpp10, Mpp10 protein | 4e-07 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 4e-07 | |
| pfam02724 | 583 | pfam02724, CDC45, CDC45-like protein | 4e-07 | |
| pfam11942 | 92 | pfam11942, Spt5_N, Spt5 transcription elongation f | 4e-07 | |
| PRK12585 | 197 | PRK12585, PRK12585, putative monovalent cation/H+ | 4e-07 | |
| pfam09747 | 178 | pfam09747, DUF2052, Coiled-coil domain containing | 5e-07 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 5e-07 | |
| COG5137 | 279 | COG5137, COG5137, Histone chaperone involved in ge | 5e-07 | |
| pfam14153 | 185 | pfam14153, Spore_coat_CotO, Spore coat protein Cot | 5e-07 | |
| pfam09805 | 134 | pfam09805, Nop25, Nucleolar protein 12 (25kDa) | 5e-07 | |
| pfam05887 | 145 | pfam05887, Trypan_PARP, Procyclic acidic repetitiv | 5e-07 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 5e-07 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 6e-07 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 6e-07 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 6e-07 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 6e-07 | |
| PRK12585 | 197 | PRK12585, PRK12585, putative monovalent cation/H+ | 6e-07 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 6e-07 | |
| PHA00435 | 306 | PHA00435, PHA00435, capsid assembly protein | 6e-07 | |
| PRK14891 | 131 | PRK14891, PRK14891, 50S ribosomal protein L24e/unk | 7e-07 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 7e-07 | |
| pfam04874 | 97 | pfam04874, Mak16, Mak16 protein C-terminal region | 7e-07 | |
| pfam04874 | 97 | pfam04874, Mak16, Mak16 protein C-terminal region | 7e-07 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 7e-07 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 7e-07 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 7e-07 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 7e-07 | |
| pfam11942 | 92 | pfam11942, Spt5_N, Spt5 transcription elongation f | 7e-07 | |
| PHA00435 | 306 | PHA00435, PHA00435, capsid assembly protein | 7e-07 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-07 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 7e-07 | |
| pfam14265 | 125 | pfam14265, DUF4355, Domain of unknown function (DU | 7e-07 | |
| pfam09747 | 178 | pfam09747, DUF2052, Coiled-coil domain containing | 8e-07 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 8e-07 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 8e-07 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 9e-07 | |
| pfam04874 | 97 | pfam04874, Mak16, Mak16 protein C-terminal region | 9e-07 | |
| pfam14153 | 185 | pfam14153, Spore_coat_CotO, Spore coat protein Cot | 9e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 9e-07 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 9e-07 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 9e-07 | |
| COG0576 | 193 | COG0576, GrpE, Molecular chaperone GrpE (heat shoc | 9e-07 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 1e-06 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 1e-06 | |
| pfam05672 | 171 | pfam05672, MAP7, MAP7 (E-MAP-115) family | 1e-06 | |
| pfam04874 | 97 | pfam04874, Mak16, Mak16 protein C-terminal region | 1e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 1e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 1e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 1e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 1e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 1e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 1e-06 | |
| pfam09805 | 134 | pfam09805, Nop25, Nucleolar protein 12 (25kDa) | 1e-06 | |
| pfam09805 | 134 | pfam09805, Nop25, Nucleolar protein 12 (25kDa) | 1e-06 | |
| pfam09805 | 134 | pfam09805, Nop25, Nucleolar protein 12 (25kDa) | 1e-06 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 1e-06 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 1e-06 | |
| pfam11942 | 92 | pfam11942, Spt5_N, Spt5 transcription elongation f | 1e-06 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 1e-06 | |
| COG0576 | 193 | COG0576, GrpE, Molecular chaperone GrpE (heat shoc | 1e-06 | |
| COG0576 | 193 | COG0576, GrpE, Molecular chaperone GrpE (heat shoc | 1e-06 | |
| pfam09538 | 104 | pfam09538, FYDLN_acid, Protein of unknown function | 1e-06 | |
| pfam04931 | 784 | pfam04931, DNA_pol_phi, DNA polymerase phi | 1e-06 | |
| TIGR02926 | 85 | TIGR02926, AhaH, ATP synthase archaeal, H subunit | 1e-06 | |
| PRK02363 | 129 | PRK02363, PRK02363, DNA-directed RNA polymerase su | 1e-06 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 1e-06 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 2e-06 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 2e-06 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 2e-06 | |
| PRK14891 | 131 | PRK14891, PRK14891, 50S ribosomal protein L24e/unk | 2e-06 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 2e-06 | |
| pfam04050 | 171 | pfam04050, Upf2, Up-frameshift suppressor 2 | 2e-06 | |
| pfam09747 | 178 | pfam09747, DUF2052, Coiled-coil domain containing | 2e-06 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 2e-06 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 2e-06 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 2e-06 | |
| pfam04774 | 106 | pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA bindi | 2e-06 | |
| pfam04774 | 106 | pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA bindi | 2e-06 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 2e-06 | |
| pfam14153 | 185 | pfam14153, Spore_coat_CotO, Spore coat protein Cot | 2e-06 | |
| COG3343 | 175 | COG3343, RpoE, DNA-directed RNA polymerase, delta | 2e-06 | |
| pfam04006 | 613 | pfam04006, Mpp10, Mpp10 protein | 2e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 2e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 2e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 2e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 2e-06 | |
| pfam05887 | 145 | pfam05887, Trypan_PARP, Procyclic acidic repetitiv | 2e-06 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 2e-06 | |
| pfam09538 | 104 | pfam09538, FYDLN_acid, Protein of unknown function | 2e-06 | |
| pfam04931 | 784 | pfam04931, DNA_pol_phi, DNA polymerase phi | 2e-06 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 2e-06 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 2e-06 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 2e-06 | |
| TIGR03685 | 105 | TIGR03685, L12P_arch, 50S ribosomal protein L12P | 2e-06 | |
| TIGR03685 | 105 | TIGR03685, L12P_arch, 50S ribosomal protein L12P | 2e-06 | |
| TIGR03685 | 105 | TIGR03685, L12P_arch, 50S ribosomal protein L12P | 2e-06 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 2e-06 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 2e-06 | |
| pfam11748 | 115 | pfam11748, DUF3306, Protein of unknown function (D | 2e-06 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 2e-06 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 2e-06 | |
| pfam00075 | 126 | pfam00075, RNase_H, RNase H | 3e-06 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 3e-06 | |
| PRK14891 | 131 | PRK14891, PRK14891, 50S ribosomal protein L24e/unk | 3e-06 | |
| PRK14891 | 131 | PRK14891, PRK14891, 50S ribosomal protein L24e/unk | 3e-06 | |
| pfam03247 | 106 | pfam03247, Prothymosin, Prothymosin/parathymosin f | 3e-06 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 3e-06 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 3e-06 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 3e-06 | |
| COG5137 | 279 | COG5137, COG5137, Histone chaperone involved in ge | 3e-06 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 3e-06 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 3e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 3e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 3e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 3e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 3e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 3e-06 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 3e-06 | |
| pfam09805 | 134 | pfam09805, Nop25, Nucleolar protein 12 (25kDa) | 3e-06 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 3e-06 | |
| pfam05887 | 145 | pfam05887, Trypan_PARP, Procyclic acidic repetitiv | 3e-06 | |
| pfam05887 | 145 | pfam05887, Trypan_PARP, Procyclic acidic repetitiv | 3e-06 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 3e-06 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 3e-06 | |
| pfam04931 | 784 | pfam04931, DNA_pol_phi, DNA polymerase phi | 3e-06 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 3e-06 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 3e-06 | |
| PTZ00438 | 374 | PTZ00438, PTZ00438, gamete antigen 27/25-like prot | 3e-06 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 3e-06 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 3e-06 | |
| COG5238 | 388 | COG5238, RNA1, Ran GTPase-activating protein (RanG | 3e-06 | |
| pfam09184 | 285 | pfam09184, PPP4R2, PPP4R2 | 3e-06 | |
| pfam02029 | 431 | pfam02029, Caldesmon, Caldesmon | 4e-06 | |
| pfam02029 | 431 | pfam02029, Caldesmon, Caldesmon | 4e-06 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 4e-06 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 4e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 4e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 4e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 4e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 4e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 4e-06 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 4e-06 | |
| pfam11942 | 92 | pfam11942, Spt5_N, Spt5 transcription elongation f | 4e-06 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 4e-06 | |
| pfam04931 | 784 | pfam04931, DNA_pol_phi, DNA polymerase phi | 4e-06 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 4e-06 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 4e-06 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 4e-06 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 5e-06 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 5e-06 | |
| pfam02029 | 431 | pfam02029, Caldesmon, Caldesmon | 5e-06 | |
| pfam05672 | 171 | pfam05672, MAP7, MAP7 (E-MAP-115) family | 5e-06 | |
| pfam04774 | 106 | pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA bindi | 5e-06 | |
| pfam05432 | 291 | pfam05432, BSP_II, Bone sialoprotein II (BSP-II) | 5e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 5e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 5e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 5e-06 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 5e-06 | |
| pfam04931 | 784 | pfam04931, DNA_pol_phi, DNA polymerase phi | 5e-06 | |
| TIGR03685 | 105 | TIGR03685, L12P_arch, 50S ribosomal protein L12P | 5e-06 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 5e-06 | |
| pfam09184 | 285 | pfam09184, PPP4R2, PPP4R2 | 5e-06 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 5e-06 | |
| COG5129 | 303 | COG5129, MAK16, Nuclear protein with HMG-like acid | 5e-06 | |
| pfam01271 | 585 | pfam01271, Granin, Granin (chromogranin or secreto | 5e-06 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 6e-06 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 6e-06 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 6e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 6e-06 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 6e-06 | |
| PRK12585 | 197 | PRK12585, PRK12585, putative monovalent cation/H+ | 6e-06 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 6e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 6e-06 | |
| pfam09184 | 285 | pfam09184, PPP4R2, PPP4R2 | 6e-06 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 6e-06 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 6e-06 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 6e-06 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 7e-06 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 7e-06 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 7e-06 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 7e-06 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 7e-06 | |
| TIGR01651 | 600 | TIGR01651, CobT, cobaltochelatase, CobT subunit | 7e-06 | |
| PTZ00423 | 193 | PTZ00423, PTZ00423, glideosome-associated protein | 7e-06 | |
| pfam09736 | 141 | pfam09736, Bud13, Pre-mRNA-splicing factor of RES | 7e-06 | |
| pfam05672 | 171 | pfam05672, MAP7, MAP7 (E-MAP-115) family | 8e-06 | |
| pfam14153 | 185 | pfam14153, Spore_coat_CotO, Spore coat protein Cot | 8e-06 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 8e-06 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 8e-06 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 8e-06 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 8e-06 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 8e-06 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 8e-06 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 9e-06 | |
| PRK14891 | 131 | PRK14891, PRK14891, 50S ribosomal protein L24e/unk | 9e-06 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 9e-06 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 9e-06 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 9e-06 | |
| COG3343 | 175 | COG3343, RpoE, DNA-directed RNA polymerase, delta | 9e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 9e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 9e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 9e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 9e-06 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 9e-06 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 9e-06 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 9e-06 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 9e-06 | |
| COG5406 | 1001 | COG5406, COG5406, Nucleosome binding factor SPN, S | 9e-06 | |
| cd02988 | 192 | cd02988, Phd_like_VIAF, Phosducin (Phd)-like famil | 9e-06 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 1e-05 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 1e-05 | |
| pfam07133 | 164 | pfam07133, Merozoite_SPAM, Merozoite surface prote | 1e-05 | |
| pfam07133 | 164 | pfam07133, Merozoite_SPAM, Merozoite surface prote | 1e-05 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 1e-05 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 1e-05 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 1e-05 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 1e-05 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 1e-05 | |
| pfam02029 | 431 | pfam02029, Caldesmon, Caldesmon | 1e-05 | |
| pfam04050 | 171 | pfam04050, Upf2, Up-frameshift suppressor 2 | 1e-05 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 1e-05 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 1e-05 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 1e-05 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 1e-05 | |
| COG5414 | 392 | COG5414, COG5414, TATA-binding protein-associated | 1e-05 | |
| COG5137 | 279 | COG5137, COG5137, Histone chaperone involved in ge | 1e-05 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 1e-05 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 1e-05 | |
| COG3343 | 175 | COG3343, RpoE, DNA-directed RNA polymerase, delta | 1e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-05 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 1e-05 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 1e-05 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 1e-05 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 1e-05 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 1e-05 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 1e-05 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 1e-05 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 1e-05 | |
| PRK12585 | 197 | PRK12585, PRK12585, putative monovalent cation/H+ | 1e-05 | |
| pfam05887 | 145 | pfam05887, Trypan_PARP, Procyclic acidic repetitiv | 1e-05 | |
| PHA00435 | 306 | PHA00435, PHA00435, capsid assembly protein | 1e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 1e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 1e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 1e-05 | |
| pfam14265 | 125 | pfam14265, DUF4355, Domain of unknown function (DU | 1e-05 | |
| pfam04931 | 784 | pfam04931, DNA_pol_phi, DNA polymerase phi | 1e-05 | |
| pfam04931 | 784 | pfam04931, DNA_pol_phi, DNA polymerase phi | 1e-05 | |
| PRK02363 | 129 | PRK02363, PRK02363, DNA-directed RNA polymerase su | 1e-05 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 1e-05 | |
| TIGR03685 | 105 | TIGR03685, L12P_arch, 50S ribosomal protein L12P | 1e-05 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 1e-05 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 1e-05 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 1e-05 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 1e-05 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 1e-05 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 1e-05 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 1e-05 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 1e-05 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 1e-05 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 1e-05 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 1e-05 | |
| TIGR01651 | 600 | TIGR01651, CobT, cobaltochelatase, CobT subunit | 1e-05 | |
| pfam09073 | 424 | pfam09073, BUD22, BUD22 | 1e-05 | |
| PRK06669 | 281 | PRK06669, fliH, flagellar assembly protein H; Vali | 1e-05 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 1e-05 | |
| PRK05658 | 619 | PRK05658, PRK05658, RNA polymerase sigma factor Rp | 1e-05 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 1e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 1e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 1e-05 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 1e-05 | |
| pfam06991 | 277 | pfam06991, Prp19_bind, Splicing factor, Prp19-bind | 1e-05 | |
| pfam06991 | 277 | pfam06991, Prp19_bind, Splicing factor, Prp19-bind | 1e-05 | |
| pfam06991 | 277 | pfam06991, Prp19_bind, Splicing factor, Prp19-bind | 1e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 1e-05 | |
| TIGR02907 | 338 | TIGR02907, spore_VI_D, stage VI sporulation protei | 1e-05 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 2e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 2e-05 | |
| COG5137 | 279 | COG5137, COG5137, Histone chaperone involved in ge | 2e-05 | |
| pfam04874 | 97 | pfam04874, Mak16, Mak16 protein C-terminal region | 2e-05 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 2e-05 | |
| COG3343 | 175 | COG3343, RpoE, DNA-directed RNA polymerase, delta | 2e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-05 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 2e-05 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 2e-05 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 2e-05 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 2e-05 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 2e-05 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 2e-05 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 2e-05 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 2e-05 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 2e-05 | |
| pfam05887 | 145 | pfam05887, Trypan_PARP, Procyclic acidic repetitiv | 2e-05 | |
| pfam05887 | 145 | pfam05887, Trypan_PARP, Procyclic acidic repetitiv | 2e-05 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 2e-05 | |
| PHA00435 | 306 | PHA00435, PHA00435, capsid assembly protein | 2e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 2e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 2e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 2e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 2e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 2e-05 | |
| pfam04931 | 784 | pfam04931, DNA_pol_phi, DNA polymerase phi | 2e-05 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 2e-05 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 2e-05 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 2e-05 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 2e-05 | |
| TIGR01651 | 600 | TIGR01651, CobT, cobaltochelatase, CobT subunit | 2e-05 | |
| TIGR01651 | 600 | TIGR01651, CobT, cobaltochelatase, CobT subunit | 2e-05 | |
| COG5406 | 1001 | COG5406, COG5406, Nucleosome binding factor SPN, S | 2e-05 | |
| cd02988 | 192 | cd02988, Phd_like_VIAF, Phosducin (Phd)-like famil | 2e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 2e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 2e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 2e-05 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 2e-05 | |
| PRK06007 | 542 | PRK06007, fliF, flagellar MS-ring protein; Reviewe | 2e-05 | |
| PRK14521 | 186 | PRK14521, rpsP, 30S ribosomal protein S16; Provisi | 2e-05 | |
| PRK08404 | 103 | PRK08404, PRK08404, V-type ATP synthase subunit H; | 2e-05 | |
| pfam05279 | 240 | pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylas | 2e-05 | |
| pfam11831 | 363 | pfam11831, Myb_Cef, pre-mRNA splicing factor compo | 2e-05 | |
| pfam11831 | 363 | pfam11831, Myb_Cef, pre-mRNA splicing factor compo | 2e-05 | |
| COG1579 | 239 | COG1579, COG1579, Zn-ribbon protein, possibly nucl | 2e-05 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 3e-05 | |
| pfam02029 | 431 | pfam02029, Caldesmon, Caldesmon | 3e-05 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 3e-05 | |
| pfam05672 | 171 | pfam05672, MAP7, MAP7 (E-MAP-115) family | 3e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-05 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 3e-05 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 3e-05 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 3e-05 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 3e-05 | |
| PRK12585 | 197 | PRK12585, PRK12585, putative monovalent cation/H+ | 3e-05 | |
| PHA00435 | 306 | PHA00435, PHA00435, capsid assembly protein | 3e-05 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 3e-05 | |
| pfam14265 | 125 | pfam14265, DUF4355, Domain of unknown function (DU | 3e-05 | |
| COG0576 | 193 | COG0576, GrpE, Molecular chaperone GrpE (heat shoc | 3e-05 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 3e-05 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 3e-05 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 3e-05 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 3e-05 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 3e-05 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 3e-05 | |
| PTZ00438 | 374 | PTZ00438, PTZ00438, gamete antigen 27/25-like prot | 3e-05 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 3e-05 | |
| COG5238 | 388 | COG5238, RNA1, Ran GTPase-activating protein (RanG | 3e-05 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 3e-05 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 3e-05 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 3e-05 | |
| cd02988 | 192 | cd02988, Phd_like_VIAF, Phosducin (Phd)-like famil | 3e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 3e-05 | |
| pfam11831 | 363 | pfam11831, Myb_Cef, pre-mRNA splicing factor compo | 3e-05 | |
| pfam11831 | 363 | pfam11831, Myb_Cef, pre-mRNA splicing factor compo | 3e-05 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 3e-05 | |
| COG2058 | 109 | COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP | 3e-05 | |
| pfam12253 | 76 | pfam12253, CAF1A, Chromatin assembly factor 1 subu | 3e-05 | |
| COG3351 | 214 | COG3351, FlaD, Putative archaeal flagellar protein | 3e-05 | |
| PRK12298 | 390 | PRK12298, obgE, GTPase CgtA; Reviewed | 3e-05 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 4e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-05 | |
| pfam04006 | 613 | pfam04006, Mpp10, Mpp10 protein | 4e-05 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 4e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 4e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 4e-05 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 4e-05 | |
| TIGR03685 | 105 | TIGR03685, L12P_arch, 50S ribosomal protein L12P | 4e-05 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 4e-05 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 4e-05 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 4e-05 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 4e-05 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 4e-05 | |
| pfam09073 | 424 | pfam09073, BUD22, BUD22 | 4e-05 | |
| TIGR02907 | 338 | TIGR02907, spore_VI_D, stage VI sporulation protei | 4e-05 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 4e-05 | |
| COG2058 | 109 | COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP | 4e-05 | |
| COG3351 | 214 | COG3351, FlaD, Putative archaeal flagellar protein | 4e-05 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 4e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 4e-05 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 4e-05 | |
| pfam03343 | 603 | pfam03343, SART-1, SART-1 family | 4e-05 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 4e-05 | |
| PRK13108 | 460 | PRK13108, PRK13108, prolipoprotein diacylglyceryl | 4e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 4e-05 | |
| pfam05672 | 171 | pfam05672, MAP7, MAP7 (E-MAP-115) family | 5e-05 | |
| PLN03142 | 1033 | PLN03142, PLN03142, Probable chromatin-remodeling | 5e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-05 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 5e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 5e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 5e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 5e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 5e-05 | |
| pfam04931 | 784 | pfam04931, DNA_pol_phi, DNA polymerase phi | 5e-05 | |
| TIGR02926 | 85 | TIGR02926, AhaH, ATP synthase archaeal, H subunit | 5e-05 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 5e-05 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 5e-05 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 5e-05 | |
| pfam09184 | 285 | pfam09184, PPP4R2, PPP4R2 | 5e-05 | |
| PTZ00423 | 193 | PTZ00423, PTZ00423, glideosome-associated protein | 5e-05 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 5e-05 | |
| PRK12298 | 390 | PRK12298, obgE, GTPase CgtA; Reviewed | 5e-05 | |
| pfam06512 | 230 | pfam06512, Na_trans_assoc, Sodium ion transport-as | 5e-05 | |
| smart00784 | 106 | smart00784, SPT2, SPT2 chromatin protein | 5e-05 | |
| pfam04502 | 321 | pfam04502, DUF572, Family of unknown function (DUF | 5e-05 | |
| pfam02029 | 431 | pfam02029, Caldesmon, Caldesmon | 6e-05 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 6e-05 | |
| pfam04006 | 613 | pfam04006, Mpp10, Mpp10 protein | 6e-05 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 6e-05 | |
| pfam14265 | 125 | pfam14265, DUF4355, Domain of unknown function (DU | 6e-05 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 6e-05 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 6e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 6e-05 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 6e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 6e-05 | |
| smart00784 | 106 | smart00784, SPT2, SPT2 chromatin protein | 6e-05 | |
| pfam09745 | 128 | pfam09745, DUF2040, Coiled-coil domain-containing | 6e-05 | |
| pfam14283 | 213 | pfam14283, DUF4366, Domain of unknown function (DU | 6e-05 | |
| pfam12619 | 145 | pfam12619, MCM2_N, Mini-chromosome maintenance pro | 6e-05 | |
| COG1317 | 234 | COG1317, FliH, Flagellar biosynthesis/type III sec | 6e-05 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 6e-05 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 7e-05 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 7e-05 | |
| COG5137 | 279 | COG5137, COG5137, Histone chaperone involved in ge | 7e-05 | |
| COG2811 | 108 | COG2811, NtpF, Archaeal/vacuolar-type H+-ATPase su | 7e-05 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 7e-05 | |
| pfam09805 | 134 | pfam09805, Nop25, Nucleolar protein 12 (25kDa) | 7e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 7e-05 | |
| COG0576 | 193 | COG0576, GrpE, Molecular chaperone GrpE (heat shoc | 7e-05 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 7e-05 | |
| TIGR03685 | 105 | TIGR03685, L12P_arch, 50S ribosomal protein L12P | 7e-05 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 7e-05 | |
| pfam11748 | 115 | pfam11748, DUF3306, Protein of unknown function (D | 7e-05 | |
| pfam11748 | 115 | pfam11748, DUF3306, Protein of unknown function (D | 7e-05 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 7e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 7e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 7e-05 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 7e-05 | |
| PRK12298 | 390 | PRK12298, obgE, GTPase CgtA; Reviewed | 7e-05 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 7e-05 | |
| PRK02292 | 188 | PRK02292, PRK02292, V-type ATP synthase subunit E; | 7e-05 | |
| TIGR03825 | 255 | TIGR03825, FliH_bacil, flagellar assembly protein | 7e-05 | |
| pfam04874 | 97 | pfam04874, Mak16, Mak16 protein C-terminal region | 8e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 8e-05 | |
| pfam04006 | 613 | pfam04006, Mpp10, Mpp10 protein | 8e-05 | |
| TIGR03685 | 105 | TIGR03685, L12P_arch, 50S ribosomal protein L12P | 8e-05 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 8e-05 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 8e-05 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 8e-05 | |
| pfam09073 | 424 | pfam09073, BUD22, BUD22 | 8e-05 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 8e-05 | |
| PRK12298 | 390 | PRK12298, obgE, GTPase CgtA; Reviewed | 8e-05 | |
| pfam03343 | 603 | pfam03343, SART-1, SART-1 family | 8e-05 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 8e-05 | |
| pfam05835 | 139 | pfam05835, Synaphin, Synaphin protein | 8e-05 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 9e-05 | |
| pfam04774 | 106 | pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA bindi | 9e-05 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 9e-05 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 9e-05 | |
| pfam14265 | 125 | pfam14265, DUF4355, Domain of unknown function (DU | 9e-05 | |
| TIGR03685 | 105 | TIGR03685, L12P_arch, 50S ribosomal protein L12P | 9e-05 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 9e-05 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 9e-05 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 9e-05 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 9e-05 | |
| pfam05279 | 240 | pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylas | 9e-05 | |
| COG5167 | 776 | COG5167, VID27, Protein involved in vacuole import | 9e-05 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 9e-05 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 1e-04 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 1e-04 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 1e-04 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 1e-04 | |
| pfam02029 | 431 | pfam02029, Caldesmon, Caldesmon | 1e-04 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 1e-04 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 1e-04 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 1e-04 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 1e-04 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 1e-04 | |
| COG5137 | 279 | COG5137, COG5137, Histone chaperone involved in ge | 1e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-04 | |
| pfam04006 | 613 | pfam04006, Mpp10, Mpp10 protein | 1e-04 | |
| pfam04006 | 613 | pfam04006, Mpp10, Mpp10 protein | 1e-04 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 1e-04 | |
| pfam09805 | 134 | pfam09805, Nop25, Nucleolar protein 12 (25kDa) | 1e-04 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 1e-04 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 1e-04 | |
| pfam02724 | 583 | pfam02724, CDC45, CDC45-like protein | 1e-04 | |
| pfam02724 | 583 | pfam02724, CDC45, CDC45-like protein | 1e-04 | |
| PHA00435 | 306 | PHA00435, PHA00435, capsid assembly protein | 1e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 1e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 1e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 1e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 1e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 1e-04 | |
| pfam14265 | 125 | pfam14265, DUF4355, Domain of unknown function (DU | 1e-04 | |
| COG0576 | 193 | COG0576, GrpE, Molecular chaperone GrpE (heat shoc | 1e-04 | |
| TIGR03685 | 105 | TIGR03685, L12P_arch, 50S ribosomal protein L12P | 1e-04 | |
| TIGR03685 | 105 | TIGR03685, L12P_arch, 50S ribosomal protein L12P | 1e-04 | |
| TIGR03685 | 105 | TIGR03685, L12P_arch, 50S ribosomal protein L12P | 1e-04 | |
| TIGR03685 | 105 | TIGR03685, L12P_arch, 50S ribosomal protein L12P | 1e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 1e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 1e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 1e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 1e-04 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 1e-04 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 1e-04 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 1e-04 | |
| TIGR01651 | 600 | TIGR01651, CobT, cobaltochelatase, CobT subunit | 1e-04 | |
| TIGR01651 | 600 | TIGR01651, CobT, cobaltochelatase, CobT subunit | 1e-04 | |
| pfam09073 | 424 | pfam09073, BUD22, BUD22 | 1e-04 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 1e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 1e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 1e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 1e-04 | |
| pfam05279 | 240 | pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylas | 1e-04 | |
| pfam11831 | 363 | pfam11831, Myb_Cef, pre-mRNA splicing factor compo | 1e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 1e-04 | |
| COG2058 | 109 | COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP | 1e-04 | |
| COG2058 | 109 | COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP | 1e-04 | |
| COG2058 | 109 | COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP | 1e-04 | |
| pfam03343 | 603 | pfam03343, SART-1, SART-1 family | 1e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-04 | |
| pfam14283 | 213 | pfam14283, DUF4366, Domain of unknown function (DU | 1e-04 | |
| pfam14283 | 213 | pfam14283, DUF4366, Domain of unknown function (DU | 1e-04 | |
| pfam12619 | 145 | pfam12619, MCM2_N, Mini-chromosome maintenance pro | 1e-04 | |
| PRK14150 | 193 | PRK14150, PRK14150, heat shock protein GrpE; Provi | 1e-04 | |
| pfam00769 | 244 | pfam00769, ERM, Ezrin/radixin/moesin family | 1e-04 | |
| pfam00769 | 244 | pfam00769, ERM, Ezrin/radixin/moesin family | 1e-04 | |
| COG1614 | 470 | COG1614, CdhC, CO dehydrogenase/acetyl-CoA synthas | 1e-04 | |
| PRK05687 | 246 | PRK05687, fliH, flagellar assembly protein H; Vali | 1e-04 | |
| TIGR03779 | 410 | TIGR03779, Bac_Flav_CT_M, Bacteroides conjugative | 1e-04 | |
| pfam12118 | 261 | pfam12118, SprA-related, SprA-related family | 1e-04 | |
| pfam09110 | 109 | pfam09110, HAND, HAND | 1e-04 | |
| PRK14156 | 177 | PRK14156, PRK14156, heat shock protein GrpE; Provi | 1e-04 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 2e-04 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 2e-04 | |
| pfam02029 | 431 | pfam02029, Caldesmon, Caldesmon | 2e-04 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 2e-04 | |
| COG5137 | 279 | COG5137, COG5137, Histone chaperone involved in ge | 2e-04 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 2e-04 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 2e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-04 | |
| pfam04006 | 613 | pfam04006, Mpp10, Mpp10 protein | 2e-04 | |
| pfam04006 | 613 | pfam04006, Mpp10, Mpp10 protein | 2e-04 | |
| pfam04006 | 613 | pfam04006, Mpp10, Mpp10 protein | 2e-04 | |
| PRK12585 | 197 | PRK12585, PRK12585, putative monovalent cation/H+ | 2e-04 | |
| PHA00435 | 306 | PHA00435, PHA00435, capsid assembly protein | 2e-04 | |
| PHA00435 | 306 | PHA00435, PHA00435, capsid assembly protein | 2e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 2e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 2e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 2e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 2e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 2e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 2e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 2e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 2e-04 | |
| pfam09538 | 104 | pfam09538, FYDLN_acid, Protein of unknown function | 2e-04 | |
| pfam09538 | 104 | pfam09538, FYDLN_acid, Protein of unknown function | 2e-04 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 2e-04 | |
| TIGR03685 | 105 | TIGR03685, L12P_arch, 50S ribosomal protein L12P | 2e-04 | |
| TIGR03685 | 105 | TIGR03685, L12P_arch, 50S ribosomal protein L12P | 2e-04 | |
| TIGR03685 | 105 | TIGR03685, L12P_arch, 50S ribosomal protein L12P | 2e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 2e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 2e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 2e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 2e-04 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 2e-04 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 2e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 2e-04 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 2e-04 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 2e-04 | |
| PTZ00438 | 374 | PTZ00438, PTZ00438, gamete antigen 27/25-like prot | 2e-04 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 2e-04 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 2e-04 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 2e-04 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 2e-04 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 2e-04 | |
| TIGR01651 | 600 | TIGR01651, CobT, cobaltochelatase, CobT subunit | 2e-04 | |
| pfam09073 | 424 | pfam09073, BUD22, BUD22 | 2e-04 | |
| PRK06669 | 281 | PRK06669, fliH, flagellar assembly protein H; Vali | 2e-04 | |
| PRK05658 | 619 | PRK05658, PRK05658, RNA polymerase sigma factor Rp | 2e-04 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 2e-04 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 2e-04 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 2e-04 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 2e-04 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 2e-04 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 2e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 2e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 2e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 2e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 2e-04 | |
| PRK14521 | 186 | PRK14521, rpsP, 30S ribosomal protein S16; Provisi | 2e-04 | |
| pfam05279 | 240 | pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylas | 2e-04 | |
| pfam05279 | 240 | pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylas | 2e-04 | |
| pfam11831 | 363 | pfam11831, Myb_Cef, pre-mRNA splicing factor compo | 2e-04 | |
| COG2058 | 109 | COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP | 2e-04 | |
| COG2058 | 109 | COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP | 2e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-04 | |
| pfam14283 | 213 | pfam14283, DUF4366, Domain of unknown function (DU | 2e-04 | |
| pfam14283 | 213 | pfam14283, DUF4366, Domain of unknown function (DU | 2e-04 | |
| pfam12619 | 145 | pfam12619, MCM2_N, Mini-chromosome maintenance pro | 2e-04 | |
| pfam12619 | 145 | pfam12619, MCM2_N, Mini-chromosome maintenance pro | 2e-04 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 2e-04 | |
| COG5167 | 776 | COG5167, VID27, Protein involved in vacuole import | 2e-04 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 2e-04 | |
| PRK14150 | 193 | PRK14150, PRK14150, heat shock protein GrpE; Provi | 2e-04 | |
| PRK14150 | 193 | PRK14150, PRK14150, heat shock protein GrpE; Provi | 2e-04 | |
| PRK14156 | 177 | PRK14156, PRK14156, heat shock protein GrpE; Provi | 2e-04 | |
| PRK14156 | 177 | PRK14156, PRK14156, heat shock protein GrpE; Provi | 2e-04 | |
| pfam10156 | 454 | pfam10156, Med17, Subunit 17 of Mediator complex | 2e-04 | |
| COG2433 | 652 | COG2433, COG2433, Uncharacterized conserved protei | 2e-04 | |
| pfam06246 | 253 | pfam06246, Isy1, Isy1-like splicing family | 2e-04 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 2e-04 | |
| PRK14145 | 196 | PRK14145, PRK14145, heat shock protein GrpE; Provi | 2e-04 | |
| PRK14145 | 196 | PRK14145, PRK14145, heat shock protein GrpE; Provi | 2e-04 | |
| pfam12446 | 133 | pfam12446, DUF3682, Protein of unknown function (D | 2e-04 | |
| pfam07222 | 243 | pfam07222, PBP_sp32, Proacrosin binding protein sp | 2e-04 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 2e-04 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 2e-04 | |
| PRK12903 | 925 | PRK12903, secA, preprotein translocase subunit Sec | 2e-04 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 2e-04 | |
| TIGR01554 | 384 | TIGR01554, major_cap_HK97, phage major capsid prot | 2e-04 | |
| pfam13476 | 204 | pfam13476, AAA_23, AAA domain | 2e-04 | |
| PRK09202 | 470 | PRK09202, nusA, transcription elongation factor Nu | 2e-04 | |
| PRK09202 | 470 | PRK09202, nusA, transcription elongation factor Nu | 2e-04 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 3e-04 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 3e-04 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 3e-04 | |
| pfam02029 | 431 | pfam02029, Caldesmon, Caldesmon | 3e-04 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 3e-04 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 3e-04 | |
| pfam04774 | 106 | pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA bindi | 3e-04 | |
| pfam04874 | 97 | pfam04874, Mak16, Mak16 protein C-terminal region | 3e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-04 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 3e-04 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 3e-04 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 3e-04 | |
| pfam09805 | 134 | pfam09805, Nop25, Nucleolar protein 12 (25kDa) | 3e-04 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 3e-04 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 3e-04 | |
| PHA00435 | 306 | PHA00435, PHA00435, capsid assembly protein | 3e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 3e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 3e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 3e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 3e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 3e-04 | |
| COG0576 | 193 | COG0576, GrpE, Molecular chaperone GrpE (heat shoc | 3e-04 | |
| TIGR03685 | 105 | TIGR03685, L12P_arch, 50S ribosomal protein L12P | 3e-04 | |
| TIGR03685 | 105 | TIGR03685, L12P_arch, 50S ribosomal protein L12P | 3e-04 | |
| TIGR03685 | 105 | TIGR03685, L12P_arch, 50S ribosomal protein L12P | 3e-04 | |
| TIGR03685 | 105 | TIGR03685, L12P_arch, 50S ribosomal protein L12P | 3e-04 | |
| TIGR03685 | 105 | TIGR03685, L12P_arch, 50S ribosomal protein L12P | 3e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 3e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 3e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 3e-04 | |
| PTZ00438 | 374 | PTZ00438, PTZ00438, gamete antigen 27/25-like prot | 3e-04 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 3e-04 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 3e-04 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 3e-04 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 3e-04 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 3e-04 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 3e-04 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 3e-04 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 3e-04 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 3e-04 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 3e-04 | |
| COG5406 | 1001 | COG5406, COG5406, Nucleosome binding factor SPN, S | 3e-04 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 3e-04 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 3e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 3e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 3e-04 | |
| COG2058 | 109 | COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP | 3e-04 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 3e-04 | |
| TIGR03825 | 255 | TIGR03825, FliH_bacil, flagellar assembly protein | 3e-04 | |
| PRK14150 | 193 | PRK14150, PRK14150, heat shock protein GrpE; Provi | 3e-04 | |
| COG1614 | 470 | COG1614, CdhC, CO dehydrogenase/acetyl-CoA synthas | 3e-04 | |
| pfam09110 | 109 | pfam09110, HAND, HAND | 3e-04 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 3e-04 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 3e-04 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 3e-04 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 3e-04 | |
| TIGR01554 | 384 | TIGR01554, major_cap_HK97, phage major capsid prot | 3e-04 | |
| PRK09202 | 470 | PRK09202, nusA, transcription elongation factor Nu | 3e-04 | |
| pfam04111 | 356 | pfam04111, APG6, Autophagy protein Apg6 | 3e-04 | |
| pfam05340 | 565 | pfam05340, DUF740, Protein of unknown function (DU | 3e-04 | |
| COG1390 | 194 | COG1390, NtpE, Archaeal/vacuolar-type H+-ATPase su | 3e-04 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 3e-04 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 4e-04 | |
| pfam02029 | 431 | pfam02029, Caldesmon, Caldesmon | 4e-04 | |
| COG3343 | 175 | COG3343, RpoE, DNA-directed RNA polymerase, delta | 4e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-04 | |
| pfam04006 | 613 | pfam04006, Mpp10, Mpp10 protein | 4e-04 | |
| pfam04006 | 613 | pfam04006, Mpp10, Mpp10 protein | 4e-04 | |
| pfam04006 | 613 | pfam04006, Mpp10, Mpp10 protein | 4e-04 | |
| pfam04006 | 613 | pfam04006, Mpp10, Mpp10 protein | 4e-04 | |
| pfam04006 | 613 | pfam04006, Mpp10, Mpp10 protein | 4e-04 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 4e-04 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 4e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 4e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 4e-04 | |
| PTZ00438 | 374 | PTZ00438, PTZ00438, gamete antigen 27/25-like prot | 4e-04 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 4e-04 | |
| PTZ00423 | 193 | PTZ00423, PTZ00423, glideosome-associated protein | 4e-04 | |
| PTZ00423 | 193 | PTZ00423, PTZ00423, glideosome-associated protein | 4e-04 | |
| COG5406 | 1001 | COG5406, COG5406, Nucleosome binding factor SPN, S | 4e-04 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 4e-04 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 4e-04 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 4e-04 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 4e-04 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 4e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 4e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 4e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 4e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 4e-04 | |
| PRK14521 | 186 | PRK14521, rpsP, 30S ribosomal protein S16; Provisi | 4e-04 | |
| pfam05279 | 240 | pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylas | 4e-04 | |
| pfam05279 | 240 | pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylas | 4e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 4e-04 | |
| COG2058 | 109 | COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP | 4e-04 | |
| COG2058 | 109 | COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP | 4e-04 | |
| pfam12253 | 76 | pfam12253, CAF1A, Chromatin assembly factor 1 subu | 4e-04 | |
| COG3351 | 214 | COG3351, FlaD, Putative archaeal flagellar protein | 4e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 4e-04 | |
| pfam14283 | 213 | pfam14283, DUF4366, Domain of unknown function (DU | 4e-04 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 4e-04 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 4e-04 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 4e-04 | |
| PRK14150 | 193 | PRK14150, PRK14150, heat shock protein GrpE; Provi | 4e-04 | |
| PRK14145 | 196 | PRK14145, PRK14145, heat shock protein GrpE; Provi | 4e-04 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 4e-04 | |
| pfam09731 | 493 | pfam09731, Mitofilin, Mitochondrial inner membrane | 4e-04 | |
| pfam00428 | 88 | pfam00428, Ribosomal_60s, 60s Acidic ribosomal pro | 4e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-04 | |
| pfam04006 | 613 | pfam04006, Mpp10, Mpp10 protein | 5e-04 | |
| pfam09805 | 134 | pfam09805, Nop25, Nucleolar protein 12 (25kDa) | 5e-04 | |
| PHA00435 | 306 | PHA00435, PHA00435, capsid assembly protein | 5e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 5e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 5e-04 | |
| PTZ00438 | 374 | PTZ00438, PTZ00438, gamete antigen 27/25-like prot | 5e-04 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 5e-04 | |
| pfam09184 | 285 | pfam09184, PPP4R2, PPP4R2 | 5e-04 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 5e-04 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 5e-04 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 5e-04 | |
| COG5406 | 1001 | COG5406, COG5406, Nucleosome binding factor SPN, S | 5e-04 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 5e-04 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 5e-04 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 5e-04 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 5e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 5e-04 | |
| TIGR02907 | 338 | TIGR02907, spore_VI_D, stage VI sporulation protei | 5e-04 | |
| TIGR02907 | 338 | TIGR02907, spore_VI_D, stage VI sporulation protei | 5e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 5e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 5e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 5e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 5e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 5e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 5e-04 | |
| PRK14150 | 193 | PRK14150, PRK14150, heat shock protein GrpE; Provi | 5e-04 | |
| COG1614 | 470 | COG1614, CdhC, CO dehydrogenase/acetyl-CoA synthas | 5e-04 | |
| PRK14156 | 177 | PRK14156, PRK14156, heat shock protein GrpE; Provi | 5e-04 | |
| PRK14145 | 196 | PRK14145, PRK14145, heat shock protein GrpE; Provi | 5e-04 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 5e-04 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 5e-04 | |
| PRK09202 | 470 | PRK09202, nusA, transcription elongation factor Nu | 5e-04 | |
| PRK05306 | 746 | PRK05306, infB, translation initiation factor IF-2 | 5e-04 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 6e-04 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 6e-04 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 6e-04 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 6e-04 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 6e-04 | |
| pfam05672 | 171 | pfam05672, MAP7, MAP7 (E-MAP-115) family | 6e-04 | |
| pfam05672 | 171 | pfam05672, MAP7, MAP7 (E-MAP-115) family | 6e-04 | |
| pfam04889 | 241 | pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont | 6e-04 | |
| COG5137 | 279 | COG5137, COG5137, Histone chaperone involved in ge | 6e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-04 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 6e-04 | |
| pfam04006 | 613 | pfam04006, Mpp10, Mpp10 protein | 6e-04 | |
| pfam05887 | 145 | pfam05887, Trypan_PARP, Procyclic acidic repetitiv | 6e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 6e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 6e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 6e-04 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 6e-04 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 6e-04 | |
| TIGR01651 | 600 | TIGR01651, CobT, cobaltochelatase, CobT subunit | 6e-04 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 6e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 6e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 6e-04 | |
| PRK14521 | 186 | PRK14521, rpsP, 30S ribosomal protein S16; Provisi | 6e-04 | |
| pfam05279 | 240 | pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylas | 6e-04 | |
| COG2058 | 109 | COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP | 6e-04 | |
| COG2058 | 109 | COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP | 6e-04 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 6e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 6e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 6e-04 | |
| pfam14283 | 213 | pfam14283, DUF4366, Domain of unknown function (DU | 6e-04 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 6e-04 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 6e-04 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 6e-04 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 6e-04 | |
| pfam00769 | 244 | pfam00769, ERM, Ezrin/radixin/moesin family | 6e-04 | |
| PRK09202 | 470 | PRK09202, nusA, transcription elongation factor Nu | 6e-04 | |
| pfam08243 | 116 | pfam08243, SPT2, SPT2 chromatin protein | 6e-04 | |
| pfam13025 | 70 | pfam13025, DUF3886, Protein of unknown function (D | 6e-04 | |
| TIGR01069 | 771 | TIGR01069, mutS2, MutS2 family protein | 6e-04 | |
| PLN03142 | 1033 | PLN03142, PLN03142, Probable chromatin-remodeling | 7e-04 | |
| pfam04874 | 97 | pfam04874, Mak16, Mak16 protein C-terminal region | 7e-04 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 7e-04 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 7e-04 | |
| pfam14153 | 185 | pfam14153, Spore_coat_CotO, Spore coat protein Cot | 7e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 7e-04 | |
| PHA00435 | 306 | PHA00435, PHA00435, capsid assembly protein | 7e-04 | |
| PHA00435 | 306 | PHA00435, PHA00435, capsid assembly protein | 7e-04 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 7e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 7e-04 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 7e-04 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 7e-04 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 7e-04 | |
| COG5406 | 1001 | COG5406, COG5406, Nucleosome binding factor SPN, S | 7e-04 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 7e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 7e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 7e-04 | |
| pfam05279 | 240 | pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylas | 7e-04 | |
| pfam05279 | 240 | pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylas | 7e-04 | |
| COG2058 | 109 | COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP | 7e-04 | |
| COG2058 | 109 | COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP | 7e-04 | |
| COG2058 | 109 | COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP | 7e-04 | |
| pfam03343 | 603 | pfam03343, SART-1, SART-1 family | 7e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 7e-04 | |
| pfam12619 | 145 | pfam12619, MCM2_N, Mini-chromosome maintenance pro | 7e-04 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 7e-04 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 7e-04 | |
| pfam00769 | 244 | pfam00769, ERM, Ezrin/radixin/moesin family | 7e-04 | |
| COG1614 | 470 | COG1614, CdhC, CO dehydrogenase/acetyl-CoA synthas | 7e-04 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 7e-04 | |
| pfam10211 | 189 | pfam10211, Ax_dynein_light, Axonemal dynein light | 7e-04 | |
| pfam06658 | 142 | pfam06658, DUF1168, Protein of unknown function (D | 7e-04 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 8e-04 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 8e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 8e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 8e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 8e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 8e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 8e-04 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 8e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 8e-04 | |
| COG2058 | 109 | COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP | 8e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 8e-04 | |
| pfam14283 | 213 | pfam14283, DUF4366, Domain of unknown function (DU | 8e-04 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 8e-04 | |
| pfam00769 | 244 | pfam00769, ERM, Ezrin/radixin/moesin family | 8e-04 | |
| pfam09110 | 109 | pfam09110, HAND, HAND | 8e-04 | |
| pfam06246 | 253 | pfam06246, Isy1, Isy1-like splicing family | 8e-04 | |
| pfam05340 | 565 | pfam05340, DUF740, Protein of unknown function (DU | 8e-04 | |
| PRK05306 | 746 | PRK05306, infB, translation initiation factor IF-2 | 8e-04 | |
| pfam03962 | 188 | pfam03962, Mnd1, Mnd1 family | 8e-04 | |
| CHL00204 | 1832 | CHL00204, ycf1, Ycf1; Provisional | 8e-04 | |
| COG1667 | 254 | COG1667, COG1667, Uncharacterized protein conserve | 8e-04 | |
| pfam12757 | 126 | pfam12757, DUF3812, Protein of unknown function (D | 8e-04 | |
| PRK05657 | 325 | PRK05657, PRK05657, RNA polymerase sigma factor Rp | 8e-04 | |
| PLN00152 | 130 | PLN00152, PLN00152, DNA-directed RNA polymerase; P | 8e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 9e-04 | |
| pfam04931 | 784 | pfam04931, DNA_pol_phi, DNA polymerase phi | 9e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 9e-04 | |
| PRK14145 | 196 | PRK14145, PRK14145, heat shock protein GrpE; Provi | 9e-04 | |
| pfam09731 | 493 | pfam09731, Mitofilin, Mitochondrial inner membrane | 9e-04 | |
| pfam02841 | 297 | pfam02841, GBP_C, Guanylate-binding protein, C-ter | 9e-04 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 0.001 | |
| pfam02029 | 431 | pfam02029, Caldesmon, Caldesmon | 0.001 | |
| pfam02029 | 431 | pfam02029, Caldesmon, Caldesmon | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.001 | |
| pfam04006 | 613 | pfam04006, Mpp10, Mpp10 protein | 0.001 | |
| pfam04006 | 613 | pfam04006, Mpp10, Mpp10 protein | 0.001 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 0.001 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 0.001 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 0.001 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.001 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.001 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.001 | |
| pfam09538 | 104 | pfam09538, FYDLN_acid, Protein of unknown function | 0.001 | |
| TIGR02926 | 85 | TIGR02926, AhaH, ATP synthase archaeal, H subunit | 0.001 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.001 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.001 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 0.001 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 0.001 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 0.001 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 0.001 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 0.001 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 0.001 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 0.001 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 0.001 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 0.001 | |
| pfam06991 | 277 | pfam06991, Prp19_bind, Splicing factor, Prp19-bind | 0.001 | |
| TIGR02907 | 338 | TIGR02907, spore_VI_D, stage VI sporulation protei | 0.001 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.001 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.001 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.001 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.001 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.001 | |
| PRK14521 | 186 | PRK14521, rpsP, 30S ribosomal protein S16; Provisi | 0.001 | |
| pfam05279 | 240 | pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylas | 0.001 | |
| pfam05279 | 240 | pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylas | 0.001 | |
| pfam05279 | 240 | pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylas | 0.001 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.001 | |
| COG2058 | 109 | COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP | 0.001 | |
| COG2058 | 109 | COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP | 0.001 | |
| pfam12253 | 76 | pfam12253, CAF1A, Chromatin assembly factor 1 subu | 0.001 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.001 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.001 | |
| pfam03343 | 603 | pfam03343, SART-1, SART-1 family | 0.001 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.001 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.001 | |
| pfam04502 | 321 | pfam04502, DUF572, Family of unknown function (DUF | 0.001 | |
| pfam04502 | 321 | pfam04502, DUF572, Family of unknown function (DUF | 0.001 | |
| pfam14283 | 213 | pfam14283, DUF4366, Domain of unknown function (DU | 0.001 | |
| pfam14283 | 213 | pfam14283, DUF4366, Domain of unknown function (DU | 0.001 | |
| pfam14283 | 213 | pfam14283, DUF4366, Domain of unknown function (DU | 0.001 | |
| pfam14283 | 213 | pfam14283, DUF4366, Domain of unknown function (DU | 0.001 | |
| pfam14283 | 213 | pfam14283, DUF4366, Domain of unknown function (DU | 0.001 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 0.001 | |
| COG5167 | 776 | COG5167, VID27, Protein involved in vacuole import | 0.001 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 0.001 | |
| PRK14150 | 193 | PRK14150, PRK14150, heat shock protein GrpE; Provi | 0.001 | |
| COG1614 | 470 | COG1614, CdhC, CO dehydrogenase/acetyl-CoA synthas | 0.001 | |
| pfam12118 | 261 | pfam12118, SprA-related, SprA-related family | 0.001 | |
| pfam09110 | 109 | pfam09110, HAND, HAND | 0.001 | |
| PRK14156 | 177 | PRK14156, PRK14156, heat shock protein GrpE; Provi | 0.001 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 0.001 | |
| PRK14145 | 196 | PRK14145, PRK14145, heat shock protein GrpE; Provi | 0.001 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 0.001 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 0.001 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 0.001 | |
| pfam05340 | 565 | pfam05340, DUF740, Protein of unknown function (DU | 0.001 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.001 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.001 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.001 | |
| pfam00428 | 88 | pfam00428, Ribosomal_60s, 60s Acidic ribosomal pro | 0.001 | |
| pfam00428 | 88 | pfam00428, Ribosomal_60s, 60s Acidic ribosomal pro | 0.001 | |
| pfam00428 | 88 | pfam00428, Ribosomal_60s, 60s Acidic ribosomal pro | 0.001 | |
| pfam00428 | 88 | pfam00428, Ribosomal_60s, 60s Acidic ribosomal pro | 0.001 | |
| pfam00428 | 88 | pfam00428, Ribosomal_60s, 60s Acidic ribosomal pro | 0.001 | |
| pfam00428 | 88 | pfam00428, Ribosomal_60s, 60s Acidic ribosomal pro | 0.001 | |
| pfam00428 | 88 | pfam00428, Ribosomal_60s, 60s Acidic ribosomal pro | 0.001 | |
| pfam00428 | 88 | pfam00428, Ribosomal_60s, 60s Acidic ribosomal pro | 0.001 | |
| pfam13025 | 70 | pfam13025, DUF3886, Protein of unknown function (D | 0.001 | |
| pfam13025 | 70 | pfam13025, DUF3886, Protein of unknown function (D | 0.001 | |
| pfam03962 | 188 | pfam03962, Mnd1, Mnd1 family | 0.001 | |
| pfam12757 | 126 | pfam12757, DUF3812, Protein of unknown function (D | 0.001 | |
| PRK05657 | 325 | PRK05657, PRK05657, RNA polymerase sigma factor Rp | 0.001 | |
| PLN00152 | 130 | PLN00152, PLN00152, DNA-directed RNA polymerase; P | 0.001 | |
| pfam02841 | 297 | pfam02841, GBP_C, Guanylate-binding protein, C-ter | 0.001 | |
| COG5177 | 769 | COG5177, COG5177, Uncharacterized conserved protei | 0.001 | |
| COG5163 | 591 | COG5163, NOP7, Protein required for biogenesis of | 0.001 | |
| pfam11711 | 377 | pfam11711, Tim54, Inner membrane protein import co | 0.001 | |
| pfam11711 | 377 | pfam11711, Tim54, Inner membrane protein import co | 0.001 | |
| PRK04456 | 463 | PRK04456, PRK04456, acetyl-CoA decarbonylase/synth | 0.001 | |
| PRK04456 | 463 | PRK04456, PRK04456, acetyl-CoA decarbonylase/synth | 0.001 | |
| PRK14149 | 191 | PRK14149, PRK14149, heat shock protein GrpE; Provi | 0.001 | |
| pfam05395 | 170 | pfam05395, DARPP-32, Protein phosphatase inhibitor | 0.001 | |
| pfam05395 | 170 | pfam05395, DARPP-32, Protein phosphatase inhibitor | 0.001 | |
| pfam08703 | 181 | pfam08703, PLC-beta_C, PLC-beta C terminal | 0.001 | |
| cd01650 | 220 | cd01650, RT_nLTR_like, RT_nLTR: Non-LTR (long term | 0.001 | |
| COG5296 | 521 | COG5296, COG5296, Transcription factor involved in | 0.001 | |
| PRK04863 | 1486 | PRK04863, mukB, cell division protein MukB; Provis | 0.001 | |
| pfam04921 | 233 | pfam04921, XAP5, XAP5, circadian clock regulator | 0.001 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 0.002 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 0.002 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 0.002 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 0.002 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 0.002 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 0.002 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 0.002 | |
| PLN03142 | 1033 | PLN03142, PLN03142, Probable chromatin-remodeling | 0.002 | |
| COG5414 | 392 | COG5414, COG5414, TATA-binding protein-associated | 0.002 | |
| COG5414 | 392 | COG5414, COG5414, TATA-binding protein-associated | 0.002 | |
| pfam05432 | 291 | pfam05432, BSP_II, Bone sialoprotein II (BSP-II) | 0.002 | |
| pfam04874 | 97 | pfam04874, Mak16, Mak16 protein C-terminal region | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 0.002 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 0.002 | |
| pfam09805 | 134 | pfam09805, Nop25, Nucleolar protein 12 (25kDa) | 0.002 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 0.002 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.002 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.002 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.002 | |
| COG0576 | 193 | COG0576, GrpE, Molecular chaperone GrpE (heat shoc | 0.002 | |
| PRK02363 | 129 | PRK02363, PRK02363, DNA-directed RNA polymerase su | 0.002 | |
| PRK02363 | 129 | PRK02363, PRK02363, DNA-directed RNA polymerase su | 0.002 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.002 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.002 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 0.002 | |
| TIGR01651 | 600 | TIGR01651, CobT, cobaltochelatase, CobT subunit | 0.002 | |
| cd02988 | 192 | cd02988, Phd_like_VIAF, Phosducin (Phd)-like famil | 0.002 | |
| pfam09073 | 424 | pfam09073, BUD22, BUD22 | 0.002 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.002 | |
| TIGR02907 | 338 | TIGR02907, spore_VI_D, stage VI sporulation protei | 0.002 | |
| TIGR02907 | 338 | TIGR02907, spore_VI_D, stage VI sporulation protei | 0.002 | |
| TIGR02907 | 338 | TIGR02907, spore_VI_D, stage VI sporulation protei | 0.002 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.002 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.002 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.002 | |
| pfam05279 | 240 | pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylas | 0.002 | |
| COG2058 | 109 | COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP | 0.002 | |
| COG2058 | 109 | COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP | 0.002 | |
| COG2058 | 109 | COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP | 0.002 | |
| COG2058 | 109 | COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP | 0.002 | |
| COG2058 | 109 | COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP | 0.002 | |
| pfam12253 | 76 | pfam12253, CAF1A, Chromatin assembly factor 1 subu | 0.002 | |
| COG3351 | 214 | COG3351, FlaD, Putative archaeal flagellar protein | 0.002 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.002 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.002 | |
| pfam03343 | 603 | pfam03343, SART-1, SART-1 family | 0.002 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.002 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.002 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.002 | |
| pfam04502 | 321 | pfam04502, DUF572, Family of unknown function (DUF | 0.002 | |
| pfam14283 | 213 | pfam14283, DUF4366, Domain of unknown function (DU | 0.002 | |
| pfam14283 | 213 | pfam14283, DUF4366, Domain of unknown function (DU | 0.002 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 0.002 | |
| PRK02292 | 188 | PRK02292, PRK02292, V-type ATP synthase subunit E; | 0.002 | |
| TIGR03825 | 255 | TIGR03825, FliH_bacil, flagellar assembly protein | 0.002 | |
| pfam05835 | 139 | pfam05835, Synaphin, Synaphin protein | 0.002 | |
| COG5167 | 776 | COG5167, VID27, Protein involved in vacuole import | 0.002 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 0.002 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 0.002 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 0.002 | |
| PRK14150 | 193 | PRK14150, PRK14150, heat shock protein GrpE; Provi | 0.002 | |
| pfam00769 | 244 | pfam00769, ERM, Ezrin/radixin/moesin family | 0.002 | |
| pfam00769 | 244 | pfam00769, ERM, Ezrin/radixin/moesin family | 0.002 | |
| pfam00769 | 244 | pfam00769, ERM, Ezrin/radixin/moesin family | 0.002 | |
| pfam00769 | 244 | pfam00769, ERM, Ezrin/radixin/moesin family | 0.002 | |
| pfam09110 | 109 | pfam09110, HAND, HAND | 0.002 | |
| PRK14156 | 177 | PRK14156, PRK14156, heat shock protein GrpE; Provi | 0.002 | |
| PRK14156 | 177 | PRK14156, PRK14156, heat shock protein GrpE; Provi | 0.002 | |
| PRK14156 | 177 | PRK14156, PRK14156, heat shock protein GrpE; Provi | 0.002 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 0.002 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 0.002 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 0.002 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 0.002 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 0.002 | |
| TIGR01554 | 384 | TIGR01554, major_cap_HK97, phage major capsid prot | 0.002 | |
| TIGR01554 | 384 | TIGR01554, major_cap_HK97, phage major capsid prot | 0.002 | |
| PRK09202 | 470 | PRK09202, nusA, transcription elongation factor Nu | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05306 | 746 | PRK05306, infB, translation initiation factor IF-2 | 0.002 | |
| PRK05306 | 746 | PRK05306, infB, translation initiation factor IF-2 | 0.002 | |
| pfam13025 | 70 | pfam13025, DUF3886, Protein of unknown function (D | 0.002 | |
| pfam13025 | 70 | pfam13025, DUF3886, Protein of unknown function (D | 0.002 | |
| pfam13025 | 70 | pfam13025, DUF3886, Protein of unknown function (D | 0.002 | |
| pfam13025 | 70 | pfam13025, DUF3886, Protein of unknown function (D | 0.002 | |
| pfam10211 | 189 | pfam10211, Ax_dynein_light, Axonemal dynein light | 0.002 | |
| COG1667 | 254 | COG1667, COG1667, Uncharacterized protein conserve | 0.002 | |
| pfam12757 | 126 | pfam12757, DUF3812, Protein of unknown function (D | 0.002 | |
| pfam12757 | 126 | pfam12757, DUF3812, Protein of unknown function (D | 0.002 | |
| pfam12757 | 126 | pfam12757, DUF3812, Protein of unknown function (D | 0.002 | |
| PRK04456 | 463 | PRK04456, PRK04456, acetyl-CoA decarbonylase/synth | 0.002 | |
| PRK14149 | 191 | PRK14149, PRK14149, heat shock protein GrpE; Provi | 0.002 | |
| PRK14149 | 191 | PRK14149, PRK14149, heat shock protein GrpE; Provi | 0.002 | |
| pfam05395 | 170 | pfam05395, DARPP-32, Protein phosphatase inhibitor | 0.002 | |
| PHA02608 | 80 | PHA02608, 67, prohead core protein; Provisional | 0.002 | |
| PHA02608 | 80 | PHA02608, 67, prohead core protein; Provisional | 0.002 | |
| PHA02608 | 80 | PHA02608, 67, prohead core protein; Provisional | 0.002 | |
| PHA02608 | 80 | PHA02608, 67, prohead core protein; Provisional | 0.002 | |
| pfam05558 | 201 | pfam05558, DREPP, DREPP plasma membrane polypeptid | 0.002 | |
| pfam12720 | 169 | pfam12720, DUF3807, Protein of unknown function (D | 0.002 | |
| pfam03032 | 46 | pfam03032, Brevenin, Brevenin/esculentin/gaegurin/ | 0.002 | |
| pfam03032 | 46 | pfam03032, Brevenin, Brevenin/esculentin/gaegurin/ | 0.002 | |
| pfam03032 | 46 | pfam03032, Brevenin, Brevenin/esculentin/gaegurin/ | 0.002 | |
| pfam03032 | 46 | pfam03032, Brevenin, Brevenin/esculentin/gaegurin/ | 0.002 | |
| pfam03032 | 46 | pfam03032, Brevenin, Brevenin/esculentin/gaegurin/ | 0.002 | |
| pfam03032 | 46 | pfam03032, Brevenin, Brevenin/esculentin/gaegurin/ | 0.002 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 0.002 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 0.002 | |
| pfam12527 | 100 | pfam12527, DUF3727, Protein of unknown function (D | 0.002 | |
| PRK14520 | 155 | PRK14520, rpsP, 30S ribosomal protein S16; Provisi | 0.002 | |
| pfam05178 | 99 | pfam05178, Kri1, KRI1-like family | 0.002 | |
| pfam13300 | 88 | pfam13300, DUF4078, Domain of unknown function (DU | 0.002 | |
| pfam03286 | 198 | pfam03286, Pox_Ag35, Pox virus Ag35 surface protei | 0.002 | |
| cd09277 | 133 | cd09277, RNase_HI_bacteria_HBD, Bacterial RNase HI | 0.002 | |
| pfam14303 | 147 | pfam14303, NAM-associated, No apical meristem-asso | 0.002 | |
| pfam04702 | 147 | pfam04702, Vicilin_N, Vicilin N terminal region | 0.002 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 0.003 | |
| COG5137 | 279 | COG5137, COG5137, Histone chaperone involved in ge | 0.003 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.003 | |
| pfam04006 | 613 | pfam04006, Mpp10, Mpp10 protein | 0.003 | |
| pfam04006 | 613 | pfam04006, Mpp10, Mpp10 protein | 0.003 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 0.003 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.003 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.003 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 0.003 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 0.003 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 0.003 | |
| pfam01271 | 585 | pfam01271, Granin, Granin (chromogranin or secreto | 0.003 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 0.003 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.003 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.003 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.003 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.003 | |
| PRK14521 | 186 | PRK14521, rpsP, 30S ribosomal protein S16; Provisi | 0.003 | |
| pfam05279 | 240 | pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylas | 0.003 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.003 | |
| COG2058 | 109 | COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP | 0.003 | |
| pfam12253 | 76 | pfam12253, CAF1A, Chromatin assembly factor 1 subu | 0.003 | |
| pfam12253 | 76 | pfam12253, CAF1A, Chromatin assembly factor 1 subu | 0.003 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.003 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.003 | |
| pfam04502 | 321 | pfam04502, DUF572, Family of unknown function (DUF | 0.003 | |
| PRK14150 | 193 | PRK14150, PRK14150, heat shock protein GrpE; Provi | 0.003 | |
| pfam00769 | 244 | pfam00769, ERM, Ezrin/radixin/moesin family | 0.003 | |
| pfam00769 | 244 | pfam00769, ERM, Ezrin/radixin/moesin family | 0.003 | |
| pfam00769 | 244 | pfam00769, ERM, Ezrin/radixin/moesin family | 0.003 | |
| COG1614 | 470 | COG1614, CdhC, CO dehydrogenase/acetyl-CoA synthas | 0.003 | |
| COG2433 | 652 | COG2433, COG2433, Uncharacterized conserved protei | 0.003 | |
| pfam07222 | 243 | pfam07222, PBP_sp32, Proacrosin binding protein sp | 0.003 | |
| TIGR01554 | 384 | TIGR01554, major_cap_HK97, phage major capsid prot | 0.003 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.003 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.003 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.003 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.003 | |
| pfam00428 | 88 | pfam00428, Ribosomal_60s, 60s Acidic ribosomal pro | 0.003 | |
| PRK05306 | 746 | PRK05306, infB, translation initiation factor IF-2 | 0.003 | |
| TIGR01069 | 771 | TIGR01069, mutS2, MutS2 family protein | 0.003 | |
| pfam12757 | 126 | pfam12757, DUF3812, Protein of unknown function (D | 0.003 | |
| PRK05657 | 325 | PRK05657, PRK05657, RNA polymerase sigma factor Rp | 0.003 | |
| PRK05657 | 325 | PRK05657, PRK05657, RNA polymerase sigma factor Rp | 0.003 | |
| PLN00152 | 130 | PLN00152, PLN00152, DNA-directed RNA polymerase; P | 0.003 | |
| pfam02841 | 297 | pfam02841, GBP_C, Guanylate-binding protein, C-ter | 0.003 | |
| COG5163 | 591 | COG5163, NOP7, Protein required for biogenesis of | 0.003 | |
| PRK04456 | 463 | PRK04456, PRK04456, acetyl-CoA decarbonylase/synth | 0.003 | |
| PRK14520 | 155 | PRK14520, rpsP, 30S ribosomal protein S16; Provisi | 0.003 | |
| pfam03286 | 198 | pfam03286, Pox_Ag35, Pox virus Ag35 surface protei | 0.003 | |
| pfam14303 | 147 | pfam14303, NAM-associated, No apical meristem-asso | 0.003 | |
| pfam04702 | 147 | pfam04702, Vicilin_N, Vicilin N terminal region | 0.003 | |
| pfam04281 | 136 | pfam04281, Tom22, Mitochondrial import receptor su | 0.003 | |
| cd09280 | 150 | cd09280, RNase_HI_eukaryote_like, Eukaryotic RNase | 0.003 | |
| COG2268 | 548 | COG2268, COG2268, Uncharacterized protein conserve | 0.003 | |
| pfam09845 | 121 | pfam09845, DUF2072, Zn-ribbon containing protein ( | 0.003 | |
| COG0711 | 161 | COG0711, AtpF, F0F1-type ATP synthase, subunit b [ | 0.003 | |
| pfam11719 | 397 | pfam11719, Drc1-Sld2, DNA replication and checkpoi | 0.003 | |
| PRK12766 | 232 | PRK12766, PRK12766, 50S ribosomal protein L32e; Pr | 0.003 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 0.004 | |
| pfam02029 | 431 | pfam02029, Caldesmon, Caldesmon | 0.004 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 0.004 | |
| PLN03142 | 1033 | PLN03142, PLN03142, Probable chromatin-remodeling | 0.004 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.004 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.004 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 0.004 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 0.004 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 0.004 | |
| PTZ00438 | 374 | PTZ00438, PTZ00438, gamete antigen 27/25-like prot | 0.004 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 0.004 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 0.004 | |
| PTZ00423 | 193 | PTZ00423, PTZ00423, glideosome-associated protein | 0.004 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 0.004 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.004 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.004 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.004 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.004 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.004 | |
| pfam05279 | 240 | pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylas | 0.004 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.004 | |
| pfam12253 | 76 | pfam12253, CAF1A, Chromatin assembly factor 1 subu | 0.004 | |
| pfam12253 | 76 | pfam12253, CAF1A, Chromatin assembly factor 1 subu | 0.004 | |
| pfam12253 | 76 | pfam12253, CAF1A, Chromatin assembly factor 1 subu | 0.004 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.004 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.004 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.004 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.004 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.004 | |
| pfam04502 | 321 | pfam04502, DUF572, Family of unknown function (DUF | 0.004 | |
| pfam12619 | 145 | pfam12619, MCM2_N, Mini-chromosome maintenance pro | 0.004 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 0.004 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 0.004 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 0.004 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 0.004 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 0.004 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 0.004 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 0.004 | |
| pfam00769 | 244 | pfam00769, ERM, Ezrin/radixin/moesin family | 0.004 | |
| TIGR03779 | 410 | TIGR03779, Bac_Flav_CT_M, Bacteroides conjugative | 0.004 | |
| pfam12446 | 133 | pfam12446, DUF3682, Protein of unknown function (D | 0.004 | |
| pfam12446 | 133 | pfam12446, DUF3682, Protein of unknown function (D | 0.004 | |
| pfam05340 | 565 | pfam05340, DUF740, Protein of unknown function (DU | 0.004 | |
| COG1390 | 194 | COG1390, NtpE, Archaeal/vacuolar-type H+-ATPase su | 0.004 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.004 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.004 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.004 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.004 | |
| pfam13025 | 70 | pfam13025, DUF3886, Protein of unknown function (D | 0.004 | |
| pfam13025 | 70 | pfam13025, DUF3886, Protein of unknown function (D | 0.004 | |
| pfam13025 | 70 | pfam13025, DUF3886, Protein of unknown function (D | 0.004 | |
| PRK05657 | 325 | PRK05657, PRK05657, RNA polymerase sigma factor Rp | 0.004 | |
| PRK05657 | 325 | PRK05657, PRK05657, RNA polymerase sigma factor Rp | 0.004 | |
| pfam02841 | 297 | pfam02841, GBP_C, Guanylate-binding protein, C-ter | 0.004 | |
| COG5163 | 591 | COG5163, NOP7, Protein required for biogenesis of | 0.004 | |
| COG5163 | 591 | COG5163, NOP7, Protein required for biogenesis of | 0.004 | |
| PRK04456 | 463 | PRK04456, PRK04456, acetyl-CoA decarbonylase/synth | 0.004 | |
| PHA02608 | 80 | PHA02608, 67, prohead core protein; Provisional | 0.004 | |
| pfam05558 | 201 | pfam05558, DREPP, DREPP plasma membrane polypeptid | 0.004 | |
| pfam03032 | 46 | pfam03032, Brevenin, Brevenin/esculentin/gaegurin/ | 0.004 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 0.004 | |
| PRK14520 | 155 | PRK14520, rpsP, 30S ribosomal protein S16; Provisi | 0.004 | |
| pfam04702 | 147 | pfam04702, Vicilin_N, Vicilin N terminal region | 0.004 | |
| pfam04702 | 147 | pfam04702, Vicilin_N, Vicilin N terminal region | 0.004 | |
| pfam04281 | 136 | pfam04281, Tom22, Mitochondrial import receptor su | 0.004 | |
| COG2268 | 548 | COG2268, COG2268, Uncharacterized protein conserve | 0.004 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 0.004 | |
| TIGR02031 | 589 | TIGR02031, BchD-ChlD, magnesium chelatase ATPase s | 0.004 | |
| COG5019 | 373 | COG5019, CDC3, Septin family protein [Cell divisio | 0.004 | |
| TIGR00600 | 1034 | TIGR00600, rad2, DNA excision repair protein (rad2 | 0.004 | |
| pfam05470 | 593 | pfam05470, eIF-3c_N, Eukaryotic translation initia | 0.004 | |
| PHA03089 | 191 | PHA03089, PHA03089, late transcription factor VLTF | 0.004 | |
| pfam05914 | 379 | pfam05914, RIB43A, RIB43A | 0.004 | |
| PRK14715 | 1627 | PRK14715, PRK14715, DNA polymerase II large subuni | 0.004 | |
| smart00937 | 116 | smart00937, PCRF, This domain is found in peptide | 0.004 |
| >gnl|CDD|187700 cd09276, Rnase_HI_RT_non_LTR, non-LTR RNase HI domain of reverse transcriptases | Back alignment and domain information |
|---|
Score = 116 bits (292), Expect = 1e-30
Identities = 44/124 (35%), Positives = 63/124 (50%), Gaps = 5/124 (4%)
Query: 330 ICYTDGSKTPTTTGCAYSV---GNVVRSTLLNPVNSIFSAELIAIFLCLEAILDSPSG-- 384
+ YTDGSK TG +++ G + RS L P S+F AEL+AI L+ L
Sbjct: 1 VIYTDGSKLEGRTGAGFAIVRKGTISRSYKLGPYCSVFDAELLAILEALQLALREGRRAR 60
Query: 385 KFLIVTDSRSSLAALSNVRFINPLITKVYSTWSYLKLCKKDITFMWCPSHCGIKGNEIVD 444
K I +DS+++L AL + R +PL+ ++ L + W P H GI+GNE D
Sbjct: 61 KITIFSDSQAALKALRSPRSSSPLVLRIRKAIRELANHGVKVRLHWVPGHSGIEGNERAD 120
Query: 445 VAAK 448
AK
Sbjct: 121 RLAK 124
|
Ribonuclease H (RNase H) is classified into two families, type 1 (prokaryotic RNase HI, eukaryotic RNase H1 and viral RNase H) and type 2 (prokaryotic RNase HII and HIII, and eukaryotic RNase H2). Ribonuclease HI (RNase HI) is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a sequence non-specific manner. RNase H is widely present in various organisms, including bacteria, archaea and eukaryotes. RNase HI has also been observed as an adjunct domain to the reverse transcriptase gene in retroviruses, long-term repeat (LTR)-bearing retrotransposons and non-LTR retrotransposons. RNase HI in LTR retrotransposons perform degradation of the original RNA template, generation of a polypurine tract (the primer for plus-strand DNA synthesis), and final removal of RNA primers from newly synthesized minus and plus strands. The catalytic residues for RNase H enzymatic activity, three aspartatic acids and one glutamatic acid residue (DEDD), are unvaried across all RNase H domains. The position of the RNase domain of non-LTR and LTR transposons is at the carboxyl terminal of the reverse transcriptase (RT) domain and their RNase domains group together, indicating a common evolutionary origin. Many non-LTR transposons have lost the RNase domain because their activity is at the nucleus and cellular RNase may suffice; however LTR retotransposons always encode their own RNase domain because it requires RNase activity in RNA-protein particles in the cytoplasm. RNase H inhibitors have been explored as an anti-HIV drug target because RNase H inactivation inhibits reverse transcription. Length = 128 |
| >gnl|CDD|215695 pfam00075, RNase_H, RNase H | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|148630 pfam07133, Merozoite_SPAM, Merozoite surface protein (SPAM) | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|184885 PRK14891, PRK14891, 50S ribosomal protein L24e/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|184885 PRK14891, PRK14891, 50S ribosomal protein L24e/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|184885 PRK14891, PRK14891, 50S ribosomal protein L24e/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|184885 PRK14891, PRK14891, 50S ribosomal protein L24e/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|184885 PRK14891, PRK14891, 50S ribosomal protein L24e/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|184885 PRK14891, PRK14891, 50S ribosomal protein L24e/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184885 PRK14891, PRK14891, 50S ribosomal protein L24e/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220377 pfam09747, DUF2052, Coiled-coil domain containing protein (DUF2052) | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family | Back alignment and domain information |
|---|
| >gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family | Back alignment and domain information |
|---|
| >gnl|CDD|220377 pfam09747, DUF2052, Coiled-coil domain containing protein (DUF2052) | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|148630 pfam07133, Merozoite_SPAM, Merozoite surface protein (SPAM) | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218684 pfam05672, MAP7, MAP7 (E-MAP-115) family | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon | Back alignment and domain information |
|---|
| >gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family | Back alignment and domain information |
|---|
| >gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218258 pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA binding family | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein | Back alignment and domain information |
|---|
| >gnl|CDD|187700 cd09276, Rnase_HI_RT_non_LTR, non-LTR RNase HI domain of reverse transcriptases | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|148630 pfam07133, Merozoite_SPAM, Merozoite surface protein (SPAM) | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon | Back alignment and domain information |
|---|
| >gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon | Back alignment and domain information |
|---|
| >gnl|CDD|220377 pfam09747, DUF2052, Coiled-coil domain containing protein (DUF2052) | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|227701 COG5414, COG5414, TATA-binding protein-associated factor [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|114172 pfam05432, BSP_II, Bone sialoprotein II (BSP-II) | Back alignment and domain information |
|---|
| >gnl|CDD|227466 COG5137, COG5137, Histone chaperone involved in gene silencing [Transcription / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|187697 cd09273, RNase_HI_RT_Bel, Bel/Pao family of RNase HI in long-term repeat retroelements | Back alignment and domain information |
|---|
| >gnl|CDD|187690 cd06222, RNase_H, RNase H is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a sequence non-specific manner | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|218258 pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA binding family | Back alignment and domain information |
|---|
| >gnl|CDD|225368 COG2811, NtpF, Archaeal/vacuolar-type H+-ATPase subunit H [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|184885 PRK14891, PRK14891, 50S ribosomal protein L24e/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|220377 pfam09747, DUF2052, Coiled-coil domain containing protein (DUF2052) | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family | Back alignment and domain information |
|---|
| >gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|218258 pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA binding family | Back alignment and domain information |
|---|
| >gnl|CDD|222571 pfam14153, Spore_coat_CotO, Spore coat protein CotO | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|225880 COG3343, RpoE, DNA-directed RNA polymerase, delta subunit [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|218684 pfam05672, MAP7, MAP7 (E-MAP-115) family | Back alignment and domain information |
|---|
| >gnl|CDD|218258 pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA binding family | Back alignment and domain information |
|---|
| >gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|218684 pfam05672, MAP7, MAP7 (E-MAP-115) family | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|222571 pfam14153, Spore_coat_CotO, Spore coat protein CotO | Back alignment and domain information |
|---|
| >gnl|CDD|225880 COG3343, RpoE, DNA-directed RNA polymerase, delta subunit [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|184885 PRK14891, PRK14891, 50S ribosomal protein L24e/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|220377 pfam09747, DUF2052, Coiled-coil domain containing protein (DUF2052) | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|218684 pfam05672, MAP7, MAP7 (E-MAP-115) family | Back alignment and domain information |
|---|
| >gnl|CDD|218684 pfam05672, MAP7, MAP7 (E-MAP-115) family | Back alignment and domain information |
|---|
| >gnl|CDD|218258 pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA binding family | Back alignment and domain information |
|---|
| >gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|222571 pfam14153, Spore_coat_CotO, Spore coat protein CotO | Back alignment and domain information |
|---|
| >gnl|CDD|222571 pfam14153, Spore_coat_CotO, Spore coat protein CotO | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|220413 pfam09805, Nop25, Nucleolar protein 12 (25kDa) | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon | Back alignment and domain information |
|---|
| >gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|218684 pfam05672, MAP7, MAP7 (E-MAP-115) family | Back alignment and domain information |
|---|
| >gnl|CDD|218258 pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA binding family | Back alignment and domain information |
|---|
| >gnl|CDD|222571 pfam14153, Spore_coat_CotO, Spore coat protein CotO | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|220413 pfam09805, Nop25, Nucleolar protein 12 (25kDa) | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|220377 pfam09747, DUF2052, Coiled-coil domain containing protein (DUF2052) | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|222571 pfam14153, Spore_coat_CotO, Spore coat protein CotO | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|221333 pfam11942, Spt5_N, Spt5 transcription elongation factor, acidic N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|183610 PRK12585, PRK12585, putative monovalent cation/H+ antiporter subunit G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|220377 pfam09747, DUF2052, Coiled-coil domain containing protein (DUF2052) | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|227466 COG5137, COG5137, Histone chaperone involved in gene silencing [Transcription / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|222571 pfam14153, Spore_coat_CotO, Spore coat protein CotO | Back alignment and domain information |
|---|
| >gnl|CDD|220413 pfam09805, Nop25, Nucleolar protein 12 (25kDa) | Back alignment and domain information |
|---|
| >gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183610 PRK12585, PRK12585, putative monovalent cation/H+ antiporter subunit G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222792 PHA00435, PHA00435, capsid assembly protein | Back alignment and domain information |
|---|
| >gnl|CDD|184885 PRK14891, PRK14891, 50S ribosomal protein L24e/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|221333 pfam11942, Spt5_N, Spt5 transcription elongation factor, acidic N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|222792 PHA00435, PHA00435, capsid assembly protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) | Back alignment and domain information |
|---|
| >gnl|CDD|220377 pfam09747, DUF2052, Coiled-coil domain containing protein (DUF2052) | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|222571 pfam14153, Spore_coat_CotO, Spore coat protein CotO | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|223649 COG0576, GrpE, Molecular chaperone GrpE (heat shock protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|218684 pfam05672, MAP7, MAP7 (E-MAP-115) family | Back alignment and domain information |
|---|
| >gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220413 pfam09805, Nop25, Nucleolar protein 12 (25kDa) | Back alignment and domain information |
|---|
| >gnl|CDD|220413 pfam09805, Nop25, Nucleolar protein 12 (25kDa) | Back alignment and domain information |
|---|
| >gnl|CDD|220413 pfam09805, Nop25, Nucleolar protein 12 (25kDa) | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|221333 pfam11942, Spt5_N, Spt5 transcription elongation factor, acidic N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223649 COG0576, GrpE, Molecular chaperone GrpE (heat shock protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|223649 COG0576, GrpE, Molecular chaperone GrpE (heat shock protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|220284 pfam09538, FYDLN_acid, Protein of unknown function (FYDLN_acid) | Back alignment and domain information |
|---|
| >gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi | Back alignment and domain information |
|---|
| >gnl|CDD|131972 TIGR02926, AhaH, ATP synthase archaeal, H subunit | Back alignment and domain information |
|---|
| >gnl|CDD|235033 PRK02363, PRK02363, DNA-directed RNA polymerase subunit delta; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|184885 PRK14891, PRK14891, 50S ribosomal protein L24e/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|220377 pfam09747, DUF2052, Coiled-coil domain containing protein (DUF2052) | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|218258 pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA binding family | Back alignment and domain information |
|---|
| >gnl|CDD|218258 pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA binding family | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|222571 pfam14153, Spore_coat_CotO, Spore coat protein CotO | Back alignment and domain information |
|---|
| >gnl|CDD|225880 COG3343, RpoE, DNA-directed RNA polymerase, delta subunit [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220284 pfam09538, FYDLN_acid, Protein of unknown function (FYDLN_acid) | Back alignment and domain information |
|---|
| >gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|221203 pfam11748, DUF3306, Protein of unknown function (DUF3306) | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|215695 pfam00075, RNase_H, RNase H | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|184885 PRK14891, PRK14891, 50S ribosomal protein L24e/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184885 PRK14891, PRK14891, 50S ribosomal protein L24e/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227466 COG5137, COG5137, Histone chaperone involved in gene silencing [Transcription / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|220413 pfam09805, Nop25, Nucleolar protein 12 (25kDa) | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) | Back alignment and domain information |
|---|
| >gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|185618 PTZ00438, PTZ00438, gamete antigen 27/25-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|227563 COG5238, RNA1, Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >gnl|CDD|220135 pfam09184, PPP4R2, PPP4R2 | Back alignment and domain information |
|---|
| >gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon | Back alignment and domain information |
|---|
| >gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|221333 pfam11942, Spt5_N, Spt5 transcription elongation factor, acidic N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon | Back alignment and domain information |
|---|
| >gnl|CDD|218684 pfam05672, MAP7, MAP7 (E-MAP-115) family | Back alignment and domain information |
|---|
| >gnl|CDD|218258 pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA binding family | Back alignment and domain information |
|---|
| >gnl|CDD|114172 pfam05432, BSP_II, Bone sialoprotein II (BSP-II) | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi | Back alignment and domain information |
|---|
| >gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|220135 pfam09184, PPP4R2, PPP4R2 | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|227458 COG5129, MAK16, Nuclear protein with HMG-like acidic region [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|216403 pfam01271, Granin, Granin (chromogranin or secretogranin) | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|183610 PRK12585, PRK12585, putative monovalent cation/H+ antiporter subunit G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|220135 pfam09184, PPP4R2, PPP4R2 | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|130712 TIGR01651, CobT, cobaltochelatase, CobT subunit | Back alignment and domain information |
|---|
| >gnl|CDD|240413 PTZ00423, PTZ00423, glideosome-associated protein 45; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220371 pfam09736, Bud13, Pre-mRNA-splicing factor of RES complex | Back alignment and domain information |
|---|
| >gnl|CDD|218684 pfam05672, MAP7, MAP7 (E-MAP-115) family | Back alignment and domain information |
|---|
| >gnl|CDD|222571 pfam14153, Spore_coat_CotO, Spore coat protein CotO | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|184885 PRK14891, PRK14891, 50S ribosomal protein L24e/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|225880 COG3343, RpoE, DNA-directed RNA polymerase, delta subunit [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|239286 cd02988, Phd_like_VIAF, Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|148630 pfam07133, Merozoite_SPAM, Merozoite surface protein (SPAM) | Back alignment and domain information |
|---|
| >gnl|CDD|148630 pfam07133, Merozoite_SPAM, Merozoite surface protein (SPAM) | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon | Back alignment and domain information |
|---|
| >gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|227701 COG5414, COG5414, TATA-binding protein-associated factor [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|227466 COG5137, COG5137, Histone chaperone involved in gene silencing [Transcription / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225880 COG3343, RpoE, DNA-directed RNA polymerase, delta subunit [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|183610 PRK12585, PRK12585, putative monovalent cation/H+ antiporter subunit G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) | Back alignment and domain information |
|---|
| >gnl|CDD|222792 PHA00435, PHA00435, capsid assembly protein | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) | Back alignment and domain information |
|---|
| >gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi | Back alignment and domain information |
|---|
| >gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi | Back alignment and domain information |
|---|
| >gnl|CDD|235033 PRK02363, PRK02363, DNA-directed RNA polymerase subunit delta; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|130712 TIGR01651, CobT, cobaltochelatase, CobT subunit | Back alignment and domain information |
|---|
| >gnl|CDD|220102 pfam09073, BUD22, BUD22 | Back alignment and domain information |
|---|
| >gnl|CDD|235850 PRK06669, fliH, flagellar assembly protein H; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|219256 pfam06991, Prp19_bind, Splicing factor, Prp19-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|219256 pfam06991, Prp19_bind, Splicing factor, Prp19-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|219256 pfam06991, Prp19_bind, Splicing factor, Prp19-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234055 TIGR02907, spore_VI_D, stage VI sporulation protein D | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227466 COG5137, COG5137, Histone chaperone involved in gene silencing [Transcription / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225880 COG3343, RpoE, DNA-directed RNA polymerase, delta subunit [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) | Back alignment and domain information |
|---|
| >gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222792 PHA00435, PHA00435, capsid assembly protein | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|130712 TIGR01651, CobT, cobaltochelatase, CobT subunit | Back alignment and domain information |
|---|
| >gnl|CDD|130712 TIGR01651, CobT, cobaltochelatase, CobT subunit | Back alignment and domain information |
|---|
| >gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|239286 cd02988, Phd_like_VIAF, Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|235668 PRK06007, fliF, flagellar MS-ring protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237744 PRK14521, rpsP, 30S ribosomal protein S16; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|169428 PRK08404, PRK08404, V-type ATP synthase subunit H; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|191249 pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylase N-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|221250 pfam11831, Myb_Cef, pre-mRNA splicing factor component | Back alignment and domain information |
|---|
| >gnl|CDD|221250 pfam11831, Myb_Cef, pre-mRNA splicing factor component | Back alignment and domain information |
|---|
| >gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|218684 pfam05672, MAP7, MAP7 (E-MAP-115) family | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|183610 PRK12585, PRK12585, putative monovalent cation/H+ antiporter subunit G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|222792 PHA00435, PHA00435, capsid assembly protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) | Back alignment and domain information |
|---|
| >gnl|CDD|223649 COG0576, GrpE, Molecular chaperone GrpE (heat shock protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|185618 PTZ00438, PTZ00438, gamete antigen 27/25-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|227563 COG5238, RNA1, Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|239286 cd02988, Phd_like_VIAF, Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221250 pfam11831, Myb_Cef, pre-mRNA splicing factor component | Back alignment and domain information |
|---|
| >gnl|CDD|221250 pfam11831, Myb_Cef, pre-mRNA splicing factor component | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|221490 pfam12253, CAF1A, Chromatin assembly factor 1 subunit A | Back alignment and domain information |
|---|
| >gnl|CDD|225887 COG3351, FlaD, Putative archaeal flagellar protein D/E [Cell motility and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|237047 PRK12298, obgE, GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|220102 pfam09073, BUD22, BUD22 | Back alignment and domain information |
|---|
| >gnl|CDD|234055 TIGR02907, spore_VI_D, stage VI sporulation protein D | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|225887 COG3351, FlaD, Putative archaeal flagellar protein D/E [Cell motility and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217502 pfam03343, SART-1, SART-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|218684 pfam05672, MAP7, MAP7 (E-MAP-115) family | Back alignment and domain information |
|---|
| >gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi | Back alignment and domain information |
|---|
| >gnl|CDD|131972 TIGR02926, AhaH, ATP synthase archaeal, H subunit | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|220135 pfam09184, PPP4R2, PPP4R2 | Back alignment and domain information |
|---|
| >gnl|CDD|240413 PTZ00423, PTZ00423, glideosome-associated protein 45; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|237047 PRK12298, obgE, GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|219069 pfam06512, Na_trans_assoc, Sodium ion transport-associated | Back alignment and domain information |
|---|
| >gnl|CDD|214818 smart00784, SPT2, SPT2 chromatin protein | Back alignment and domain information |
|---|
| >gnl|CDD|218115 pfam04502, DUF572, Family of unknown function (DUF572) | Back alignment and domain information |
|---|
| >gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|214818 smart00784, SPT2, SPT2 chromatin protein | Back alignment and domain information |
|---|
| >gnl|CDD|220376 pfam09745, DUF2040, Coiled-coil domain-containing protein 55 (DUF2040) | Back alignment and domain information |
|---|
| >gnl|CDD|222648 pfam14283, DUF4366, Domain of unknown function (DUF4366) | Back alignment and domain information |
|---|
| >gnl|CDD|221668 pfam12619, MCM2_N, Mini-chromosome maintenance protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|224236 COG1317, FliH, Flagellar biosynthesis/type III secretory pathway protein [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227466 COG5137, COG5137, Histone chaperone involved in gene silencing [Transcription / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|225368 COG2811, NtpF, Archaeal/vacuolar-type H+-ATPase subunit H [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|220413 pfam09805, Nop25, Nucleolar protein 12 (25kDa) | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|223649 COG0576, GrpE, Molecular chaperone GrpE (heat shock protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221203 pfam11748, DUF3306, Protein of unknown function (DUF3306) | Back alignment and domain information |
|---|
| >gnl|CDD|221203 pfam11748, DUF3306, Protein of unknown function (DUF3306) | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|237047 PRK12298, obgE, GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|235026 PRK02292, PRK02292, V-type ATP synthase subunit E; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234366 TIGR03825, FliH_bacil, flagellar assembly protein FliH | Back alignment and domain information |
|---|
| >gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein | Back alignment and domain information |
|---|
| >gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|220102 pfam09073, BUD22, BUD22 | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|237047 PRK12298, obgE, GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|217502 pfam03343, SART-1, SART-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|218771 pfam05835, Synaphin, Synaphin protein | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|218258 pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA binding family | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) | Back alignment and domain information |
|---|
| >gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|191249 pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylase N-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|227496 COG5167, VID27, Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|227466 COG5137, COG5137, Histone chaperone involved in gene silencing [Transcription / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein | Back alignment and domain information |
|---|
| >gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|220413 pfam09805, Nop25, Nucleolar protein 12 (25kDa) | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|222792 PHA00435, PHA00435, capsid assembly protein | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) | Back alignment and domain information |
|---|
| >gnl|CDD|223649 COG0576, GrpE, Molecular chaperone GrpE (heat shock protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|130712 TIGR01651, CobT, cobaltochelatase, CobT subunit | Back alignment and domain information |
|---|
| >gnl|CDD|130712 TIGR01651, CobT, cobaltochelatase, CobT subunit | Back alignment and domain information |
|---|
| >gnl|CDD|220102 pfam09073, BUD22, BUD22 | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|191249 pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylase N-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|221250 pfam11831, Myb_Cef, pre-mRNA splicing factor component | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|217502 pfam03343, SART-1, SART-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|222648 pfam14283, DUF4366, Domain of unknown function (DUF4366) | Back alignment and domain information |
|---|
| >gnl|CDD|222648 pfam14283, DUF4366, Domain of unknown function (DUF4366) | Back alignment and domain information |
|---|
| >gnl|CDD|221668 pfam12619, MCM2_N, Mini-chromosome maintenance protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|184539 PRK14150, PRK14150, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family | Back alignment and domain information |
|---|
| >gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family | Back alignment and domain information |
|---|
| >gnl|CDD|224530 COG1614, CdhC, CO dehydrogenase/acetyl-CoA synthase beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|235562 PRK05687, fliH, flagellar assembly protein H; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|234352 TIGR03779, Bac_Flav_CT_M, Bacteroides conjugative transposon TraM protein | Back alignment and domain information |
|---|
| >gnl|CDD|221429 pfam12118, SprA-related, SprA-related family | Back alignment and domain information |
|---|
| >gnl|CDD|220112 pfam09110, HAND, HAND | Back alignment and domain information |
|---|
| >gnl|CDD|237628 PRK14156, PRK14156, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|227466 COG5137, COG5137, Histone chaperone involved in gene silencing [Transcription / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein | Back alignment and domain information |
|---|
| >gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein | Back alignment and domain information |
|---|
| >gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein | Back alignment and domain information |
|---|
| >gnl|CDD|183610 PRK12585, PRK12585, putative monovalent cation/H+ antiporter subunit G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|222792 PHA00435, PHA00435, capsid assembly protein | Back alignment and domain information |
|---|
| >gnl|CDD|222792 PHA00435, PHA00435, capsid assembly protein | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|220284 pfam09538, FYDLN_acid, Protein of unknown function (FYDLN_acid) | Back alignment and domain information |
|---|
| >gnl|CDD|220284 pfam09538, FYDLN_acid, Protein of unknown function (FYDLN_acid) | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|185618 PTZ00438, PTZ00438, gamete antigen 27/25-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|130712 TIGR01651, CobT, cobaltochelatase, CobT subunit | Back alignment and domain information |
|---|
| >gnl|CDD|220102 pfam09073, BUD22, BUD22 | Back alignment and domain information |
|---|
| >gnl|CDD|235850 PRK06669, fliH, flagellar assembly protein H; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|237744 PRK14521, rpsP, 30S ribosomal protein S16; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|191249 pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylase N-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|191249 pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylase N-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|221250 pfam11831, Myb_Cef, pre-mRNA splicing factor component | Back alignment and domain information |
|---|
| >gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|222648 pfam14283, DUF4366, Domain of unknown function (DUF4366) | Back alignment and domain information |
|---|
| >gnl|CDD|222648 pfam14283, DUF4366, Domain of unknown function (DUF4366) | Back alignment and domain information |
|---|
| >gnl|CDD|221668 pfam12619, MCM2_N, Mini-chromosome maintenance protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|221668 pfam12619, MCM2_N, Mini-chromosome maintenance protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|227496 COG5167, VID27, Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|184539 PRK14150, PRK14150, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184539 PRK14150, PRK14150, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237628 PRK14156, PRK14156, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237628 PRK14156, PRK14156, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220605 pfam10156, Med17, Subunit 17 of Mediator complex | Back alignment and domain information |
|---|
| >gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|218954 pfam06246, Isy1, Isy1-like splicing family | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|184536 PRK14145, PRK14145, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184536 PRK14145, PRK14145, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221581 pfam12446, DUF3682, Protein of unknown function (DUF3682) | Back alignment and domain information |
|---|
| >gnl|CDD|148682 pfam07222, PBP_sp32, Proacrosin binding protein sp32 | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237258 PRK12903, secA, preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family | Back alignment and domain information |
|---|
| >gnl|CDD|222160 pfam13476, AAA_23, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|236410 PRK09202, nusA, transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236410 PRK09202, nusA, transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|218258 pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA binding family | Back alignment and domain information |
|---|
| >gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|220413 pfam09805, Nop25, Nucleolar protein 12 (25kDa) | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|222792 PHA00435, PHA00435, capsid assembly protein | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|223649 COG0576, GrpE, Molecular chaperone GrpE (heat shock protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|185618 PTZ00438, PTZ00438, gamete antigen 27/25-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234366 TIGR03825, FliH_bacil, flagellar assembly protein FliH | Back alignment and domain information |
|---|
| >gnl|CDD|184539 PRK14150, PRK14150, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224530 COG1614, CdhC, CO dehydrogenase/acetyl-CoA synthase beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|220112 pfam09110, HAND, HAND | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family | Back alignment and domain information |
|---|
| >gnl|CDD|236410 PRK09202, nusA, transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217902 pfam04111, APG6, Autophagy protein Apg6 | Back alignment and domain information |
|---|
| >gnl|CDD|218561 pfam05340, DUF740, Protein of unknown function (DUF740) | Back alignment and domain information |
|---|
| >gnl|CDD|224308 COG1390, NtpE, Archaeal/vacuolar-type H+-ATPase subunit E [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon | Back alignment and domain information |
|---|
| >gnl|CDD|225880 COG3343, RpoE, DNA-directed RNA polymerase, delta subunit [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein | Back alignment and domain information |
|---|
| >gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein | Back alignment and domain information |
|---|
| >gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein | Back alignment and domain information |
|---|
| >gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein | Back alignment and domain information |
|---|
| >gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|185618 PTZ00438, PTZ00438, gamete antigen 27/25-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|240413 PTZ00423, PTZ00423, glideosome-associated protein 45; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240413 PTZ00423, PTZ00423, glideosome-associated protein 45; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|237744 PRK14521, rpsP, 30S ribosomal protein S16; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|191249 pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylase N-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|191249 pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylase N-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|221490 pfam12253, CAF1A, Chromatin assembly factor 1 subunit A | Back alignment and domain information |
|---|
| >gnl|CDD|225887 COG3351, FlaD, Putative archaeal flagellar protein D/E [Cell motility and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|222648 pfam14283, DUF4366, Domain of unknown function (DUF4366) | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|184539 PRK14150, PRK14150, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184536 PRK14145, PRK14145, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|220369 pfam09731, Mitofilin, Mitochondrial inner membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|215914 pfam00428, Ribosomal_60s, 60s Acidic ribosomal protein | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein | Back alignment and domain information |
|---|
| >gnl|CDD|220413 pfam09805, Nop25, Nucleolar protein 12 (25kDa) | Back alignment and domain information |
|---|
| >gnl|CDD|222792 PHA00435, PHA00435, capsid assembly protein | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|185618 PTZ00438, PTZ00438, gamete antigen 27/25-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|220135 pfam09184, PPP4R2, PPP4R2 | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234055 TIGR02907, spore_VI_D, stage VI sporulation protein D | Back alignment and domain information |
|---|
| >gnl|CDD|234055 TIGR02907, spore_VI_D, stage VI sporulation protein D | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|184539 PRK14150, PRK14150, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224530 COG1614, CdhC, CO dehydrogenase/acetyl-CoA synthase beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|237628 PRK14156, PRK14156, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184536 PRK14145, PRK14145, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236410 PRK09202, nusA, transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|218684 pfam05672, MAP7, MAP7 (E-MAP-115) family | Back alignment and domain information |
|---|
| >gnl|CDD|218684 pfam05672, MAP7, MAP7 (E-MAP-115) family | Back alignment and domain information |
|---|
| >gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein | Back alignment and domain information |
|---|
| >gnl|CDD|227466 COG5137, COG5137, Histone chaperone involved in gene silencing [Transcription / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein | Back alignment and domain information |
|---|
| >gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|130712 TIGR01651, CobT, cobaltochelatase, CobT subunit | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|237744 PRK14521, rpsP, 30S ribosomal protein S16; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|191249 pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylase N-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|222648 pfam14283, DUF4366, Domain of unknown function (DUF4366) | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family | Back alignment and domain information |
|---|
| >gnl|CDD|236410 PRK09202, nusA, transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|219761 pfam08243, SPT2, SPT2 chromatin protein | Back alignment and domain information |
|---|
| >gnl|CDD|205206 pfam13025, DUF3886, Protein of unknown function (DUF3886) | Back alignment and domain information |
|---|
| >gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222571 pfam14153, Spore_coat_CotO, Spore coat protein CotO | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|222792 PHA00435, PHA00435, capsid assembly protein | Back alignment and domain information |
|---|
| >gnl|CDD|222792 PHA00435, PHA00435, capsid assembly protein | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|191249 pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylase N-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|191249 pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylase N-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|217502 pfam03343, SART-1, SART-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|221668 pfam12619, MCM2_N, Mini-chromosome maintenance protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family | Back alignment and domain information |
|---|
| >gnl|CDD|224530 COG1614, CdhC, CO dehydrogenase/acetyl-CoA synthase beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|204414 pfam10211, Ax_dynein_light, Axonemal dynein light chain | Back alignment and domain information |
|---|
| >gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|222648 pfam14283, DUF4366, Domain of unknown function (DUF4366) | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family | Back alignment and domain information |
|---|
| >gnl|CDD|220112 pfam09110, HAND, HAND | Back alignment and domain information |
|---|
| >gnl|CDD|218954 pfam06246, Isy1, Isy1-like splicing family | Back alignment and domain information |
|---|
| >gnl|CDD|218561 pfam05340, DUF740, Protein of unknown function (DUF740) | Back alignment and domain information |
|---|
| >gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|202833 pfam03962, Mnd1, Mnd1 family | Back alignment and domain information |
|---|
| >gnl|CDD|214395 CHL00204, ycf1, Ycf1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224581 COG1667, COG1667, Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|221756 pfam12757, DUF3812, Protein of unknown function (DUF3812) | Back alignment and domain information |
|---|
| >gnl|CDD|235548 PRK05657, PRK05657, RNA polymerase sigma factor RpoS; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|177755 PLN00152, PLN00152, DNA-directed RNA polymerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|184536 PRK14145, PRK14145, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220369 pfam09731, Mitofilin, Mitochondrial inner membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|202427 pfam02841, GBP_C, Guanylate-binding protein, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon | Back alignment and domain information |
|---|
| >gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein | Back alignment and domain information |
|---|
| >gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|220284 pfam09538, FYDLN_acid, Protein of unknown function (FYDLN_acid) | Back alignment and domain information |
|---|
| >gnl|CDD|131972 TIGR02926, AhaH, ATP synthase archaeal, H subunit | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|219256 pfam06991, Prp19_bind, Splicing factor, Prp19-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|234055 TIGR02907, spore_VI_D, stage VI sporulation protein D | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|237744 PRK14521, rpsP, 30S ribosomal protein S16; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|191249 pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylase N-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|191249 pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylase N-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|191249 pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylase N-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|221490 pfam12253, CAF1A, Chromatin assembly factor 1 subunit A | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|217502 pfam03343, SART-1, SART-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|218115 pfam04502, DUF572, Family of unknown function (DUF572) | Back alignment and domain information |
|---|
| >gnl|CDD|218115 pfam04502, DUF572, Family of unknown function (DUF572) | Back alignment and domain information |
|---|
| >gnl|CDD|222648 pfam14283, DUF4366, Domain of unknown function (DUF4366) | Back alignment and domain information |
|---|
| >gnl|CDD|222648 pfam14283, DUF4366, Domain of unknown function (DUF4366) | Back alignment and domain information |
|---|
| >gnl|CDD|222648 pfam14283, DUF4366, Domain of unknown function (DUF4366) | Back alignment and domain information |
|---|
| >gnl|CDD|222648 pfam14283, DUF4366, Domain of unknown function (DUF4366) | Back alignment and domain information |
|---|
| >gnl|CDD|222648 pfam14283, DUF4366, Domain of unknown function (DUF4366) | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|227496 COG5167, VID27, Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|184539 PRK14150, PRK14150, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224530 COG1614, CdhC, CO dehydrogenase/acetyl-CoA synthase beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|221429 pfam12118, SprA-related, SprA-related family | Back alignment and domain information |
|---|
| >gnl|CDD|220112 pfam09110, HAND, HAND | Back alignment and domain information |
|---|
| >gnl|CDD|237628 PRK14156, PRK14156, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|184536 PRK14145, PRK14145, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|218561 pfam05340, DUF740, Protein of unknown function (DUF740) | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215914 pfam00428, Ribosomal_60s, 60s Acidic ribosomal protein | Back alignment and domain information |
|---|
| >gnl|CDD|215914 pfam00428, Ribosomal_60s, 60s Acidic ribosomal protein | Back alignment and domain information |
|---|
| >gnl|CDD|215914 pfam00428, Ribosomal_60s, 60s Acidic ribosomal protein | Back alignment and domain information |
|---|
| >gnl|CDD|215914 pfam00428, Ribosomal_60s, 60s Acidic ribosomal protein | Back alignment and domain information |
|---|
| >gnl|CDD|215914 pfam00428, Ribosomal_60s, 60s Acidic ribosomal protein | Back alignment and domain information |
|---|
| >gnl|CDD|215914 pfam00428, Ribosomal_60s, 60s Acidic ribosomal protein | Back alignment and domain information |
|---|
| >gnl|CDD|215914 pfam00428, Ribosomal_60s, 60s Acidic ribosomal protein | Back alignment and domain information |
|---|
| >gnl|CDD|215914 pfam00428, Ribosomal_60s, 60s Acidic ribosomal protein | Back alignment and domain information |
|---|
| >gnl|CDD|205206 pfam13025, DUF3886, Protein of unknown function (DUF3886) | Back alignment and domain information |
|---|
| >gnl|CDD|205206 pfam13025, DUF3886, Protein of unknown function (DUF3886) | Back alignment and domain information |
|---|
| >gnl|CDD|202833 pfam03962, Mnd1, Mnd1 family | Back alignment and domain information |
|---|
| >gnl|CDD|221756 pfam12757, DUF3812, Protein of unknown function (DUF3812) | Back alignment and domain information |
|---|
| >gnl|CDD|235548 PRK05657, PRK05657, RNA polymerase sigma factor RpoS; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|177755 PLN00152, PLN00152, DNA-directed RNA polymerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|202427 pfam02841, GBP_C, Guanylate-binding protein, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|227504 COG5177, COG5177, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|227492 COG5163, NOP7, Protein required for biogenesis of the 60S ribosomal subunit [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|221179 pfam11711, Tim54, Inner membrane protein import complex subunit Tim54 | Back alignment and domain information |
|---|
| >gnl|CDD|221179 pfam11711, Tim54, Inner membrane protein import complex subunit Tim54 | Back alignment and domain information |
|---|
| >gnl|CDD|235302 PRK04456, PRK04456, acetyl-CoA decarbonylase/synthase complex subunit beta; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235302 PRK04456, PRK04456, acetyl-CoA decarbonylase/synthase complex subunit beta; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|184538 PRK14149, PRK14149, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218576 pfam05395, DARPP-32, Protein phosphatase inhibitor 1/DARPP-32 | Back alignment and domain information |
|---|
| >gnl|CDD|218576 pfam05395, DARPP-32, Protein phosphatase inhibitor 1/DARPP-32 | Back alignment and domain information |
|---|
| >gnl|CDD|204032 pfam08703, PLC-beta_C, PLC-beta C terminal | Back alignment and domain information |
|---|
| >gnl|CDD|238827 cd01650, RT_nLTR_like, RT_nLTR: Non-LTR (long terminal repeat) retrotransposon and non-LTR retrovirus reverse transcriptase (RT) | Back alignment and domain information |
|---|
| >gnl|CDD|227615 COG5296, COG5296, Transcription factor involved in TATA site selection and in elongation by RNA polymerase II [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218328 pfam04921, XAP5, XAP5, circadian clock regulator | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227701 COG5414, COG5414, TATA-binding protein-associated factor [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|227701 COG5414, COG5414, TATA-binding protein-associated factor [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|114172 pfam05432, BSP_II, Bone sialoprotein II (BSP-II) | Back alignment and domain information |
|---|
| >gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|220413 pfam09805, Nop25, Nucleolar protein 12 (25kDa) | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|223649 COG0576, GrpE, Molecular chaperone GrpE (heat shock protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|235033 PRK02363, PRK02363, DNA-directed RNA polymerase subunit delta; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235033 PRK02363, PRK02363, DNA-directed RNA polymerase subunit delta; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|130712 TIGR01651, CobT, cobaltochelatase, CobT subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239286 cd02988, Phd_like_VIAF, Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis | Back alignment and domain information |
|---|
| >gnl|CDD|220102 pfam09073, BUD22, BUD22 | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234055 TIGR02907, spore_VI_D, stage VI sporulation protein D | Back alignment and domain information |
|---|
| >gnl|CDD|234055 TIGR02907, spore_VI_D, stage VI sporulation protein D | Back alignment and domain information |
|---|
| >gnl|CDD|234055 TIGR02907, spore_VI_D, stage VI sporulation protein D | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|191249 pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylase N-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|221490 pfam12253, CAF1A, Chromatin assembly factor 1 subunit A | Back alignment and domain information |
|---|
| >gnl|CDD|225887 COG3351, FlaD, Putative archaeal flagellar protein D/E [Cell motility and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|217502 pfam03343, SART-1, SART-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|218115 pfam04502, DUF572, Family of unknown function (DUF572) | Back alignment and domain information |
|---|
| >gnl|CDD|222648 pfam14283, DUF4366, Domain of unknown function (DUF4366) | Back alignment and domain information |
|---|
| >gnl|CDD|222648 pfam14283, DUF4366, Domain of unknown function (DUF4366) | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|235026 PRK02292, PRK02292, V-type ATP synthase subunit E; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234366 TIGR03825, FliH_bacil, flagellar assembly protein FliH | Back alignment and domain information |
|---|
| >gnl|CDD|218771 pfam05835, Synaphin, Synaphin protein | Back alignment and domain information |
|---|
| >gnl|CDD|227496 COG5167, VID27, Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|184539 PRK14150, PRK14150, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family | Back alignment and domain information |
|---|
| >gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family | Back alignment and domain information |
|---|
| >gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family | Back alignment and domain information |
|---|
| >gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family | Back alignment and domain information |
|---|
| >gnl|CDD|220112 pfam09110, HAND, HAND | Back alignment and domain information |
|---|
| >gnl|CDD|237628 PRK14156, PRK14156, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237628 PRK14156, PRK14156, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237628 PRK14156, PRK14156, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family | Back alignment and domain information |
|---|
| >gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family | Back alignment and domain information |
|---|
| >gnl|CDD|236410 PRK09202, nusA, transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|205206 pfam13025, DUF3886, Protein of unknown function (DUF3886) | Back alignment and domain information |
|---|
| >gnl|CDD|205206 pfam13025, DUF3886, Protein of unknown function (DUF3886) | Back alignment and domain information |
|---|
| >gnl|CDD|205206 pfam13025, DUF3886, Protein of unknown function (DUF3886) | Back alignment and domain information |
|---|
| >gnl|CDD|205206 pfam13025, DUF3886, Protein of unknown function (DUF3886) | Back alignment and domain information |
|---|
| >gnl|CDD|204414 pfam10211, Ax_dynein_light, Axonemal dynein light chain | Back alignment and domain information |
|---|
| >gnl|CDD|224581 COG1667, COG1667, Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|221756 pfam12757, DUF3812, Protein of unknown function (DUF3812) | Back alignment and domain information |
|---|
| >gnl|CDD|221756 pfam12757, DUF3812, Protein of unknown function (DUF3812) | Back alignment and domain information |
|---|
| >gnl|CDD|221756 pfam12757, DUF3812, Protein of unknown function (DUF3812) | Back alignment and domain information |
|---|
| >gnl|CDD|235302 PRK04456, PRK04456, acetyl-CoA decarbonylase/synthase complex subunit beta; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|184538 PRK14149, PRK14149, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184538 PRK14149, PRK14149, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218576 pfam05395, DARPP-32, Protein phosphatase inhibitor 1/DARPP-32 | Back alignment and domain information |
|---|
| >gnl|CDD|177433 PHA02608, 67, prohead core protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177433 PHA02608, 67, prohead core protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177433 PHA02608, 67, prohead core protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177433 PHA02608, 67, prohead core protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218637 pfam05558, DREPP, DREPP plasma membrane polypeptide | Back alignment and domain information |
|---|
| >gnl|CDD|221733 pfam12720, DUF3807, Protein of unknown function (DUF3807) | Back alignment and domain information |
|---|
| >gnl|CDD|111875 pfam03032, Brevenin, Brevenin/esculentin/gaegurin/rugosin family | Back alignment and domain information |
|---|
| >gnl|CDD|111875 pfam03032, Brevenin, Brevenin/esculentin/gaegurin/rugosin family | Back alignment and domain information |
|---|
| >gnl|CDD|111875 pfam03032, Brevenin, Brevenin/esculentin/gaegurin/rugosin family | Back alignment and domain information |
|---|
| >gnl|CDD|111875 pfam03032, Brevenin, Brevenin/esculentin/gaegurin/rugosin family | Back alignment and domain information |
|---|
| >gnl|CDD|111875 pfam03032, Brevenin, Brevenin/esculentin/gaegurin/rugosin family | Back alignment and domain information |
|---|
| >gnl|CDD|111875 pfam03032, Brevenin, Brevenin/esculentin/gaegurin/rugosin family | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|221620 pfam12527, DUF3727, Protein of unknown function (DUF3727) | Back alignment and domain information |
|---|
| >gnl|CDD|184724 PRK14520, rpsP, 30S ribosomal protein S16; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218482 pfam05178, Kri1, KRI1-like family | Back alignment and domain information |
|---|
| >gnl|CDD|205480 pfam13300, DUF4078, Domain of unknown function (DUF4078) | Back alignment and domain information |
|---|
| >gnl|CDD|217476 pfam03286, Pox_Ag35, Pox virus Ag35 surface protein | Back alignment and domain information |
|---|
| >gnl|CDD|187701 cd09277, RNase_HI_bacteria_HBD, Bacterial RNase HI containing a hybrid binding domain (HBD) at the N-terminus | Back alignment and domain information |
|---|
| >gnl|CDD|222665 pfam14303, NAM-associated, No apical meristem-associated C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|218218 pfam04702, Vicilin_N, Vicilin N terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|227466 COG5137, COG5137, Histone chaperone involved in gene silencing [Transcription / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein | Back alignment and domain information |
|---|
| >gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216403 pfam01271, Granin, Granin (chromogranin or secretogranin) | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|237744 PRK14521, rpsP, 30S ribosomal protein S16; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|191249 pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylase N-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|221490 pfam12253, CAF1A, Chromatin assembly factor 1 subunit A | Back alignment and domain information |
|---|
| >gnl|CDD|221490 pfam12253, CAF1A, Chromatin assembly factor 1 subunit A | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|218115 pfam04502, DUF572, Family of unknown function (DUF572) | Back alignment and domain information |
|---|
| >gnl|CDD|184539 PRK14150, PRK14150, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family | Back alignment and domain information |
|---|
| >gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family | Back alignment and domain information |
|---|
| >gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family | Back alignment and domain information |
|---|
| >gnl|CDD|224530 COG1614, CdhC, CO dehydrogenase/acetyl-CoA synthase beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|148682 pfam07222, PBP_sp32, Proacrosin binding protein sp32 | Back alignment and domain information |
|---|
| >gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215914 pfam00428, Ribosomal_60s, 60s Acidic ribosomal protein | Back alignment and domain information |
|---|
| >gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|221756 pfam12757, DUF3812, Protein of unknown function (DUF3812) | Back alignment and domain information |
|---|
| >gnl|CDD|235548 PRK05657, PRK05657, RNA polymerase sigma factor RpoS; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235548 PRK05657, PRK05657, RNA polymerase sigma factor RpoS; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|177755 PLN00152, PLN00152, DNA-directed RNA polymerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|202427 pfam02841, GBP_C, Guanylate-binding protein, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|227492 COG5163, NOP7, Protein required for biogenesis of the 60S ribosomal subunit [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|235302 PRK04456, PRK04456, acetyl-CoA decarbonylase/synthase complex subunit beta; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|184724 PRK14520, rpsP, 30S ribosomal protein S16; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217476 pfam03286, Pox_Ag35, Pox virus Ag35 surface protein | Back alignment and domain information |
|---|
| >gnl|CDD|222665 pfam14303, NAM-associated, No apical meristem-associated C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|218218 pfam04702, Vicilin_N, Vicilin N terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|218003 pfam04281, Tom22, Mitochondrial import receptor subunit Tom22 | Back alignment and domain information |
|---|
| >gnl|CDD|187704 cd09280, RNase_HI_eukaryote_like, Eukaryotic RNase H is longer and more complex than their prokaryotic counterparts and unlike prokaryote, RNase H are essential in higher eukaryote | Back alignment and domain information |
|---|
| >gnl|CDD|225177 COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|220438 pfam09845, DUF2072, Zn-ribbon containing protein (DUF2072) | Back alignment and domain information |
|---|
| >gnl|CDD|223783 COG0711, AtpF, F0F1-type ATP synthase, subunit b [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|221185 pfam11719, Drc1-Sld2, DNA replication and checkpoint protein | Back alignment and domain information |
|---|
| >gnl|CDD|183731 PRK12766, PRK12766, 50S ribosomal protein L32e; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185618 PTZ00438, PTZ00438, gamete antigen 27/25-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|240413 PTZ00423, PTZ00423, glideosome-associated protein 45; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|191249 pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylase N-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|221490 pfam12253, CAF1A, Chromatin assembly factor 1 subunit A | Back alignment and domain information |
|---|
| >gnl|CDD|221490 pfam12253, CAF1A, Chromatin assembly factor 1 subunit A | Back alignment and domain information |
|---|
| >gnl|CDD|221490 pfam12253, CAF1A, Chromatin assembly factor 1 subunit A | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|218115 pfam04502, DUF572, Family of unknown function (DUF572) | Back alignment and domain information |
|---|
| >gnl|CDD|221668 pfam12619, MCM2_N, Mini-chromosome maintenance protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family | Back alignment and domain information |
|---|
| >gnl|CDD|234352 TIGR03779, Bac_Flav_CT_M, Bacteroides conjugative transposon TraM protein | Back alignment and domain information |
|---|
| >gnl|CDD|221581 pfam12446, DUF3682, Protein of unknown function (DUF3682) | Back alignment and domain information |
|---|
| >gnl|CDD|221581 pfam12446, DUF3682, Protein of unknown function (DUF3682) | Back alignment and domain information |
|---|
| >gnl|CDD|218561 pfam05340, DUF740, Protein of unknown function (DUF740) | Back alignment and domain information |
|---|
| >gnl|CDD|224308 COG1390, NtpE, Archaeal/vacuolar-type H+-ATPase subunit E [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205206 pfam13025, DUF3886, Protein of unknown function (DUF3886) | Back alignment and domain information |
|---|
| >gnl|CDD|205206 pfam13025, DUF3886, Protein of unknown function (DUF3886) | Back alignment and domain information |
|---|
| >gnl|CDD|205206 pfam13025, DUF3886, Protein of unknown function (DUF3886) | Back alignment and domain information |
|---|
| >gnl|CDD|235548 PRK05657, PRK05657, RNA polymerase sigma factor RpoS; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235548 PRK05657, PRK05657, RNA polymerase sigma factor RpoS; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|202427 pfam02841, GBP_C, Guanylate-binding protein, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|227492 COG5163, NOP7, Protein required for biogenesis of the 60S ribosomal subunit [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|227492 COG5163, NOP7, Protein required for biogenesis of the 60S ribosomal subunit [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|235302 PRK04456, PRK04456, acetyl-CoA decarbonylase/synthase complex subunit beta; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|177433 PHA02608, 67, prohead core protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218637 pfam05558, DREPP, DREPP plasma membrane polypeptide | Back alignment and domain information |
|---|
| >gnl|CDD|111875 pfam03032, Brevenin, Brevenin/esculentin/gaegurin/rugosin family | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|184724 PRK14520, rpsP, 30S ribosomal protein S16; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218218 pfam04702, Vicilin_N, Vicilin N terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|218218 pfam04702, Vicilin_N, Vicilin N terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|218003 pfam04281, Tom22, Mitochondrial import receptor subunit Tom22 | Back alignment and domain information |
|---|
| >gnl|CDD|225177 COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >gnl|CDD|227352 COG5019, CDC3, Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|233044 TIGR00600, rad2, DNA excision repair protein (rad2) | Back alignment and domain information |
|---|
| >gnl|CDD|218598 pfam05470, eIF-3c_N, Eukaryotic translation initiation factor 3 subunit 8 N-terminus | Back alignment and domain information |
|---|
| >gnl|CDD|222977 PHA03089, PHA03089, late transcription factor VLTF-4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|147845 pfam05914, RIB43A, RIB43A | Back alignment and domain information |
|---|
| >gnl|CDD|237799 PRK14715, PRK14715, DNA polymerase II large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214923 smart00937, PCRF, This domain is found in peptide chain release factors | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 682 | |||
| COG0328 | 154 | RnhA Ribonuclease HI [DNA replication, recombinati | 99.88 | |
| PRK06548 | 161 | ribonuclease H; Provisional | 99.87 | |
| PRK08719 | 147 | ribonuclease H; Reviewed | 99.85 | |
| PRK00203 | 150 | rnhA ribonuclease H; Reviewed | 99.82 | |
| PF00075 | 132 | RNase_H: RNase H; InterPro: IPR002156 The RNase H | 99.82 | |
| cd06222 | 130 | RnaseH RNase H (RNase HI) is an endonuclease that | 99.7 | |
| KOG3752|consensus | 371 | 99.7 | ||
| PRK13907 | 128 | rnhA ribonuclease H; Provisional | 99.68 | |
| PRK07708 | 219 | hypothetical protein; Validated | 99.58 | |
| PRK07238 | 372 | bifunctional RNase H/acid phosphatase; Provisional | 99.41 | |
| PF13456 | 87 | RVT_3: Reverse transcriptase-like; PDB: 3ALY_A 2EH | 99.14 | |
| cd01650 | 220 | RT_nLTR_like RT_nLTR: Non-LTR (long terminal repea | 98.86 | |
| cd01651 | 226 | RT_G2_intron RT_G2_intron: Reverse transcriptases | 98.14 | |
| cd01648 | 119 | TERT TERT: Telomerase reverse transcriptase (TERT) | 98.11 | |
| cd00304 | 98 | RT_like RT_like: Reverse transcriptase (RT, RNA-de | 98.0 | |
| PF00078 | 214 | RVT_1: Reverse transcriptase (RNA-dependent DNA po | 97.92 | |
| cd03487 | 214 | RT_Bac_retron_II RT_Bac_retron_II: Reverse transcr | 97.9 | |
| cd01646 | 158 | RT_Bac_retron_I RT_Bac_retron_I: Reverse transcrip | 97.83 | |
| cd03714 | 119 | RT_DIRS1 RT_DIRS1: Reverse transcriptases (RTs) oc | 96.7 | |
| cd01709 | 346 | RT_like_1 RT_like_1: A subfamily of reverse transc | 96.33 | |
| cd01645 | 213 | RT_Rtv RT_Rtv: Reverse transcriptases (RTs) from r | 96.26 | |
| cd03715 | 210 | RT_ZFREV_like RT_ZFREV_like: A subfamily of revers | 95.22 | |
| PF09004 | 42 | DUF1891: Domain of unknown function (DUF1891); Int | 92.92 | |
| cd01647 | 177 | RT_LTR RT_LTR: Reverse transcriptases (RTs) from r | 88.54 | |
| KOG1832|consensus | 1516 | 86.1 | ||
| KOG4768|consensus | 796 | 83.3 |
| >COG0328 RnhA Ribonuclease HI [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Probab=99.88 E-value=1.8e-22 Score=182.08 Aligned_cols=127 Identities=20% Similarity=0.206 Sum_probs=105.2
Q ss_pred CeEEEEeCCCCC--CCCceEEEEEc-c-e--eeeecCCCCCchHHHHHHHHHHHHHHHHcCCCCcEEEEcCCHHHHHhhh
Q psy3428 327 SHTICYTDGSKT--PTTTGCAYSVG-N-V--VRSTLLNPVNSIFSAELIAIFLCLEAILDSPSGKFLIVTDSRSSLAALS 400 (682)
Q Consensus 327 ~~~~iytDgS~~--~~~~G~g~~~~-~-~--~~~~~~~~~~~~~~aEl~Ai~~al~~~~~~~~~~v~i~sDs~~~i~~l~ 400 (682)
..+.||||||+. +|..|+|+|+. . . ..+.... .+||++||+.|++.||+++.+.+...|.|+|||++|+++|.
T Consensus 2 ~~v~if~DGa~~gNpG~gG~g~vl~~~~~~~~~s~~~~-~tTNNraEl~A~i~AL~~l~~~~~~~v~l~tDS~yv~~~i~ 80 (154)
T COG0328 2 KKVEIFTDGACLGNPGPGGWGAVLRYGDGEKELSGGEG-RTTNNRAELRALIEALEALKELGACEVTLYTDSKYVVEGIT 80 (154)
T ss_pred CceEEEecCccCCCCCCceEEEEEEcCCceEEEeeeee-cccChHHHHHHHHHHHHHHHhcCCceEEEEecHHHHHHHHH
Confidence 368999999975 46799998875 1 1 2333344 89999999999999999999888999999999999999997
Q ss_pred cCCCC-----------cH-HHHHHHHHHHHHHhcCCceEEEEecCCCCCchhHHHHHHhcCcccCC
Q psy3428 401 NVRFI-----------NP-LITKVYSTWSYLKLCKKDITFMWCPSHCGIKGNEIVDVAAKNPTTGT 454 (682)
Q Consensus 401 ~~~~~-----------~~-~~~~i~~~~~~l~~~~~~v~~~WVpgH~gi~gNe~AD~lAk~a~~~~ 454 (682)
.+..+ .| ..++++..+.++..+...|.+.|||||+|.++||+||+||+.|+...
T Consensus 81 ~w~~~w~~~~w~~~~~~pvkn~dl~~~~~~~~~~~~~v~~~WVkgH~g~~~NeraD~LA~~~~~~~ 146 (154)
T COG0328 81 RWIVKWKKNGWKTADKKPVKNKDLWEELDELLKRHELVFWEWVKGHAGHPENERADQLAREAARAA 146 (154)
T ss_pred HHHhhccccCccccccCccccHHHHHHHHHHHhhCCeEEEEEeeCCCCChHHHHHHHHHHHHHHhh
Confidence 43111 12 35688999999998888999999999999999999999999998765
|
|
| >PRK06548 ribonuclease H; Provisional | Back alignment and domain information |
|---|
| >PRK08719 ribonuclease H; Reviewed | Back alignment and domain information |
|---|
| >PRK00203 rnhA ribonuclease H; Reviewed | Back alignment and domain information |
|---|
| >PF00075 RNase_H: RNase H; InterPro: IPR002156 The RNase H domain is responsible for hydrolysis of the RNA portion of RNA x DNA hybrids, and this activity requires the presence of divalent cations (Mg2+ or Mn2+) that bind its active site | Back alignment and domain information |
|---|
| >cd06222 RnaseH RNase H (RNase HI) is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a not sequence-specific manner | Back alignment and domain information |
|---|
| >KOG3752|consensus | Back alignment and domain information |
|---|
| >PRK13907 rnhA ribonuclease H; Provisional | Back alignment and domain information |
|---|
| >PRK07708 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK07238 bifunctional RNase H/acid phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF13456 RVT_3: Reverse transcriptase-like; PDB: 3ALY_A 2EHG_A 3HST_B | Back alignment and domain information |
|---|
| >cd01650 RT_nLTR_like RT_nLTR: Non-LTR (long terminal repeat) retrotransposon and non-LTR retrovirus reverse transcriptase (RT) | Back alignment and domain information |
|---|
| >cd01651 RT_G2_intron RT_G2_intron: Reverse transcriptases (RTs) with group II intron origin | Back alignment and domain information |
|---|
| >cd01648 TERT TERT: Telomerase reverse transcriptase (TERT) | Back alignment and domain information |
|---|
| >cd00304 RT_like RT_like: Reverse transcriptase (RT, RNA-dependent DNA polymerase)_like family | Back alignment and domain information |
|---|
| >PF00078 RVT_1: Reverse transcriptase (RNA-dependent DNA polymerase); InterPro: IPR000477 The use of an RNA template to produce DNA, for integration into the host genome and exploitation of a host cell, is a strategy employed in the replication of retroid elements, such as the retroviruses and bacterial retrons | Back alignment and domain information |
|---|
| >cd03487 RT_Bac_retron_II RT_Bac_retron_II: Reverse transcriptases (RTs) in bacterial retrotransposons or retrons | Back alignment and domain information |
|---|
| >cd01646 RT_Bac_retron_I RT_Bac_retron_I: Reverse transcriptases (RTs) in bacterial retrotransposons or retrons | Back alignment and domain information |
|---|
| >cd03714 RT_DIRS1 RT_DIRS1: Reverse transcriptases (RTs) occurring in the DIRS1 group of retransposons | Back alignment and domain information |
|---|
| >cd01709 RT_like_1 RT_like_1: A subfamily of reverse transcriptases (RTs) | Back alignment and domain information |
|---|
| >cd01645 RT_Rtv RT_Rtv: Reverse transcriptases (RTs) from retroviruses (Rtvs) | Back alignment and domain information |
|---|
| >cd03715 RT_ZFREV_like RT_ZFREV_like: A subfamily of reverse transcriptases (RTs) found in sequences similar to the intact endogenous retrovirus ZFERV from zebrafish and to Moloney murine leukemia virus RT | Back alignment and domain information |
|---|
| >PF09004 DUF1891: Domain of unknown function (DUF1891); InterPro: IPR015095 This domain is found at the extreme N terminus of eukaryotic alkylated DNA repair protein homologs | Back alignment and domain information |
|---|
| >cd01647 RT_LTR RT_LTR: Reverse transcriptases (RTs) from retrotransposons and retroviruses which have long terminal repeats (LTRs) in their DNA copies but not in their RNA template | Back alignment and domain information |
|---|
| >KOG1832|consensus | Back alignment and domain information |
|---|
| >KOG4768|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 682 | ||||
| 3dlk_A | 556 | Crystal Structure Of An Engineered Form Of The Hiv- | 4e-04 | ||
| 3qo9_A | 557 | Crystal Structure Of Hiv-1 Reverse Transcriptase (R | 5e-04 | ||
| 1hni_A | 558 | Structure Of Hiv-1 Reverse Transcriptase In A Compl | 5e-04 | ||
| 3irx_A | 558 | Crystal Structure Of Hiv-1 Reverse Transcriptase (R | 5e-04 | ||
| 1qe1_A | 558 | Crystal Structure Of 3tc-Resistant M184i Mutant Of | 5e-04 | ||
| 1hys_A | 553 | Crystal Structure Of Hiv-1 Reverse Transcriptase In | 5e-04 | ||
| 1hpz_A | 560 | Human Immunodeficiency Virus Type 1 Length = 560 | 5e-04 | ||
| 4dg1_A | 549 | Crystal Structure Of Hiv-1 Reverse Transcriptase (R | 5e-04 | ||
| 2ze2_A | 557 | Crystal Structure Of L100iK103N MUTANT HIV-1 Revers | 5e-04 | ||
| 3ig1_A | 555 | Hiv-1 Reverse Transcriptase With The Inhibitor Beta | 5e-04 | ||
| 1dlo_A | 556 | Human Immunodeficiency Virus Type 1 Length = 556 | 5e-04 | ||
| 2i5j_A | 552 | Crystal Structure Of Hiv-1 Reverse Transcriptase (R | 5e-04 | ||
| 2zd1_A | 557 | Crystal Structure Of Hiv-1 Reverse Transcriptase (R | 5e-04 | ||
| 1hvu_A | 554 | Human Immunodeficiency Virus Type 1 Reverse Transcr | 5e-04 | ||
| 1s6p_A | 560 | Crystal Structure Of Human Immunodeficiency Virus T | 5e-04 | ||
| 3qlh_A | 555 | Hiv-1 Reverse Transcriptase In Complex With Manicol | 5e-04 | ||
| 3kle_A | 562 | Crystal Structure Of Azt-Resistant Hiv-1 Reverse Tr | 5e-04 | ||
| 3klh_A | 564 | Crystal Structure Of Azt-Resistant Hiv-1 Reverse Tr | 5e-04 | ||
| 2vg5_A | 557 | Crystal Structures Of Hiv-1 Reverse Transcriptase C | 5e-04 | ||
| 1hmv_A | 560 | The Structure Of Unliganded Reverse Transcriptase F | 5e-04 | ||
| 1uwb_A | 558 | Tyr 181 Cys Hiv-1 Rt8-Cl Tibo Length = 558 | 5e-04 | ||
| 3jsm_A | 558 | K65r Mutant Hiv-1 Reverse Transcriptase Cross-Linke | 5e-04 | ||
| 3hvt_A | 556 | Structural Basis Of Asymmetry In The Human Immunode | 5e-04 | ||
| 1n5y_A | 558 | Hiv-1 Reverse Transcriptase Crosslinked To Post- Tr | 6e-04 | ||
| 1s1w_A | 560 | Crystal Structure Of V106a Mutant Hiv-1 Reverse Tra | 6e-04 | ||
| 1s1t_A | 560 | Crystal Structure Of L100i Mutant Hiv-1 Reverse Tra | 6e-04 | ||
| 3klf_A | 557 | Crystal Structure Of Wild-Type Hiv-1 Reverse Transc | 6e-04 | ||
| 2iaj_A | 560 | Crystal Structure Of K103nY181C MUTANT HIV-1 Revers | 6e-04 | ||
| 1rev_A | 560 | Hiv-1 Reverse Transcriptase Length = 560 | 6e-04 | ||
| 1lwe_A | 560 | Crystal Structure Of M41lT215Y MUTANT HIV-1 Reverse | 6e-04 | ||
| 1s1x_A | 560 | Crystal Structure Of V108i Mutant Hiv-1 Reverse Tra | 6e-04 | ||
| 3dm2_A | 560 | Crystal Structure Of Hiv-1 K103n Mutant Reverse Tra | 6e-04 | ||
| 1lw0_A | 560 | Crystal Structure Of T215y Mutant Hiv-1 Reverse Tra | 6e-04 | ||
| 1jle_A | 560 | Crystal Structure Of Y188c Mutant Hiv-1 Reverse Tra | 6e-04 | ||
| 1lwc_A | 560 | Crystal Structure Of M184v Mutant Hiv-1 Reverse Tra | 6e-04 | ||
| 1rt3_A | 560 | Azt Drug Resistant Hiv-1 Reverse Transcriptase Comp | 6e-04 | ||
| 2jle_A | 566 | Novel Indazole Nnrtis Created Using Molecular Templ | 6e-04 | ||
| 3bgr_A | 557 | Crystal Structure Of K103nY181C MUTANT HIV-1 Revers | 6e-04 | ||
| 3ffi_A | 561 | Hiv-1 Rt With Pyridone Non-Nucleoside Inhibitor Len | 6e-04 | ||
| 2ynf_A | 563 | Hiv-1 Reverse Transcriptase Y188l Mutant In Complex | 6e-04 | ||
| 1lwf_A | 560 | Crystal Structure Of A Mutant Hiv-1 Reverse Transcr | 6e-04 | ||
| 1jkh_A | 560 | Crystal Structure Of Y181c Mutant Hiv-1 Reverse Tra | 6e-04 | ||
| 3med_A | 560 | Hiv-1 K103n Reverse Transcriptase In Complex With T | 6e-04 | ||
| 3drs_A | 563 | Hiv Reverse Transcriptase K103n Mutant In Complex W | 6e-04 | ||
| 2rki_A | 560 | Crystal Structure Of Hiv-1 Reverse Transcriptase (R | 6e-04 | ||
| 1jlf_A | 560 | Crystal Structure Of Y188c Mutant Hiv-1 Reverse Tra | 6e-04 | ||
| 2rf2_A | 563 | Hiv Reverse Transcriptase In Complex With Inhibitor | 7e-04 | ||
| 3kjv_A | 560 | Hiv-1 Reverse Transcriptase In Complex With Dna Len | 7e-04 | ||
| 3di6_A | 561 | Hiv-1 Rt With Pyridazinone Non-Nucleoside Inhibitor | 7e-04 | ||
| 3dmj_A | 560 | Crystal Structure Of Hiv-1 V106a And Y181c Mutant R | 7e-04 | ||
| 3drr_A | 563 | Hiv Reverse Transcriptase Y181c Mutant In Complex W | 8e-04 |
| >pdb|3DLK|A Chain A, Crystal Structure Of An Engineered Form Of The Hiv-1 Reverse Transcriptase, Rt69a Length = 556 | Back alignment and structure |
|
| >pdb|3QO9|A Chain A, Crystal Structure Of Hiv-1 Reverse Transcriptase (Rt) In Complex With Tsao-T, A Non-Nucleoside Rt Inhibitor (Nnrti) Length = 557 | Back alignment and structure |
| >pdb|1HNI|A Chain A, Structure Of Hiv-1 Reverse Transcriptase In A Complex With The Nonnucleoside Inhibitor Alpha-Apa R 95845 At 2.8 Angstroms Resolution Length = 558 | Back alignment and structure |
| >pdb|3IRX|A Chain A, Crystal Structure Of Hiv-1 Reverse Transcriptase (Rt) In Complex With The Non-Nucleoside Rt Inhibitor (E)-S-Methyl 5-(1-(3,7-Dimethyl-2-Oxo-2, 3-Dihydrobenzo[d]oxazol-5-Yl)-5- (5-Methyl-1,3,4-Oxadiazol-2-Yl)pent-1-Enyl)-2-Methoxy-3- Methylbenzothioate. Length = 558 | Back alignment and structure |
| >pdb|1QE1|A Chain A, Crystal Structure Of 3tc-Resistant M184i Mutant Of Hiv-1 Reverse Transcriptase Length = 558 | Back alignment and structure |
| >pdb|1HYS|A Chain A, Crystal Structure Of Hiv-1 Reverse Transcriptase In Complex With A Polypurine Tract Rna:dna Length = 553 | Back alignment and structure |
| >pdb|1HPZ|A Chain A, Human Immunodeficiency Virus Type 1 Length = 560 | Back alignment and structure |
| >pdb|4DG1|A Chain A, Crystal Structure Of Hiv-1 Reverse Transcriptase (Rt) With Polymorphism Mutation K172a And K173a Length = 549 | Back alignment and structure |
| >pdb|2ZE2|A Chain A, Crystal Structure Of L100iK103N MUTANT HIV-1 Reverse Transcriptase (Rt) In Complex With Tmc278 (Rilpivirine), A Non-Nucleoside Rt Inhibitor Length = 557 | Back alignment and structure |
| >pdb|3IG1|A Chain A, Hiv-1 Reverse Transcriptase With The Inhibitor Beta- Thujaplicinol Bound At The Rnase H Active Site Length = 555 | Back alignment and structure |
| >pdb|1DLO|A Chain A, Human Immunodeficiency Virus Type 1 Length = 556 | Back alignment and structure |
| >pdb|2I5J|A Chain A, Crystal Structure Of Hiv-1 Reverse Transcriptase (Rt) In Complex With Dhbnh, An Rnase H Inhibitor Length = 552 | Back alignment and structure |
| >pdb|2ZD1|A Chain A, Crystal Structure Of Hiv-1 Reverse Transcriptase (Rt) In Complex With Tmc278 (Rilpivirine), A Non-Nucleoside Rt Inhibitor Length = 557 | Back alignment and structure |
| >pdb|1HVU|A Chain A, Human Immunodeficiency Virus Type 1 Reverse Transcriptase Complexed With A 33-Base Nucleotide Rna Pseudoknot Length = 554 | Back alignment and structure |
| >pdb|1S6P|A Chain A, Crystal Structure Of Human Immunodeficiency Virus Type 1 Reverse Transcriptase (Rt) In Complex With Janssen-R100943 Length = 560 | Back alignment and structure |
| >pdb|3QLH|A Chain A, Hiv-1 Reverse Transcriptase In Complex With Manicol At The Rnase H Active Site And Tmc278 (rilpivirine) At The Nnrti Binding Pocket Length = 555 | Back alignment and structure |
| >pdb|3KLE|A Chain A, Crystal Structure Of Azt-Resistant Hiv-1 Reverse Transcriptase Crosslinked To A Dsdna With A Bound Excision Product, Aztppppa Length = 562 | Back alignment and structure |
| >pdb|3KLH|A Chain A, Crystal Structure Of Azt-Resistant Hiv-1 Reverse Transcriptase Crosslinked To Post-Translocation Aztmp-Terminated Dna (Complex P) Length = 564 | Back alignment and structure |
| >pdb|2VG5|A Chain A, Crystal Structures Of Hiv-1 Reverse Transcriptase Complexes With Thiocarbamate Non-Nucleoside Inhibitors Length = 557 | Back alignment and structure |
| >pdb|1HMV|A Chain A, The Structure Of Unliganded Reverse Transcriptase From The Human Immunodeficiency Virus Type 1 Length = 560 | Back alignment and structure |
| >pdb|1UWB|A Chain A, Tyr 181 Cys Hiv-1 Rt8-Cl Tibo Length = 558 | Back alignment and structure |
| >pdb|3JSM|A Chain A, K65r Mutant Hiv-1 Reverse Transcriptase Cross-Linked To Ds-Dna And Complexed With Tenofovir-Diphosphate As The Incoming Nucleotide Substrate Length = 558 | Back alignment and structure |
| >pdb|3HVT|A Chain A, Structural Basis Of Asymmetry In The Human Immunodeficiency Virus Type 1 Reverse Transcriptase Heterodimer Length = 556 | Back alignment and structure |
| >pdb|1N5Y|A Chain A, Hiv-1 Reverse Transcriptase Crosslinked To Post- Translocation Aztmp-Terminated Dna (Complex P) Length = 558 | Back alignment and structure |
| >pdb|1S1W|A Chain A, Crystal Structure Of V106a Mutant Hiv-1 Reverse Transcriptase In Complex With Uc-781 Length = 560 | Back alignment and structure |
| >pdb|1S1T|A Chain A, Crystal Structure Of L100i Mutant Hiv-1 Reverse Transcriptase In Complex With Uc-781 Length = 560 | Back alignment and structure |
| >pdb|3KLF|A Chain A, Crystal Structure Of Wild-Type Hiv-1 Reverse Transcriptase Crosslinked To A Dsdna With A Bound Excision Product, Aztppppa Length = 557 | Back alignment and structure |
| >pdb|2IAJ|A Chain A, Crystal Structure Of K103nY181C MUTANT HIV-1 Reverse Transcriptase (Rt) In Complex With Atp Length = 560 | Back alignment and structure |
| >pdb|1REV|A Chain A, Hiv-1 Reverse Transcriptase Length = 560 | Back alignment and structure |
| >pdb|1LWE|A Chain A, Crystal Structure Of M41lT215Y MUTANT HIV-1 Reverse Transcriptase (Rtmn) In Complex With Nevirapine Length = 560 | Back alignment and structure |
| >pdb|1S1X|A Chain A, Crystal Structure Of V108i Mutant Hiv-1 Reverse Transcriptase In Complex With Nevirapine Length = 560 | Back alignment and structure |
| >pdb|3DM2|A Chain A, Crystal Structure Of Hiv-1 K103n Mutant Reverse Transcriptase In Complex With Gw564511. Length = 560 | Back alignment and structure |
| >pdb|1LW0|A Chain A, Crystal Structure Of T215y Mutant Hiv-1 Reverse Transcriptase In Complex With Nevirapine Length = 560 | Back alignment and structure |
| >pdb|1JLE|A Chain A, Crystal Structure Of Y188c Mutant Hiv-1 Reverse Transcriptase Length = 560 | Back alignment and structure |
| >pdb|1LWC|A Chain A, Crystal Structure Of M184v Mutant Hiv-1 Reverse Transcriptase In Complex With Nevirapine Length = 560 | Back alignment and structure |
| >pdb|1RT3|A Chain A, Azt Drug Resistant Hiv-1 Reverse Transcriptase Complexed With 1051u91 Length = 560 | Back alignment and structure |
| >pdb|2JLE|A Chain A, Novel Indazole Nnrtis Created Using Molecular Template Hybridization Based On Crystallographic Overlays Length = 566 | Back alignment and structure |
| >pdb|3BGR|A Chain A, Crystal Structure Of K103nY181C MUTANT HIV-1 Reverse Transcriptase (Rt) In Complex With Tmc278 (Rilpivirine), A Non-Nucleoside Rt Inhibitor Length = 557 | Back alignment and structure |
| >pdb|3FFI|A Chain A, Hiv-1 Rt With Pyridone Non-Nucleoside Inhibitor Length = 561 | Back alignment and structure |
| >pdb|2YNF|A Chain A, Hiv-1 Reverse Transcriptase Y188l Mutant In Complex With Inhibitor Gsk560 Length = 563 | Back alignment and structure |
| >pdb|1LWF|A Chain A, Crystal Structure Of A Mutant Hiv-1 Reverse Transcriptase (rtmq+m184v: M41l/d67n/k70r/m184v/t215y) In Complex With Nevirapine Length = 560 | Back alignment and structure |
| >pdb|1JKH|A Chain A, Crystal Structure Of Y181c Mutant Hiv-1 Reverse Transcriptase In Complex With Dmp-266(Efavirenz) Length = 560 | Back alignment and structure |
| >pdb|3MED|A Chain A, Hiv-1 K103n Reverse Transcriptase In Complex With Tmc125 Length = 560 | Back alignment and structure |
| >pdb|3DRS|A Chain A, Hiv Reverse Transcriptase K103n Mutant In Complex With Inhibitor R8d Length = 563 | Back alignment and structure |
| >pdb|2RKI|A Chain A, Crystal Structure Of Hiv-1 Reverse Transcriptase (Rt) In Complex With A Triazole Derived Nnrti Length = 560 | Back alignment and structure |
| >pdb|1JLF|A Chain A, Crystal Structure Of Y188c Mutant Hiv-1 Reverse Transcriptase In Complex With Nevirapine Length = 560 | Back alignment and structure |
| >pdb|2RF2|A Chain A, Hiv Reverse Transcriptase In Complex With Inhibitor 7e (Nnrti) Length = 563 | Back alignment and structure |
| >pdb|3KJV|A Chain A, Hiv-1 Reverse Transcriptase In Complex With Dna Length = 560 | Back alignment and structure |
| >pdb|3DI6|A Chain A, Hiv-1 Rt With Pyridazinone Non-Nucleoside Inhibitor Length = 561 | Back alignment and structure |
| >pdb|3DMJ|A Chain A, Crystal Structure Of Hiv-1 V106a And Y181c Mutant Reverse Transcriptase In Complex With Gw564511 Length = 560 | Back alignment and structure |
| >pdb|3DRR|A Chain A, Hiv Reverse Transcriptase Y181c Mutant In Complex With Inhibitor R8e Length = 563 | Back alignment and structure |
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 682 | |||
| 3qio_A | 150 | GAG-POL polyprotein; RNAse H, inhibitor, nuclease, | 99.87 | |
| 2qkb_A | 154 | Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hy | 99.87 | |
| 2kq2_A | 147 | Ribonuclease H-related protein; PSI, NESG, protein | 99.86 | |
| 3h08_A | 146 | RNH (ribonuclease H); RNAse H, 3D-structure, endon | 99.85 | |
| 3p1g_A | 165 | Xenotropic murine leukemia virus-related virus (X | 99.85 | |
| 1jl1_A | 155 | Ribonuclease HI; RNAse HI, protein stability, ther | 99.84 | |
| 2e4l_A | 158 | Ribonuclease HI, RNAse HI; hydrolase, endoribonucl | 99.83 | |
| 1ril_A | 166 | Ribonuclease H; hydrolase(endoribonuclease); 2.80A | 99.82 | |
| 2lsn_A | 165 | Reverse transcriptase; RNAse H, viral protein; NMR | 99.8 | |
| 3hst_B | 141 | Protein RV2228C/MT2287; ribonuclease H1, RV2228C N | 99.76 | |
| 3u3g_D | 140 | Ribonuclease H, RNAse H1; hydrolase, cleave the RN | 99.75 | |
| 2ehg_A | 149 | Ribonuclease HI; RNAse HI, hyperthermophilic archa | 99.73 | |
| 1mu2_A | 555 | HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polym | 99.72 | |
| 2zd1_A | 557 | Reverse transcriptase/ribonuclease H; P51/P66, het | 99.7 | |
| 1zbf_A | 142 | Ribonuclease H-related protein; RNAse H, RNA/DNA h | 99.29 | |
| 4htu_A | 134 | Ribonuclease H, RNAse H; 5-chloro-2'-deoxyuridine, | 99.04 | |
| 3fsi_A | 255 | RT, reverse transcriptase domain; transferase/DNA | 96.25 | |
| 1rw3_A | 455 | POL polyprotein; RNA and DNA dependent DNA polymer | 93.6 | |
| 3kyl_A | 596 | Telomerase reverse transcriptase; reverse transcri | 93.52 | |
| 2zd1_B | 428 | P51 RT; P51/P66, hetero dimer, NNRTI, nonnucleosid | 89.81 | |
| 2zd1_A | 557 | Reverse transcriptase/ribonuclease H; P51/P66, het | 89.59 | |
| 1mu2_A | 555 | HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polym | 88.9 |
| >3qio_A GAG-POL polyprotein; RNAse H, inhibitor, nuclease, transferase, hydrolase- complex; HET: QID; 1.40A {Hiv-1 M} SCOP: c.55.3.1 PDB: 3qin_A* 3hyf_A* 1o1w_A 3lp3_A* 1hrh_A 3k2p_A* 1rdh_A | Back alignment and structure |
|---|
Probab=99.87 E-value=1.6e-22 Score=185.97 Aligned_cols=124 Identities=23% Similarity=0.277 Sum_probs=95.7
Q ss_pred CCCeEEEEeCCCCCC--CCceEEEEEcce-eeeecCCCCCchHHHHHHHHHHHHHHHHcCCCCcEEEEcCCHHHHHhhhc
Q psy3428 325 YTSHTICYTDGSKTP--TTTGCAYSVGNV-VRSTLLNPVNSIFSAELIAIFLCLEAILDSPSGKFLIVTDSRSSLAALSN 401 (682)
Q Consensus 325 ~~~~~~iytDgS~~~--~~~G~g~~~~~~-~~~~~~~~~~~~~~aEl~Ai~~al~~~~~~~~~~v~i~sDs~~~i~~l~~ 401 (682)
..+.+.||||||+.. +..|+|+++... .....+ ..+||+.||+.|++.||+.+ ..+|.|+|||++++++|..
T Consensus 9 ~~~~~~iytDGs~~~n~g~~g~G~v~~~~~~~~~~~-~~~Tnn~aEl~A~i~AL~~~----~~~v~i~tDS~~v~~~i~~ 83 (150)
T 3qio_A 9 IVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTL-TDTTNQKTELQAIYLALQDS----GLEVNIVTDSQYALGIITQ 83 (150)
T ss_dssp CTTCEEEEEEEEECTTTCCEEEEEEETTSCEEEEEE-SSCCHHHHHHHHHHHHHHHS----CSEEEEEESCHHHHHHHHH
T ss_pred CCCCEEEEEccCCCCCCCCeEEEEEEEcCCEEEEeC-CCCCHHHHHHHHHHHHHHhC----CCcEEEEeCcHHHHHHHHH
Confidence 456899999999754 458889887632 222333 47899999999999999985 4899999999999999976
Q ss_pred CC-----------CCcH-HHHHHHHHHHHHHhcCCceEEEEecCCCCCchhHHHHHHhcCcccC
Q psy3428 402 VR-----------FINP-LITKVYSTWSYLKLCKKDITFMWCPSHCGIKGNEIVDVAAKNPTTG 453 (682)
Q Consensus 402 ~~-----------~~~~-~~~~i~~~~~~l~~~~~~v~~~WVpgH~gi~gNe~AD~lAk~a~~~ 453 (682)
+. ...+ ..+++++.+..+..++..|.|.|||||+|++|||.||+||++|+..
T Consensus 84 w~~~W~~~gw~~~~g~~v~n~~l~~~l~~~l~~~~~v~~~wV~gH~g~~~Ne~AD~LA~~a~~~ 147 (150)
T 3qio_A 84 WIHNWKKRGWKTADKKPVKNVDLVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK 147 (150)
T ss_dssp HHHHHCC------------CHHHHHHHHHHHTTCSEEEEEECCTTSCCHHHHHHHHHHHTTTSC
T ss_pred HHHHHhhcCcCcCcCcccccHHHHHHHHHHHhhcCceEEEEccCcCCChhHHHHHHHHHHHHHH
Confidence 51 1112 2245666555444567899999999999999999999999999875
|
| >2qkb_A Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hybrid; 2.40A {Homo sapiens} PDB: 2qk9_A 2qkk_A* | Back alignment and structure |
|---|
| >2kq2_A Ribonuclease H-related protein; PSI, NESG, protein structure, APO enzyme, structural genomics, protein structure initiative; NMR {Desulfitobacterium hafniense dcb-2} PDB: 2kw4_A | Back alignment and structure |
|---|
| >3h08_A RNH (ribonuclease H); RNAse H, 3D-structure, endonuclease, hydrolase, magnesium, metal-binding; 1.60A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >3p1g_A Xenotropic murine leukemia virus-related virus (X H domain; XMRV, RNAse H, reverse transcriptase, transcription; 1.50A {Xenotropic mulv-related virus} PDB: 3v1q_A 3v1o_A 3v1r_A* 2hb5_A 4e89_A | Back alignment and structure |
|---|
| >1jl1_A Ribonuclease HI; RNAse HI, protein stability, thermostability, hydrogen exchange, cooperativity, hydrolase; 1.30A {Escherichia coli} SCOP: c.55.3.1 PDB: 1f21_A 1jxb_A 1g15_A 1rch_A 1rdd_A 1rnh_A* 2rn2_A 1rda_A 1law_A 1rdb_A 1lav_A 3aa4_A 1rbu_A 1gob_A 1rdc_A 1kvc_A 3aa3_A 3aa2_A 3aa5_X 1rbv_A ... | Back alignment and structure |
|---|
| >2e4l_A Ribonuclease HI, RNAse HI; hydrolase, endoribonuclease; 2.00A {Shewanella oneidensis} PDB: 2zqb_A | Back alignment and structure |
|---|
| >1ril_A Ribonuclease H; hydrolase(endoribonuclease); 2.80A {Thermus thermophilus} SCOP: c.55.3.1 PDB: 2rpi_A | Back alignment and structure |
|---|
| >2lsn_A Reverse transcriptase; RNAse H, viral protein; NMR {Simian foamy virus} | Back alignment and structure |
|---|
| >3hst_B Protein RV2228C/MT2287; ribonuclease H1, RV2228C N-terminal domain, fusion protein, maltose binding protein, HYDR; HET: MLR TAR; 2.25A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3u3g_D Ribonuclease H, RNAse H1; hydrolase, cleave the RNA strand of RNA/DNA hybrid; 1.40A {Uncultured organism} | Back alignment and structure |
|---|
| >2ehg_A Ribonuclease HI; RNAse HI, hyperthermophilic archaeon, D stranded RNA-dependent RNAse, hydrolase; 1.60A {Sulfolobus tokodaii} PDB: 3aly_A | Back alignment and structure |
|---|
| >1mu2_A HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polymerase, drug design, transferase; 2.35A {Human immunodeficiency virus 2} SCOP: c.55.3.1 e.8.1.2 PDB: 1mu2_B | Back alignment and structure |
|---|
| >2zd1_A Reverse transcriptase/ribonuclease H; P51/P66, hetero dimer, NNRTI, nonnucleoside inhibitor, AIDS, HIV, rilpivirine, diarylpyrimidine, DAPY, DNA recombination; HET: T27; 1.80A {Human immunodeficiency virus 1} PDB: 3is9_A* 3irx_A* 2ze2_A* 3bgr_A* 3qlh_A* 3klf_A* 3qo9_A* 1dlo_A 1bqm_A 2be2_A* 1s6q_A* 1s6p_A* 1s9g_A* 1suq_A* 2b5j_A* 2b6a_A* 2ban_A* 1s9e_A* 1hni_A* 1hnv_A* ... | Back alignment and structure |
|---|
| >1zbf_A Ribonuclease H-related protein; RNAse H, RNA/DNA hybrid, DDE motif, hydrolase; 1.50A {Bacillus halodurans} SCOP: c.55.3.1 PDB: 1zbi_A 2g8u_A 2g8i_A 2g8h_A 2g8k_A 2g8f_A 2g8v_A 2g8w_A 3ey1_A* 1zbl_A 3d0p_A* 3i8d_A* 2r7y_A* | Back alignment and structure |
|---|
| >4htu_A Ribonuclease H, RNAse H; 5-chloro-2'-deoxyuridine, W-C base PAIR, wobble base PAIR, D helix; HET: DNA UCL; 1.49A {Bacillus halodurans} PDB: 3d0p_A* 4hue_A* 4huf_A* 4hug_A* 1zbf_A 1zbi_A 2g8u_A 3uld_A* 3ey1_A* 3twh_A* 2g8f_A 2g8v_A 2g8w_A 2g8i_A 2g8h_A 2g8k_A 3i8d_A* 2r7y_A* 1zbl_A | Back alignment and structure |
|---|
| >3fsi_A RT, reverse transcriptase domain; transferase/DNA MMLV RT, protein-DNA complex, drug-DNA complex; HET: OWL; 1.75A {Moloney murine leukemia virus} SCOP: e.8.1.2 PDB: 1d1u_A 1n4l_A* 1ztt_A 2fjv_A* 2fjw_A 2fjx_A* 2fvp_A 2fvq_A 2fvr_A 2fvs_A 2r2r_A* 2r2s_A* 2r2t_A* 2r2u_A* 1ztw_A* 1i6j_A 1qaj_A* 1d0e_A* 1nnd_A 1mml_A ... | Back alignment and structure |
|---|
| >1rw3_A POL polyprotein; RNA and DNA dependent DNA polymerase, reverse transcriptase, transferase, replication; 3.00A {Moloney murine leukemia virus} SCOP: e.8.1.2 | Back alignment and structure |
|---|
| >3kyl_A Telomerase reverse transcriptase; reverse transcriptase; 2.70A {Tribolium castaneum} PDB: 3du5_A 3du6_A | Back alignment and structure |
|---|
| >2zd1_B P51 RT; P51/P66, hetero dimer, NNRTI, nonnucleoside inhibitor, AIDS, HIV, rilpivirine, diarylpyrimidine, DAPY, DNA recombination; HET: T27; 1.80A {Human immunodeficiency virus 1} SCOP: e.8.1.2 PDB: 2ykm_B* 2ykn_B* 2ze2_B* 3bgr_B* 3ig1_B* 3irx_B* 3is9_B* 3qo9_B* 3v4i_B* 3v6d_B* 3v81_B* 3klf_B* 3kk1_B* 3kjv_B* 3kk2_B* 3kk3_B* 2be2_B* 1n5y_B* 1bqm_B* 1n6q_B* ... | Back alignment and structure |
|---|
| >2zd1_A Reverse transcriptase/ribonuclease H; P51/P66, hetero dimer, NNRTI, nonnucleoside inhibitor, AIDS, HIV, rilpivirine, diarylpyrimidine, DAPY, DNA recombination; HET: T27; 1.80A {Human immunodeficiency virus 1} PDB: 3is9_A* 3irx_A* 2ze2_A* 3bgr_A* 3qlh_A* 3klf_A* 3qo9_A* 1dlo_A 1bqm_A 2be2_A* 1s6q_A* 1s6p_A* 1s9g_A* 1suq_A* 2b5j_A* 2b6a_A* 2ban_A* 1s9e_A* 1hni_A* 1hnv_A* ... | Back alignment and structure |
|---|
| >1mu2_A HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polymerase, drug design, transferase; 2.35A {Human immunodeficiency virus 2} SCOP: c.55.3.1 e.8.1.2 PDB: 1mu2_B | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 682 | ||||
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 3e-10 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 4e-10 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 1e-09 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 2e-09 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 4e-09 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 5e-09 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 1e-08 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 2e-08 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 3e-08 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 4e-08 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 5e-08 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 9e-08 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 1e-07 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 2e-07 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 2e-06 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 2e-05 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 5e-05 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 2e-04 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 2e-04 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 4e-04 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 4e-04 | |
| d1sa0e_ | 138 | a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus | 2e-09 | |
| d1sa0e_ | 138 | a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus | 3e-09 | |
| d1sa0e_ | 138 | a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus | 5e-09 | |
| d1sa0e_ | 138 | a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus | 6e-09 | |
| d1sa0e_ | 138 | a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus | 9e-09 | |
| d1sa0e_ | 138 | a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus | 1e-08 | |
| d1sa0e_ | 138 | a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus | 2e-08 | |
| d1sa0e_ | 138 | a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus | 2e-08 | |
| d1sa0e_ | 138 | a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus | 3e-08 | |
| d1sa0e_ | 138 | a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus | 5e-08 | |
| d1sa0e_ | 138 | a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus | 8e-08 | |
| d1sa0e_ | 138 | a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus | 3e-07 | |
| d1sa0e_ | 138 | a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus | 5e-07 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 1e-06 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 3e-04 | |
| d1mu2a1 | 126 | c.55.3.1 (A:430-555) HIV RNase H (Domain of revers | 2e-06 | |
| d1mu2a1 | 126 | c.55.3.1 (A:430-555) HIV RNase H (Domain of revers | 8e-04 | |
| d2ayua1 | 301 | d.305.1.1 (A:70-370) Nucleosome assembly protein, | 1e-04 | |
| d2ayua1 | 301 | d.305.1.1 (A:70-370) Nucleosome assembly protein, | 2e-04 | |
| d2ayua1 | 301 | d.305.1.1 (A:70-370) Nucleosome assembly protein, | 3e-04 | |
| d2ayua1 | 301 | d.305.1.1 (A:70-370) Nucleosome assembly protein, | 3e-04 | |
| d2ayua1 | 301 | d.305.1.1 (A:70-370) Nucleosome assembly protein, | 5e-04 | |
| d2ayua1 | 301 | d.305.1.1 (A:70-370) Nucleosome assembly protein, | 5e-04 | |
| d2ayua1 | 301 | d.305.1.1 (A:70-370) Nucleosome assembly protein, | 5e-04 | |
| d2ayua1 | 301 | d.305.1.1 (A:70-370) Nucleosome assembly protein, | 5e-04 | |
| d2ayua1 | 301 | d.305.1.1 (A:70-370) Nucleosome assembly protein, | 8e-04 | |
| d2ayua1 | 301 | d.305.1.1 (A:70-370) Nucleosome assembly protein, | 9e-04 | |
| d2ayua1 | 301 | d.305.1.1 (A:70-370) Nucleosome assembly protein, | 0.001 | |
| d2ayua1 | 301 | d.305.1.1 (A:70-370) Nucleosome assembly protein, | 0.001 | |
| d2ayua1 | 301 | d.305.1.1 (A:70-370) Nucleosome assembly protein, | 0.001 | |
| d2ayua1 | 301 | d.305.1.1 (A:70-370) Nucleosome assembly protein, | 0.002 | |
| d2ayua1 | 301 | d.305.1.1 (A:70-370) Nucleosome assembly protein, | 0.002 | |
| d2ayua1 | 301 | d.305.1.1 (A:70-370) Nucleosome assembly protein, | 0.003 | |
| d1siga_ | 334 | a.177.1.1 (A:) Sigma70 {Escherichia coli [TaxId: 5 | 1e-04 | |
| d1siga_ | 334 | a.177.1.1 (A:) Sigma70 {Escherichia coli [TaxId: 5 | 4e-04 | |
| d1ofcx3 | 102 | a.187.1.1 (X:697-798) HAND domain of the nucleosom | 2e-04 | |
| d1ofcx3 | 102 | a.187.1.1 (X:697-798) HAND domain of the nucleosom | 4e-04 | |
| d1ofcx3 | 102 | a.187.1.1 (X:697-798) HAND domain of the nucleosom | 6e-04 | |
| d1ofcx3 | 102 | a.187.1.1 (X:697-798) HAND domain of the nucleosom | 6e-04 | |
| d1ofcx3 | 102 | a.187.1.1 (X:697-798) HAND domain of the nucleosom | 8e-04 | |
| d1ofcx3 | 102 | a.187.1.1 (X:697-798) HAND domain of the nucleosom | 8e-04 | |
| d1ofcx3 | 102 | a.187.1.1 (X:697-798) HAND domain of the nucleosom | 0.001 | |
| d1ofcx3 | 102 | a.187.1.1 (X:697-798) HAND domain of the nucleosom | 0.002 | |
| d1ofcx3 | 102 | a.187.1.1 (X:697-798) HAND domain of the nucleosom | 0.003 | |
| d1ofcx3 | 102 | a.187.1.1 (X:697-798) HAND domain of the nucleosom | 0.003 | |
| d2ap3a1 | 185 | a.24.27.1 (A:12-196) Hypothetical protein MW0975 ( | 2e-04 | |
| d2ap3a1 | 185 | a.24.27.1 (A:12-196) Hypothetical protein MW0975 ( | 4e-04 | |
| d2ap3a1 | 185 | a.24.27.1 (A:12-196) Hypothetical protein MW0975 ( | 8e-04 | |
| d2ap3a1 | 185 | a.24.27.1 (A:12-196) Hypothetical protein MW0975 ( | 0.001 | |
| d1ulya_ | 190 | a.4.5.58 (A:) Hypothetical protein PH1932 {Pyrococ | 5e-04 | |
| d1qkla_ | 127 | a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: | 0.001 | |
| d1qkla_ | 127 | a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: | 0.002 | |
| d1qkla_ | 127 | a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: | 0.002 | |
| d1qkla_ | 127 | a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: | 0.002 | |
| d1qkla_ | 127 | a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: | 0.002 | |
| d1qkla_ | 127 | a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: | 0.002 | |
| d1s1ta1 | 110 | c.55.3.1 (A:430-539) HIV RNase H (Domain of revers | 0.002 | |
| d1jfib_ | 135 | a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain | 0.002 | |
| d1jfib_ | 135 | a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain | 0.003 | |
| d1jl1a_ | 152 | c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli | 0.003 |
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain superfamily: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain family: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain domain: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 59.4 bits (143), Expect = 3e-10
Identities = 11/68 (16%), Positives = 34/68 (50%)
Query: 587 RIENIIQLIRRGEREEEEEEEEEEEEEEEEEEEEEEEEEVQEEEEEEEEEEEEEEEEEEE 646
+ +N + ++ +E ++ E+ E + + +E+E + +E+E+ +E ++E
Sbjct: 227 QRKNEQMMEQKERSYQEHLKQLTEKMENDRVQLLKEQERTLALKLQEQEQLLKEGFQKES 286
Query: 647 EEEEEEVR 654
+ E++
Sbjct: 287 RIMKNEIQ 294
|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
| >d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
| >d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
| >d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
| >d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
| >d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
| >d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
| >d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
| >d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
| >d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
| >d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
| >d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
| >d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
| >d1mu2a1 c.55.3.1 (A:430-555) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 2 [TaxId: 11709]} Length = 126 | Back information, alignment and structure |
|---|
| >d1mu2a1 c.55.3.1 (A:430-555) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 2 [TaxId: 11709]} Length = 126 | Back information, alignment and structure |
|---|
| >d2ayua1 d.305.1.1 (A:70-370) Nucleosome assembly protein, NAP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d2ayua1 d.305.1.1 (A:70-370) Nucleosome assembly protein, NAP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d2ayua1 d.305.1.1 (A:70-370) Nucleosome assembly protein, NAP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d2ayua1 d.305.1.1 (A:70-370) Nucleosome assembly protein, NAP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d2ayua1 d.305.1.1 (A:70-370) Nucleosome assembly protein, NAP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d2ayua1 d.305.1.1 (A:70-370) Nucleosome assembly protein, NAP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d2ayua1 d.305.1.1 (A:70-370) Nucleosome assembly protein, NAP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d2ayua1 d.305.1.1 (A:70-370) Nucleosome assembly protein, NAP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d2ayua1 d.305.1.1 (A:70-370) Nucleosome assembly protein, NAP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d2ayua1 d.305.1.1 (A:70-370) Nucleosome assembly protein, NAP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d2ayua1 d.305.1.1 (A:70-370) Nucleosome assembly protein, NAP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d2ayua1 d.305.1.1 (A:70-370) Nucleosome assembly protein, NAP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d2ayua1 d.305.1.1 (A:70-370) Nucleosome assembly protein, NAP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d2ayua1 d.305.1.1 (A:70-370) Nucleosome assembly protein, NAP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d2ayua1 d.305.1.1 (A:70-370) Nucleosome assembly protein, NAP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d2ayua1 d.305.1.1 (A:70-370) Nucleosome assembly protein, NAP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1siga_ a.177.1.1 (A:) Sigma70 {Escherichia coli [TaxId: 562]} Length = 334 | Back information, alignment and structure |
|---|
| >d1siga_ a.177.1.1 (A:) Sigma70 {Escherichia coli [TaxId: 562]} Length = 334 | Back information, alignment and structure |
|---|
| >d1ofcx3 a.187.1.1 (X:697-798) HAND domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 102 | Back information, alignment and structure |
|---|
| >d1ofcx3 a.187.1.1 (X:697-798) HAND domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 102 | Back information, alignment and structure |
|---|
| >d1ofcx3 a.187.1.1 (X:697-798) HAND domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 102 | Back information, alignment and structure |
|---|
| >d1ofcx3 a.187.1.1 (X:697-798) HAND domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 102 | Back information, alignment and structure |
|---|
| >d1ofcx3 a.187.1.1 (X:697-798) HAND domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 102 | Back information, alignment and structure |
|---|
| >d1ofcx3 a.187.1.1 (X:697-798) HAND domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 102 | Back information, alignment and structure |
|---|
| >d1ofcx3 a.187.1.1 (X:697-798) HAND domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 102 | Back information, alignment and structure |
|---|
| >d1ofcx3 a.187.1.1 (X:697-798) HAND domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 102 | Back information, alignment and structure |
|---|
| >d1ofcx3 a.187.1.1 (X:697-798) HAND domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 102 | Back information, alignment and structure |
|---|
| >d1ofcx3 a.187.1.1 (X:697-798) HAND domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 102 | Back information, alignment and structure |
|---|
| >d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} Length = 185 | Back information, alignment and structure |
|---|
| >d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} Length = 185 | Back information, alignment and structure |
|---|
| >d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} Length = 185 | Back information, alignment and structure |
|---|
| >d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} Length = 185 | Back information, alignment and structure |
|---|
| >d1ulya_ a.4.5.58 (A:) Hypothetical protein PH1932 {Pyrococcus horikoshii [TaxId: 53953]} Length = 190 | Back information, alignment and structure |
|---|
| >d1qkla_ a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: 9606]} Length = 127 | Back information, alignment and structure |
|---|
| >d1qkla_ a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: 9606]} Length = 127 | Back information, alignment and structure |
|---|
| >d1qkla_ a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: 9606]} Length = 127 | Back information, alignment and structure |
|---|
| >d1qkla_ a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: 9606]} Length = 127 | Back information, alignment and structure |
|---|
| >d1qkla_ a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: 9606]} Length = 127 | Back information, alignment and structure |
|---|
| >d1qkla_ a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: 9606]} Length = 127 | Back information, alignment and structure |
|---|
| >d1s1ta1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]} Length = 110 | Back information, alignment and structure |
|---|
| >d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 135 | Back information, alignment and structure |
|---|
| >d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 135 | Back information, alignment and structure |
|---|
| >d1jl1a_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]} Length = 152 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 682 | |||
| d1mu2a1 | 126 | HIV RNase H (Domain of reverse transcriptase) {Hum | 99.88 | |
| d1rila_ | 147 | RNase H (RNase HI) {Thermus thermophilus [TaxId: 2 | 99.83 | |
| d1jl1a_ | 152 | RNase H (RNase HI) {Escherichia coli [TaxId: 562]} | 99.82 | |
| d1s1ta1 | 110 | HIV RNase H (Domain of reverse transcriptase) {Hum | 99.69 | |
| d1zbfa1 | 132 | BH0863-like Ribonuclease H {Bacillus halodurans [T | 99.45 | |
| d1ztwa1 | 255 | MMLV reverse transcriptase {Moloney murine leukemi | 94.28 |
| >d1mu2a1 c.55.3.1 (A:430-555) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 2 [TaxId: 11709]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Ribonuclease H-like motif superfamily: Ribonuclease H-like family: Ribonuclease H domain: HIV RNase H (Domain of reverse transcriptase) species: Human immunodeficiency virus type 2 [TaxId: 11709]
Probab=99.88 E-value=1.7e-23 Score=185.31 Aligned_cols=119 Identities=24% Similarity=0.257 Sum_probs=88.7
Q ss_pred CCeEEEEeCCCCCC--CCceEEEEEcce-eeeecCCCCCchHHHHHHHHHHHHHHHHcCCCCcEEEEcCCHHHHHhhhcC
Q psy3428 326 TSHTICYTDGSKTP--TTTGCAYSVGNV-VRSTLLNPVNSIFSAELIAIFLCLEAILDSPSGKFLIVTDSRSSLAALSNV 402 (682)
Q Consensus 326 ~~~~~iytDgS~~~--~~~G~g~~~~~~-~~~~~~~~~~~~~~aEl~Ai~~al~~~~~~~~~~v~i~sDs~~~i~~l~~~ 402 (682)
++...+|||||+.. +.+|+|+++... .....++ .+||+.|||.||++||+. ....+.|+|||++++..+.+.
T Consensus 5 ~~~~t~YTDGS~~~n~~~~~~g~~~~~~~~~~~~~~-~~tnn~AEl~Ai~~al~~----~~~~i~I~tDS~~v~~~~~~~ 79 (126)
T d1mu2a1 5 PGAETFYTDGSCNRQSKEGKAGYVTDRGKDKVKKLE-QTTNQQAELEAFAMALTD----SGPKVNIIVDSQYVMGIVASQ 79 (126)
T ss_dssp TTCEEEEEEEEECTTTCCEEEEEEETTSCEEEEEES-SCCHHHHHHHHHHHHHHT----SCSEEEEEESCHHHHHHHHTC
T ss_pred CCCcEEEEcCCCCCCCCcEEEEEEecCCCEEEEecC-CCcchHHHHHHHHHHhcc----CCcceEEEechHHHHHHHhcC
Confidence 34578999999764 346777776643 3333333 579999999999999985 367899999999999999887
Q ss_pred CCCcHHHHHHHHHHHHHHhcCCceEEEEecCCCCCchhHHHHHHhcCcc
Q psy3428 403 RFINPLITKVYSTWSYLKLCKKDITFMWCPSHCGIKGNEIVDVAAKNPT 451 (682)
Q Consensus 403 ~~~~~~~~~i~~~~~~l~~~~~~v~~~WVpgH~gi~gNe~AD~lAk~a~ 451 (682)
...+.. ......+..+.. ...|.|.|||||+|++|||+||+||++|+
T Consensus 80 ~~~~~~-~~~~~~~~~~~~-~~~v~~~wV~gH~g~~gNe~AD~LA~~ai 126 (126)
T d1mu2a1 80 PTESES-KIVNQIIEEMIK-KEAIYVAWVPAHKGIGGNQEVDHLVSQGI 126 (126)
T ss_dssp CSEESC-HHHHHHHHHHHH-CSEEEEEECCSSSCCTTHHHHHHHHHTTC
T ss_pred Cccccc-hHHHHHHHHhhh-cceeEEEEEeCCCCCcchHHHHHHHHhhC
Confidence 654310 112222333333 46899999999999999999999999985
|
| >d1rila_ c.55.3.1 (A:) RNase H (RNase HI) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jl1a_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s1ta1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]} | Back information, alignment and structure |
|---|
| >d1zbfa1 c.55.3.1 (A:62-193) BH0863-like Ribonuclease H {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1ztwa1 e.8.1.2 (A:24-278) MMLV reverse transcriptase {Moloney murine leukemia virus, MoMLV [TaxId: 11801]} | Back information, alignment and structure |
|---|