Psyllid ID: psy3619


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------42
MCDQKTLWTPSSLVPDCVSEDTQQADYHIVASIAYRANGAVANLCLKPTFISPTPLFPVINDTPNDSIPGTCTDLVGGFSCSCDLGFTGKHCQHLIDDCASEPCQNGGSCVDMLDGFMCQCRPGFVGLQCEADIDECLSDPCSPEGTDKCLDLDNKFQCECNVGYTGVMCETNIDDCKSNPCLNGGICRDGVAKFTCDCPPGWTGSRCEKDIGSCTNMPCQNDANCIDLFQDFFCVSSHSVQGRRPLIQAHSSGVQVSLFPELQDAFLAFHEYATINDGQWHHVAIVWTQGTLTLITEGLIAGKVENYGSGKSLPQYGWVVLGKPRPDNIKAYTEAGFEGKLTKVQIWNRALDFTNEIQKQVRDCRTEPVLHTGLVLTWTGYDDINGGVERVVPSHCSQHICPPGYTGPECDQLTVDK
ccccccccccccccccccccccccccccccccccEEcccccccEEcccccccccccccccccccccccccEEccccccEEEEccccccccccccccccccccccccccEEEcccccEEEcccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccEEEEccccEEEEccccccccccccccccccccccccccEEEEccccEEEEccccccccccccccccccccccccccccccccccccEEcccccccEEEEEcccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccEEEEcccccEEEEccccccccccccccccc
ccccccccccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccHHHHcccccccEEEEEccEEEEEccccEEcccccEEccccccccccccccEEEEcccccEEEEccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccccccccccccEEEEccccccccEcccccccccccccccccEcccccccEEEEccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccEEccccccEEEEccccccccccccccccc
mcdqktlwtpsslvpdcvsedtqqaDYHIVASIAYRANGavanlclkptfisptplfpvindtpndsipgtctdlvggfscscdlgftgkhcqhliddcasepcqnggscvdmldgfmcqcrpgfvglqceadideclsdpcspegtdkcldldnkfqcecnvgytgvmcetniddcksnpclnggicrdgvakftcdcppgwtgsrcekdigsctnmpcqndanciDLFQdffcvsshsvqgrrpliqahssgvqvslfPELQDAFLAFHEYatindgqwHHVAIVWTQGTLTLITEGLIAgkvenygsgkslpqygwvvlgkprpdnikayteagfegklTKVQIWNRALDFTNEIQKQVRdcrtepvlhtgLVLTwtgyddinggvervvpshcsqhicppgytgpecdqltvdk
mcdqktlwtpsslvpdcVSEDTQQADYHIVASIAYRANGAVANLCLKPTFISPTPLFPVINDTPNDSIPGTCTDLVGGFSCSCDLGFTGKHCQHLIDDCASEPCQNGGSCVDMLDGFMCQCRPGFVGLQCEADIDECLSDPCSPEGTDKCLDLDNKFQCECNVGYTGVMCETNIDDCKSNPCLNGGICRDGVAKFTCDCPPGWTGSRCEKDIGSCTNMPCQNDANCIDLFQDFFCVSSHSVQGRRPLIQAHSSGVQVSLFPELQDAFLAFHEYATINDGQWHHVAIVWTQGTLTLITEGLIAGKVENYGSGKSLPQYGWVVLGKPRPDNIKAYTEAGFEGKLTKVQIWNRALDFTNEIQKqvrdcrtepvlHTGLVLTWTGYDDINGGVERVVPSHCSqhicppgytgpecdQLTVDK
MCDQKTLWTPSSLVPDCVSEDTQQADYHIVASIAYRANGAVANLCLKPTFISPTPLFPVINDTPNDSIPGTCTDLVGGFSCSCDLGFTGKHCQHLIDDCASEPCQNGGSCVDMLDGFMCQCRPGFVGLQCEADIDECLSDPCSPEGTDKCLDLDNKFQCECNVGYTGVMCETNIDDCKSNPCLNGGICRDGVAKFTCDCPPGWTGSRCEKDIGSCTNMPCQNDANCIDLFQDFFCVSSHSVQGRRPLIQAHSSGVQVSLFPELQDAFLAFHEYATINDGQWHHVAIVWTQGTLTLITEGLIAGKVENYGSGKSLPQYGWVVLGKPRPDNIKAYTEAGFEGKLTKVQIWNRALDFTNEIQKQVRDCRTEPVLHTGLVLTWTGYDDINGGVERVVPSHCSQHICPPGYTGPECDQLTVDK
************LVPDCVSEDTQQADYHIVASIAYRANGAVANLCLKPTFISPTPLFPVINDTPNDSIPGTCTDLVGGFSCSCDLGFTGKHCQHLIDDCASEPCQNGGSCVDMLDGFMCQCRPGFVGLQCEADIDECLSDPCSPEGTDKCLDLDNKFQCECNVGYTGVMCETNIDDCKSNPCLNGGICRDGVAKFTCDCPPGWTGSRCEKDIGSCTNMPCQNDANCIDLFQDFFCVSSHSVQGRRPLIQAHSSGVQVSLFPELQDAFLAFHEYATINDGQWHHVAIVWTQGTLTLITEGLIAGKVENYGSGKSLPQYGWVVLGKPRPDNIKAYTEAGFEGKLTKVQIWNRALDFTNEIQKQVRDCRTEPVLHTGLVLTWTGYDDINGGVERVVPSHCSQHICPPGYT***********
MCDQKTLWTPSSLVPDCVSEDTQQADYHIVASIAYRANGAVANLCLKPTFISPTPLFPVINDTPNDSIPGTCTDLVGGFSCSCDLGFTGKHCQHLIDDCASEPCQNGGSCVDMLDGFMCQCRPGFVGLQCEADIDECLSDPCSPEGTDKCLDLDNKFQCECNVGYTGVMCETNIDDCKSNPCLNGGICRDGVAKFTCDCPPGWTGSRCEKDIGSCTNMPCQNDANCIDLFQDFFCVSSHSVQGRRPLIQAHSSGVQVSLFPELQDAFLAFHEYATINDGQWHHVAIVWTQGTLTLITEGLIAGKVENYGSGKSLPQYGWVVLGKPRPDNIKAYTEAGFEGKLTKVQIWNRALDFTNEIQKQVRDCRTEPVLHTGLVLTWTGYDDINGGVERVVPSHCSQHICPPGYTGPECDQLTVDK
*********PSSLVPDCVSEDTQQADYHIVASIAYRANGAVANLCLKPTFISPTPLFPVINDTPNDSIPGTCTDLVGGFSCSCDLGFTGKHCQHLIDDCASEPCQNGGSCVDMLDGFMCQCRPGFVGLQCEADIDECLSDPCSPEGTDKCLDLDNKFQCECNVGYTGVMCETNIDDCKSNPCLNGGICRDGVAKFTCDCPPGWTGSRCEKDIGSCTNMPCQNDANCIDLFQDFFCVSSHSVQGRRPLIQAHSSGVQVSLFPELQDAFLAFHEYATINDGQWHHVAIVWTQGTLTLITEGLIAGKVENYGSGKSLPQYGWVVLGKPRPDNIKAYTEAGFEGKLTKVQIWNRALDFTNEIQKQVRDCRTEPVLHTGLVLTWTGYDDINGGVERVVPSHCSQHICPPGYTGPECDQLTVDK
MCDQKTLWTPSSLVPDCVSEDTQQADYHIVASIAYRANGAVANLCLKPTFISPTPLFPVINDTPNDSIPGTCTDLVGGFSCSCDLGFTGKHCQHLIDDCASEPCQNGGSCVDMLDGFMCQCRPGFVGLQCEADIDECLSDPCSPEGTDKCLDLDNKFQCECNVGYTGVMCETNIDDCKSNPCLNGGICRDGVAKFTCDCPPGWTGSRCEKDIGSCTNMPCQNDANCIDLFQDFFCVSSHSVQGRRPLIQAHSSGVQVSLFPELQDAFLAFHEYATINDGQWHHVAIVWTQGTLTLITEGLIAGKVENYGSGKSLPQYGWVVLGKPRPDNIKAYTEAGFEGKLTKVQIWNRALDFTNEIQKQVRDCRTEPVLHTGLVLTWTGYDDINGGVERVVPSHCSQHICPPGYTGPECD******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCDQKTLWTPSSLVPDCVSEDTQQADYHIVASIAYRANGAVANLCLKPTFISPTPLFPVINDTPNDSIPGTCTDLVGGFSCSCDLGFTGKHCQHLIDDCASEPCQNGGSCVDMLDGFMCQCRPGFVGLQCEADIDECLSDPCSPEGTDKCLDLDNKFQCECNVGYTGVMCETNIDDCKSNPCLNGGICRDGVAKFTCDCPPGWTGSRCEKDIGSCTNMPCQNDANCIDLFQDFFCVSSHSVQGRRPLIQAHSSGVQVSLFPELQDAFLAFHEYATINDGQWHHVAIVWTQGTLTLITEGLIAGKVENYGSGKSLPQYGWVVLGKPRPDNIKAYTEAGFEGKLTKVQIWNRALDFTNEIQKQVRDCRTEPVLHTGLVLTWTGYDDINGGVERVVPSHCSQHICPPGYTGPECDQLTVDK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query418 2.2.26 [Sep-21-2011]
A2AVA0 3567 Sushi, von Willebrand fac yes N/A 0.755 0.088 0.308 2e-46
Q4LDE5 3571 Sushi, von Willebrand fac yes N/A 0.751 0.087 0.328 4e-44
P100791064 Fibropellin-1 OS=Strongyl no N/A 0.708 0.278 0.342 1e-43
P0C6B8 3564 Sushi, von Willebrand fac yes N/A 0.755 0.088 0.308 1e-43
P49013570 Fibropellin-3 OS=Strongyl no N/A 0.409 0.3 0.494 1e-41
P07207 2703 Neurogenic locus Notch pr no N/A 0.392 0.060 0.497 1e-40
O35516 2470 Neurogenic locus notch ho no N/A 0.413 0.070 0.451 1e-39
P46530 2437 Neurogenic locus notch ho no N/A 0.411 0.070 0.454 2e-39
Q04721 2471 Neurogenic locus notch ho no N/A 0.416 0.070 0.441 4e-39
Q9QW30 2471 Neurogenic locus notch ho no N/A 0.413 0.070 0.451 2e-38
>sp|A2AVA0|SVEP1_MOUSE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Mus musculus GN=Svep1 PE=1 SV=1 Back     alignment and function desciption
 Score =  186 bits (473), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 118/382 (30%), Positives = 174/382 (45%), Gaps = 66/382 (17%)

Query: 70   GTCTDLVGGFSCSCDLGFTGKHCQHLIDDCASEPCQNGGSCVDMLDGFMCQCRPGFVGLQ 129
            G C D VGGF+C C LG++G+ C+  I++C S PC N G+C D L  + C C  G++G+ 
Sbjct: 1243 GICRDQVGGFTCECSLGYSGQICEENINECISSPCLNKGTCTDGLASYRCTCVKGYMGVH 1302

Query: 130  CEADIDECLSDPCSPEGTDKCLDLDNKFQCECNVGYTGVMCETNIDDCKSNPCLNGGICR 189
            CE D++EC S PC       C D    F C+C  G+ G  CE N+D+C S PC NG  C+
Sbjct: 1303 CETDVNECQSSPCLNNAV--CKDQVGGFSCKCPPGFLGTRCEKNVDECLSQPCQNGATCK 1360

Query: 190  DGVAKFTCDCPPGWTGSRCEKDIGSCTNMPCQNDANCIDLFQDFFC-----VSSHSVQGR 244
            DG   F C CP G+TG+ CE +I  C + PC+N A C+D    + C      S H  +  
Sbjct: 1361 DGANSFRCQCPAGFTGTHCELNINECQSNPCRNQATCVDELNSYSCKCQPGFSGHRCETE 1420

Query: 245  RPL---IQAHSSGVQV-----SLFPELQDAFLAFH-------------EYA--------- 274
            +P    +    SG+        + P L     AF               YA         
Sbjct: 1421 QPSGFNLDFEVSGIYGYVLLDGVLPTLHAITCAFWMKSSDVINYGTPISYALEDDKDNTF 1480

Query: 275  ----------------------TINDGQWHHVAIVWTQ--GTLTLITEGLIAGKVENYGS 310
                                  ++NDG WHH+AI WT   G   +  +G ++        
Sbjct: 1481 LLTDYNGWVLYVNGKEKITNCPSVNDGIWHHIAITWTSTGGAWRVYIDGELSDGGTGLSI 1540

Query: 311  GKSLPQYGWVVLGKPRPDNIKAYTEA-GFEGKLTKVQIWNRALDFTNEIQKQVRDCRTEP 369
            GK++P  G +VLG+ +    + +  A  F G ++++ +W+  L    +++     C  E 
Sbjct: 1541 GKAIPGGGALVLGQEQDKKGEGFNPAESFVGSISQLNLWDYVLS-PQQVKLLASSCPEE- 1598

Query: 370  VLHTGLVLTWTGY-DDINGGVE 390
             L  G VL W  +   I G V+
Sbjct: 1599 -LSRGNVLAWPDFLSGITGKVK 1619




May play a role in the cell attachment process.
Mus musculus (taxid: 10090)
>sp|Q4LDE5|SVEP1_HUMAN Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Homo sapiens GN=SVEP1 PE=1 SV=3 Back     alignment and function description
>sp|P10079|FBP1_STRPU Fibropellin-1 OS=Strongylocentrotus purpuratus GN=EGF1 PE=1 SV=2 Back     alignment and function description
>sp|P0C6B8|SVEP1_RAT Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Rattus norvegicus GN=Svep1 PE=1 SV=1 Back     alignment and function description
>sp|P49013|FBP3_STRPU Fibropellin-3 OS=Strongylocentrotus purpuratus GN=EGF3 PE=1 SV=1 Back     alignment and function description
>sp|P07207|NOTCH_DROME Neurogenic locus Notch protein OS=Drosophila melanogaster GN=N PE=1 SV=3 Back     alignment and function description
>sp|O35516|NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus GN=Notch2 PE=1 SV=1 Back     alignment and function description
>sp|P46530|NOTC1_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio GN=notch1a PE=2 SV=1 Back     alignment and function description
>sp|Q04721|NOTC2_HUMAN Neurogenic locus notch homolog protein 2 OS=Homo sapiens GN=NOTCH2 PE=1 SV=3 Back     alignment and function description
>sp|Q9QW30|NOTC2_RAT Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus GN=Notch2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query418
328723934 3561 PREDICTED: hypothetical protein LOC10016 0.827 0.097 0.476 1e-99
350413330 3564 PREDICTED: hypothetical protein LOC10074 0.830 0.097 0.464 9e-95
270002799 3631 hypothetical protein TcasGA2_TC000871 [T 0.808 0.093 0.509 1e-94
189234400 3570 PREDICTED: similar to SP1070 CG9138-PA [ 0.808 0.094 0.509 2e-94
307180183 3602 Fibropellin-1 [Camponotus floridanus] 0.830 0.096 0.466 2e-94
383856229 3582 PREDICTED: uncharacterized protein LOC10 0.799 0.093 0.523 2e-92
328782396 3510 PREDICTED: hypothetical protein LOC41282 0.806 0.096 0.516 6e-92
340717389 3564 PREDICTED: hypothetical protein LOC10064 0.799 0.093 0.521 3e-91
307209910 3536 Fibropellin-1 [Harpegnathos saltator] 0.834 0.098 0.459 3e-91
332016443 3485 Fibropellin-1 [Acromyrmex echinatior] 0.834 0.100 0.452 1e-90
>gi|328723934|ref|XP_001949468.2| PREDICTED: hypothetical protein LOC100162025 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  369 bits (948), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 199/418 (47%), Positives = 240/418 (57%), Gaps = 72/418 (17%)

Query: 70   GTCTDLVGGFSCSCDLGFTGKHCQHLIDDCASEPCQNGGSCVDMLDGFMCQCRPGFVGLQ 129
            G C D V  FSC C  G+TGK C+  +  C S+PC N  +C+++   + C C  G  G Q
Sbjct: 2381 GKCYDGVNTFSCQCPPGWTGKRCEIDLSSCQSKPCYNDATCINLFQDYFCVCPSGTDGKQ 2440

Query: 130  CEADIDECLSDPCSPEGTDKCLDLDNKFQCECNVGYTGVMCETNIDDCKSNPCLNGGICR 189
            CE   + C+ +PC   G  +C D  +   C C   Y G+ C+   D C++N C NG  C 
Sbjct: 2441 CETAPERCIGNPCMHGG--RCQDFGSGLNCTCPSDYDGIGCQYEFDACQANTCKNGATCI 2498

Query: 190  DG--------------------------------------VAKFTCDCPPGWTGSRCEKD 211
            D                                         KF C CP   TG  C K 
Sbjct: 2499 DNGPGYKCICPPGFMGKNCDEDIVDCKENSCPPTATCIDLTNKFYCQCPFNLTGDDCRKT 2558

Query: 212  I--------------GSCTNMPCQ----NDANCIDL-------------FQDFFCVSSHS 240
            I               +   +P Q     D+  I +             F  +   S H 
Sbjct: 2559 IQVDYDFSFPEETLSSAALTVPFQFTGARDSFTIAMWVQYAQKDEPGIFFTLYSVTSPHV 2618

Query: 241  VQGRRPLIQAHSSGVQVSLFPELQDAFLAFHEYATINDGQWHHVAIVWTQGTLTLITEGL 300
            VQG+R LIQAHSSGV+VS+FPELQD FLAFHEY TINDGQWHH+AIVW QGTLTLITEGL
Sbjct: 2619 VQGQRVLIQAHSSGVEVSIFPELQDVFLAFHEYTTINDGQWHHIAIVWNQGTLTLITEGL 2678

Query: 301  IAGKVENYGSGKSLPQYGWVVLGKPRPDNIKAYTEAGFEGKLTKVQIWNRALDFTNEIQK 360
            IA K+E YG+G+ LP++GW VLGKPR D  K +TEAGF+G+L KVQ+W RALD TNE+QK
Sbjct: 2679 IASKMEGYGTGRKLPEFGWAVLGKPRMDR-KTFTEAGFKGQLNKVQVWGRALDVTNEVQK 2737

Query: 361  QVRDCRTEPVLHTGLVLTWTGYDDINGGVERVVPSHCSQHICPPGYTGPECDQLTVDK 418
            QVRDCRTEPVL+ GLVLTW G+DDI GGVER+VPS CSQH CP GYTGP C+QL VDK
Sbjct: 2738 QVRDCRTEPVLYQGLVLTWAGFDDIQGGVERIVPSKCSQHSCPVGYTGPNCEQLQVDK 2795




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|350413330|ref|XP_003489961.1| PREDICTED: hypothetical protein LOC100747564 [Bombus impatiens] Back     alignment and taxonomy information
>gi|270002799|gb|EEZ99246.1| hypothetical protein TcasGA2_TC000871 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189234400|ref|XP_974965.2| PREDICTED: similar to SP1070 CG9138-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307180183|gb|EFN68216.1| Fibropellin-1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383856229|ref|XP_003703612.1| PREDICTED: uncharacterized protein LOC100879487 [Megachile rotundata] Back     alignment and taxonomy information
>gi|328782396|ref|XP_396277.4| PREDICTED: hypothetical protein LOC412825 [Apis mellifera] Back     alignment and taxonomy information
>gi|340717389|ref|XP_003397166.1| PREDICTED: hypothetical protein LOC100648516 [Bombus terrestris] Back     alignment and taxonomy information
>gi|307209910|gb|EFN86689.1| Fibropellin-1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332016443|gb|EGI57356.1| Fibropellin-1 [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query418
FB|FBgn0031879 3589 uif "uninflatable" [Drosophila 0.806 0.093 0.484 3.1e-95
WB|WBGene00018546 3170 F47C12.1 [Caenorhabditis elega 0.413 0.054 0.439 7.3e-63
RGD|1588987 3564 Svep1 "sushi, von Willebrand f 0.416 0.048 0.437 5e-55
UNIPROTKB|P0C6B8 3564 Svep1 "Sushi, von Willebrand f 0.416 0.048 0.437 5e-55
MGI|MGI:1928849 3567 Svep1 "sushi, von Willebrand f 0.392 0.045 0.475 2.7e-54
UNIPROTKB|F1SND0 3573 SVEP1 "Uncharacterized protein 0.435 0.050 0.423 9.3e-54
UNIPROTKB|F1MNH3 3573 SVEP1 "Uncharacterized protein 0.416 0.048 0.414 6.3e-53
UNIPROTKB|F1Q0A7 3253 SVEP1 "Uncharacterized protein 0.392 0.050 0.457 8.4e-53
UNIPROTKB|J9NWK3 3569 SVEP1 "Uncharacterized protein 0.392 0.045 0.457 1.1e-52
UNIPROTKB|J9P1K9 3640 SVEP1 "Uncharacterized protein 0.392 0.045 0.457 1.1e-52
FB|FBgn0031879 uif "uninflatable" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 831 (297.6 bits), Expect = 3.1e-95, Sum P(2) = 3.1e-95
 Identities = 172/355 (48%), Positives = 212/355 (59%)

Query:    70 GTCTDLVGGFSCSCDLGFTGKHCQHLIDDCASEPCQNGGSCVDMLDGFMCQCRPGFVGLQ 129
             G C D   G +CSC   ++G  CQ+  D C    CQNG +CVD   G+ CQC PGF G  
Sbjct:  2459 GKCQDFGSGLNCSCPADYSGIGCQYEYDACEEHVCQNGATCVDNGAGYSCQCPPGFTGRN 2518

Query:   130 CEADIDECLSDPCSPEGTDKCLDLDNKFQCECNVGYTGVMCETNIDDCKSNPCLNGGICR 189
             CE DI +C  + C P  T  C+DL N F C+C    TG       DDC+    ++  +  
Sbjct:  2519 CEQDIVDCKDNSCPPGAT--CVDLTNGFYCQCPFNMTG-------DDCRKAIQVDYDLYF 2569

Query:   190 DGVAKFTC-DCPPGWTGSRCEKDIGSCTNMPCQNDANCIDLFQDFFCVSSHSVQGRRPLI 248
                ++ T     P  TG      +        Q D   I  F  +   S+   Q RR L+
Sbjct:  2570 SDPSRSTAAQVVPFPTGEANSLTVAMWVQF-AQKDDRGI-FFTLYGVQSARMTQQRRMLL 2627

Query:   249 QAHSSGVQVSLFPELQDAFLAFHEYATINDGQWHHVAIVWT--QGTLTLITEGLIAGKVE 306
             QAHSSGVQVSLF +  DAFL+F EY ++NDGQWHHVA+VW    G L LITEGLIA K+E
Sbjct:  2628 QAHSSGVQVSLFEDQPDAFLSFGEYTSVNDGQWHHVAVVWDGISGQLQLITEGLIASKME 2687

Query:   307 NYGSGKSLPQYGWVVLGKPRP---DNIKAYTEAGFEGKLTKVQIWNRALDFTNEIQKQVR 363
              YG+G SLP Y W VLG P+P    N  AY+++GF+G +TK Q+W RALD T+EIQKQVR
Sbjct:  2688 -YGAGGSLPGYLWAVLGLPQPYGLSNELAYSDSGFQGTITKAQVWARALDITSEIQKQVR 2746

Query:   364 DCRTEPVLHTGLVLTWTGYDDINGGVERVVPSHCSQHICPPGYTGPECDQLTVDK 418
             DCR+EPVL+ GL+L W GY+  +GGVER VPS C Q  CP GYTG  C QL VDK
Sbjct:  2747 DCRSEPVLYPGLILNWAGYEVTSGGVERNVPSLCGQRKCPVGYTGANCQQLVVDK 2801


GO:0005112 "Notch binding" evidence=ISS
GO:0007155 "cell adhesion" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
GO:0030246 "carbohydrate binding" evidence=IEA
GO:0016324 "apical plasma membrane" evidence=IDA
GO:0035152 "regulation of tube architecture, open tracheal system" evidence=IMP
GO:0046716 "muscle cell homeostasis" evidence=IMP
GO:0045746 "negative regulation of Notch signaling pathway" evidence=IGI
WB|WBGene00018546 F47C12.1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
RGD|1588987 Svep1 "sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P0C6B8 Svep1 "Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1928849 Svep1 "sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1SND0 SVEP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MNH3 SVEP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q0A7 SVEP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NWK3 SVEP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P1K9 SVEP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query418
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 3e-09
pfam13385156 pfam13385, Laminin_G_3, Concanavalin A-like lectin 1e-08
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 2e-08
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 2e-07
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 9e-07
pfam02210124 pfam02210, Laminin_G_2, Laminin G domain 1e-06
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 3e-06
cd0005336 cd00053, EGF, Epidermal growth factor domain, foun 9e-06
pfam0000832 pfam00008, EGF, EGF-like domain 4e-05
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 5e-05
cd00110151 cd00110, LamG, Laminin G domain; Laminin G-like do 6e-05
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 9e-05
cd0005336 cd00053, EGF, Epidermal growth factor domain, foun 3e-04
PRK14581672 PRK14581, hmsF, outer membrane N-deacetylase; Prov 3e-04
cd00152201 cd00152, PTX, Pentraxins are plasma proteins chara 5e-04
smart00282132 smart00282, LamG, Laminin G domain 7e-04
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 0.003
smart00159206 smart00159, PTX, Pentraxin / C-reactive protein / 0.003
pfam0000832 pfam00008, EGF, EGF-like domain 0.004
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
 Score = 51.9 bits (125), Expect = 3e-09
 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 1/38 (2%)

Query: 173 NIDDCKS-NPCLNGGICRDGVAKFTCDCPPGWTGSRCE 209
           +ID+C S NPC NGG C + V  + C CPPG+TG  CE
Sbjct: 1   DIDECASGNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38


Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements. Length = 38

>gnl|CDD|222092 pfam13385, Laminin_G_3, Concanavalin A-like lectin/glucanases superfamily Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|216930 pfam02210, Laminin_G_2, Laminin G domain Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|238010 cd00053, EGF, Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>gnl|CDD|215652 pfam00008, EGF, EGF-like domain Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|238058 cd00110, LamG, Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|238010 cd00053, EGF, Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>gnl|CDD|184753 PRK14581, hmsF, outer membrane N-deacetylase; Provisional Back     alignment and domain information
>gnl|CDD|238086 cd00152, PTX, Pentraxins are plasma proteins characterized by their pentameric discoid assembly and their Ca2+ dependent ligand binding, such as Serum amyloid P component (SAP) and C-reactive Protein (CRP), which are cytokine-inducible acute-phase proteins implicated in innate immunity Back     alignment and domain information
>gnl|CDD|214598 smart00282, LamG, Laminin G domain Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|128463 smart00159, PTX, Pentraxin / C-reactive protein / pentaxin family Back     alignment and domain information
>gnl|CDD|215652 pfam00008, EGF, EGF-like domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query418
2vj3_A135 Human Notch-1 Egfs 11-13 Length = 135 2e-25
2vj3_A135 Human Notch-1 Egfs 11-13 Length = 135 3e-16
1toz_A116 Nmr Structure Of The Human Notch-1 Ligand Binding R 5e-24
1toz_A116 Nmr Structure Of The Human Notch-1 Ligand Binding R 1e-15
4d90_A143 Crystal Structure Of Del-1 Egf Domains Length = 143 1e-11
1dan_L152 Complex Of Active Site Inhibited Human Blood Coagul 8e-07
2vj2_A169 Human Jagged-1, Domains Dsl And Egfs1-3 Length = 16 1e-06
1w0y_L142 Tf7a_3771 Complex Length = 142 1e-06
1o5d_L152 Dissecting And Designing Inhibitor Selectivity Dete 1e-06
1z6j_L142 Crystal Structure Of A Ternary Complex Of Factor Vi 1e-06
2ygq_A324 Wif Domain-Epidermal Growth Factor (Egf)-Like Domai 2e-06
3h5c_B317 X-Ray Structure Of Protein Z-Protein Z Inhibitor Co 3e-06
3h5c_B317 X-Ray Structure Of Protein Z-Protein Z Inhibitor Co 5e-04
1dva_L101 Crystal Structure Of The Complex Between The Peptid 3e-06
1j9c_L95 Crystal Structure Of Tissue Factor-Factor Viia Comp 3e-06
1qfk_L104 Structure Of Human Factor Viia And Its Implications 6e-06
1f7e_A46 The First Egf-Like Domain From Human Blood Coagulat 8e-06
2puq_L94 Crystal Structure Of Active Site Inhibited Coagulat 1e-05
1bf9_A41 N-Terminal Egf-Like Domain From Human Factor Vii, N 2e-05
3qcw_A 1245 Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), 5e-05
1lmj_A86 Nmr Study Of The Fibrillin-1 Cbegf12-13 Pair Of Ca2 6e-05
3flp_A217 Crystal Structure Of Native Heptameric Sap-Like Pen 7e-05
1edm_B39 Epidermal Growth Factor-Like Domain From Human Fact 1e-04
3poy_A 1019 Crystal Structure Of The Alpha-Neurexin-1 Ectodomai 2e-04
3r05_A 1254 Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), 2e-04
1x7a_L146 Porcine Factor Ixa Complexed To 1-{3-[amino(Imino) 3e-04
1apo_A42 Three-Dimensional Structure Of The Apo Form Of The 3e-04
2gy5_A423 Tie2 Ligand-Binding Domain Crystal Structure Length 4e-04
1nfu_B195 Crystal Structure Of Human Coagulation Factor Xa Co 6e-04
>pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 Back     alignment and structure

Iteration: 1

Score = 113 bits (282), Expect = 2e-25, Method: Compositional matrix adjust. Identities = 54/119 (45%), Positives = 79/119 (66%), Gaps = 4/119 (3%) Query: 96 IDDCA--SEPCQNGGSCVDMLDGFMCQCRPGFVGLQCEADIDECLSDPCSPEGTDKCLDL 153 +D+C+ + PC++ G C++ L F CQC G+ G +CE D++EC+S+PC + T CLD Sbjct: 5 VDECSLGANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDAT--CLDQ 62 Query: 154 DNKFQCECNVGYTGVMCETNIDDCKSNPCLNGGICRDGVAKFTCDCPPGWTGSRCEKDI 212 +FQC C GY GV CE N D+C S+PCL+ G C D + +F C+CP G+TG C+ D+ Sbjct: 63 IGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQVDL 121
>pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 Back     alignment and structure
>pdb|1TOZ|A Chain A, Nmr Structure Of The Human Notch-1 Ligand Binding Region Length = 116 Back     alignment and structure
>pdb|1TOZ|A Chain A, Nmr Structure Of The Human Notch-1 Ligand Binding Region Length = 116 Back     alignment and structure
>pdb|4D90|A Chain A, Crystal Structure Of Del-1 Egf Domains Length = 143 Back     alignment and structure
>pdb|1DAN|L Chain L, Complex Of Active Site Inhibited Human Blood Coagulation Factor Viia With Human Recombinant Soluble Tissue Factor Length = 152 Back     alignment and structure
>pdb|2VJ2|A Chain A, Human Jagged-1, Domains Dsl And Egfs1-3 Length = 169 Back     alignment and structure
>pdb|1W0Y|L Chain L, Tf7a_3771 Complex Length = 142 Back     alignment and structure
>pdb|1O5D|L Chain L, Dissecting And Designing Inhibitor Selectivity Determinants At The S1 Site Using An Artificial Ala190 Protease (Ala190 Upa) Length = 152 Back     alignment and structure
>pdb|1Z6J|L Chain L, Crystal Structure Of A Ternary Complex Of Factor Viia/tissue Factor/pyrazinone Inhibitor Length = 142 Back     alignment and structure
>pdb|2YGQ|A Chain A, Wif Domain-Epidermal Growth Factor (Egf)-Like Domains 1-3 Of Human Wnt Inhibitory Factor 1 In Complex With 1,2-Dipalmitoylphosphatidylcholine Length = 324 Back     alignment and structure
>pdb|3H5C|B Chain B, X-Ray Structure Of Protein Z-Protein Z Inhibitor Complex Length = 317 Back     alignment and structure
>pdb|3H5C|B Chain B, X-Ray Structure Of Protein Z-Protein Z Inhibitor Complex Length = 317 Back     alignment and structure
>pdb|1DVA|L Chain L, Crystal Structure Of The Complex Between The Peptide Exosite Inhibitor E-76 And Coagulation Factor Viia Length = 101 Back     alignment and structure
>pdb|1J9C|L Chain L, Crystal Structure Of Tissue Factor-Factor Viia Complex Length = 95 Back     alignment and structure
>pdb|1QFK|L Chain L, Structure Of Human Factor Viia And Its Implications For The Triggering Of Blood Coagulation Length = 104 Back     alignment and structure
>pdb|1F7E|A Chain A, The First Egf-Like Domain From Human Blood Coagulation Fvii, Nmr, 20 Structures Length = 46 Back     alignment and structure
>pdb|2PUQ|L Chain L, Crystal Structure Of Active Site Inhibited Coagulation Factor Viia In Complex With Soluble Tissue Factor Length = 94 Back     alignment and structure
>pdb|1BF9|A Chain A, N-Terminal Egf-Like Domain From Human Factor Vii, Nmr, 23 Structures Length = 41 Back     alignment and structure
>pdb|3QCW|A Chain A, Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), No Splice Inserts Length = 1245 Back     alignment and structure
>pdb|1LMJ|A Chain A, Nmr Study Of The Fibrillin-1 Cbegf12-13 Pair Of Ca2+ Binding Epidermal Growth Factor-like Domains Length = 86 Back     alignment and structure
>pdb|3FLP|A Chain A, Crystal Structure Of Native Heptameric Sap-Like Pentraxin From Limulus Polyphemus Length = 217 Back     alignment and structure
>pdb|1EDM|B Chain B, Epidermal Growth Factor-Like Domain From Human Factor Ix Length = 39 Back     alignment and structure
>pdb|3POY|A Chain A, Crystal Structure Of The Alpha-Neurexin-1 Ectodomain, Lns 2-6 Length = 1019 Back     alignment and structure
>pdb|3R05|A Chain A, Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), With Splice Insert Ss3 Length = 1254 Back     alignment and structure
>pdb|1X7A|L Chain L, Porcine Factor Ixa Complexed To 1-{3-[amino(Imino) Methyl]phenyl}-N-[4-(1h-Benzimidazol-1-Yl)-2- Fluorophenyl]- 3-(Trifluoromethyl)-1h-Pyrazole-5-Carboxamide Length = 146 Back     alignment and structure
>pdb|1APO|A Chain A, Three-Dimensional Structure Of The Apo Form Of The N- Terminal Egf-Like Module Of Blood Coagulation Factor X As Determined By Nmr Spectroscopy And Simulated Folding Length = 42 Back     alignment and structure
>pdb|2GY5|A Chain A, Tie2 Ligand-Binding Domain Crystal Structure Length = 423 Back     alignment and structure
>pdb|1NFU|B Chain B, Crystal Structure Of Human Coagulation Factor Xa Complexed With Rpr132747 Length = 195 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query418
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 1e-53
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 1e-49
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 1e-36
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 9e-50
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 2e-39
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 1e-38
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 5e-44
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 6e-25
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 5e-15
2vh0_B134 Activated factor XA light chain; serine protease, 4e-41
2vh0_B134 Activated factor XA light chain; serine protease, 2e-40
2vh0_B134 Activated factor XA light chain; serine protease, 1e-28
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 8e-37
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 2e-35
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 1e-23
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 1e-36
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 3e-33
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 3e-23
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 1e-33
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 6e-32
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 3e-31
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 5e-23
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 1e-14
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 2e-07
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 4e-33
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 4e-32
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 2e-23
1aut_L114 Activated protein C; serine proteinase, plasma cal 1e-24
1aut_L114 Activated protein C; serine proteinase, plasma cal 3e-23
1aut_L114 Activated protein C; serine proteinase, plasma cal 3e-21
1aut_L114 Activated protein C; serine proteinase, plasma cal 9e-15
1aut_L114 Activated protein C; serine proteinase, plasma cal 2e-09
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 2e-23
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 3e-17
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 2e-14
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 6e-04
3flp_A217 SAP-like pentraxin; physiological doubly-stacked h 3e-21
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 1e-19
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 1e-13
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 7e-12
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 2e-10
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 1e-08
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 5e-08
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 7e-07
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 3e-06
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 1e-19
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 7e-16
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 6e-15
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 2e-10
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 1e-06
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 2e-19
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 8e-15
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 4e-13
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 1e-12
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 5e-17
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 7e-14
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 6e-13
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 2e-10
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 7e-17
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 2e-15
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 4e-12
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 3e-04
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 2e-16
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 3e-14
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 7e-13
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 2e-10
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 5e-16
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 1e-14
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 8e-07
3pvn_A206 C-reactive protein; pentraxin family, immune syste 2e-15
3kqr_A204 Serum amyloid P-component; glycoprotein, disulfide 2e-15
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 3e-15
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 1e-12
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 4e-08
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 7e-06
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 2e-14
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 3e-07
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 9e-04
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 4e-14
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 8e-11
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 2e-09
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 7e-05
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 1e-04
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 6e-14
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 6e-10
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 1e-09
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 4e-12
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 4e-08
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 6e-04
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 2e-11
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 4e-11
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 1e-06
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 1e-06
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 3e-06
1yo8_A634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 9e-05
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 1e-04
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 2e-10
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 4e-10
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 6e-09
2bou_A143 EGF-like module containing mucin-like hormone rece 2e-09
2bou_A143 EGF-like module containing mucin-like hormone rece 4e-09
2bou_A143 EGF-like module containing mucin-like hormone rece 3e-06
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 3e-09
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 3e-08
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 4e-06
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 2e-08
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 2e-05
4dqa_A355 Uncharacterized protein; two domains structure, DU 1e-07
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 2e-07
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 2e-06
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 3e-06
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 3e-07
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 6e-04
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 4e-07
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 8e-07
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 6e-05
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 7e-07
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 1e-06
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 5e-05
2wjs_A608 Laminin subunit alpha-2; integrin, secreted, coile 2e-06
2wjs_A 608 Laminin subunit alpha-2; integrin, secreted, coile 2e-04
2f83_A625 Coagulation factor XI; protease, apple domain, hyd 3e-06
3v64_A191 Low-density lipoprotein receptor-related protein; 5e-06
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 6e-06
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 9e-05
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 7e-06
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 3e-04
2v73_A191 CBM40, putative EXO-alpha-sialidase; carbohydrate- 1e-05
3p5b_L400 Low density lipoprotein receptor variant; B-propel 3e-05
1pz7_A204 Agrin; structural protein; 1.42A {Gallus gallus} S 4e-05
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 4e-05
1nql_B53 Epidermal growth factor; cell surface receptor, ty 4e-05
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 6e-05
3v4v_B503 Integrin beta-7; cell adhesion, madcam-1, membrane 6e-05
3v65_B386 Low-density lipoprotein receptor-related protein; 9e-05
3v65_B386 Low-density lipoprotein receptor-related protein; 3e-04
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 9e-05
3nxp_A 424 Prethrombin-1; allostery, blood coagulation, hydro 5e-04
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 1e-04
3t3p_B472 Integrin beta-3; integrin, cell adhesion, blood cl 2e-04
1d2s_A170 SHBG, sex hormone-binding globulin; steroid transp 3e-04
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 3e-04
1f5f_A205 SHBG, sex hormone-binding globulin; jellyroll, sig 5e-04
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 9e-04
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
 Score =  174 bits (443), Expect = 1e-53
 Identities = 54/129 (41%), Positives = 80/129 (62%), Gaps = 4/129 (3%)

Query: 96  IDDCA--SEPCQNGGSCVDMLDGFMCQCRPGFVGLQCEADIDECLSDPCSPEGTDKCLDL 153
           +D+C+  + PC++ G C++ L  F CQC  G+ G +CE D++EC+S+PC  + T  CLD 
Sbjct: 5   VDECSLGANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDAT--CLDQ 62

Query: 154 DNKFQCECNVGYTGVMCETNIDDCKSNPCLNGGICRDGVAKFTCDCPPGWTGSRCEKDIG 213
             +FQC C  GY GV CE N D+C S+PCL+ G C D + +F C+CP G+TG  C+ D+ 
Sbjct: 63  IGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQVDLH 122

Query: 214 SCTNMPCQN 222
              +     
Sbjct: 123 HILDAQKMV 131


>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>3flp_A SAP-like pentraxin; physiological doubly-stacked heptamer, pentraxin fold, cyclic heptamer, invertebrate lectin, sugar binding protein; 2.30A {Limulus polyphemus} PDB: 3flr_A 3flt_A Length = 217 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>3pvn_A C-reactive protein; pentraxin family, immune system; 1.98A {Homo sapiens} PDB: 1gnh_A 1lj7_A 3l2y_A 1b09_A 3pvo_A Length = 206 Back     alignment and structure
>3kqr_A Serum amyloid P-component; glycoprotein, disulfide bond, lectin, metal-binding secreted; HET: NAG; 1.50A {Homo sapiens} PDB: 1lgn_A* 1gyk_A 2a3w_A* 2a3x_A* 2a3y_A* 1sac_A* 3d5o_A* 2w08_A* Length = 204 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Length = 267 Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Length = 267 Back     alignment and structure
>4dqa_A Uncharacterized protein; two domains structure, DUF 1735, laminin_G_3 concanavalin A- lectin/glucanases superfamily domain; HET: MSE; 1.50A {Bacteroides ovatus} Length = 355 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Length = 217 Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Length = 162 Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Length = 162 Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Length = 625 Back     alignment and structure
>3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Length = 191 Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Length = 157 Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Length = 157 Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Length = 53 Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Length = 53 Back     alignment and structure
>2v73_A CBM40, putative EXO-alpha-sialidase; carbohydrate-binding module, bacterial pathogen, sialic acid, sugar-binding protein; HET: SIA; 2.2A {Clostridium perfringens} Length = 191 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A Length = 204 Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Length = 63 Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Length = 53 Back     alignment and structure
>3v4v_B Integrin beta-7; cell adhesion, madcam-1, membrane; HET: NAG BMA MAN 0DU; 3.10A {Homo sapiens} PDB: 3v4p_B* Length = 503 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Length = 424 Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Length = 424 Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Length = 58 Back     alignment and structure
>3t3p_B Integrin beta-3; integrin, cell adhesion, blood clotting, fibrinogen, platele; HET: NAG BMA MAN; 2.20A {Homo sapiens} PDB: 3t3m_B* 3nig_B* 3nif_B* 3nid_B* 2vdr_B* 2vc2_B* 2vdk_B* 2vdm_B* 2vdn_B* 2vdl_B* 2vdp_B* 2vdq_B* 2vdo_B* 3fcu_B* 1txv_B* 1ty3_B* 1ty5_B* 1ty6_B* 1ty7_B* 1tye_B* Length = 472 Back     alignment and structure
>1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* Length = 170 Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Length = 188 Back     alignment and structure
>1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* Length = 205 Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* 3krk_A* ... Length = 587 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query418
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.91
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.91
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.9
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.87
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.84
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.83
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.81
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 99.8
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.8
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.8
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.76
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.75
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 99.75
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.73
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 99.73
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.73
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.71
2bou_A143 EGF-like module containing mucin-like hormone rece 99.7
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.68
3v64_A191 Low-density lipoprotein receptor-related protein; 99.68
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 99.67
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 99.66
2bou_A143 EGF-like module containing mucin-like hormone rece 99.66
1pz7_A204 Agrin; structural protein; 1.42A {Gallus gallus} S 99.64
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 99.64
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.63
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.63
3pve_A189 Agrin, AGRN protein; mRNA splicing, structural gen 99.62
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 99.61
3sh4_A195 LG3 peptide; actin disassambly, integrin alpha12 B 99.6
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.58
2r16_A182 Neurexin-1-alpha; beta-sandwich, cell adhesion, sp 99.58
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 99.57
1d2s_A170 SHBG, sex hormone-binding globulin; steroid transp 99.56
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.56
3bod_A178 Neurexin-1-alpha; neurexin1D, LNS6, alternative sp 99.54
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 99.52
1f5f_A205 SHBG, sex hormone-binding globulin; jellyroll, sig 99.52
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 99.51
2h0b_A184 Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A 99.5
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 99.45
2jd4_A 383 Laminin subunit alpha-1; basement membrane protein 99.43
1h30_A 422 GAS6, growth-arrest-specific protein; laminin G-do 99.42
2r1d_A226 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 99.42
2r1b_A220 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 99.41
1dyk_A 394 Laminin alpha 2 chain; metal binding protein; 2.0A 99.41
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.4
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.39
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.39
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 99.36
1aut_L114 Activated protein C; serine proteinase, plasma cal 99.35
2jd4_A383 Laminin subunit alpha-1; basement membrane protein 99.35
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 99.35
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 99.34
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 99.33
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 99.32
1dyk_A394 Laminin alpha 2 chain; metal binding protein; 2.0A 99.32
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.3
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.3
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 99.3
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 99.3
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 99.27
2vh0_B134 Activated factor XA light chain; serine protease, 99.26
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 99.26
2wjs_A 608 Laminin subunit alpha-2; integrin, secreted, coile 99.24
1aut_L114 Activated protein C; serine proteinase, plasma cal 99.22
2vh0_B134 Activated factor XA light chain; serine protease, 99.21
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 99.19
2wjs_A 608 Laminin subunit alpha-2; integrin, secreted, coile 99.1
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 99.08
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 99.03
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 99.02
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 99.01
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 98.99
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.98
3flp_A217 SAP-like pentraxin; physiological doubly-stacked h 98.94
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 98.91
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 98.89
1h30_A422 GAS6, growth-arrest-specific protein; laminin G-do 98.87
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 98.86
3kqr_A204 Serum amyloid P-component; glycoprotein, disulfide 98.85
3pvn_A206 C-reactive protein; pentraxin family, immune syste 98.81
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 98.81
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.81
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.78
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.75
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 98.7
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.69
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.66
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.65
3v65_B386 Low-density lipoprotein receptor-related protein; 98.65
3v65_B386 Low-density lipoprotein receptor-related protein; 98.61
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.54
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 98.45
2k2s_B61 Micronemal protein 6; microneme protein complex, c 98.41
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 98.41
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 98.41
1a3p_A45 Epidermal growth factor; disulfide connectivities, 98.39
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 98.37
1a3p_A45 Epidermal growth factor; disulfide connectivities, 98.37
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 98.32
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 98.28
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 98.27
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 98.25
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 98.18
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 98.17
2k2s_B61 Micronemal protein 6; microneme protein complex, c 98.16
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 98.11
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 98.09
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 98.08
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 98.08
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 98.07
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 98.04
4dqa_A355 Uncharacterized protein; two domains structure, DU 98.03
2wph_E59 Coagulation factor IXA light chain; serine proteas 98.03
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 97.95
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 97.83
1nql_B53 Epidermal growth factor; cell surface receptor, ty 97.68
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 97.67
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 97.61
1za4_A251 Thrombospondin 1; TSP-1, NTSP-1, HBD, arixtra, cel 97.61
2erf_A209 Thrombospondin-1; TSP-1, N-terminal TSPN, HBD, sug 97.59
1ob1_C99 Major merozoite surface protein; immune system, im 97.58
2uur_A245 Collagen alpha-1(IX) chain; glycoprotein, hydroxyl 97.56
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 97.52
1nql_B53 Epidermal growth factor; cell surface receptor, ty 97.5
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 97.46
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 97.4
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 97.4
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 97.36
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 97.29
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 97.22
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 97.13
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 97.1
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 97.05
2v73_A191 CBM40, putative EXO-alpha-sialidase; carbohydrate- 97.04
1ob1_C99 Major merozoite surface protein; immune system, im 97.02
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 96.93
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 96.83
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 96.76
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 96.74
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 96.66
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 96.58
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 96.52
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 96.48
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 96.41
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 96.4
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 96.29
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 96.17
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 96.13
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 96.11
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 96.04
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 96.04
2i9a_A145 Urokinase-type plasminogen activator; growth facto 96.04
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 96.03
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 95.77
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 95.65
1szb_A170 Mannose binding lectin-associated serine protease- 95.6
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 95.42
2wph_E59 Coagulation factor IXA light chain; serine proteas 95.39
2i9a_A145 Urokinase-type plasminogen activator; growth facto 95.28
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 95.26
2jkb_A 686 Sialidase B; intramolecular trans-sialidase, lyase 95.01
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 94.99
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 94.97
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 94.96
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 94.81
2sli_A 679 Intramolecular trans-sialidase; hydrolase, neurami 94.37
1a8d_A 452 Tetanus neurotoxin; clostridial, ganglioside bindi 94.13
1szb_A170 Mannose binding lectin-associated serine protease- 94.08
2y38_A403 Laminin subunit alpha-5; structural protein, cell 94.04
2y38_A403 Laminin subunit alpha-5; structural protein, cell 93.97
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 93.75
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 93.5
1b9w_A95 Protein (merozoite surface protein 1); MSP-1, cand 92.24
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 92.11
1nzi_A159 Complement C1S component; calcium, innate immunity 91.47
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 90.73
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 88.62
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 88.36
3rsj_A 413 BONT/F; clostridium botulinum type F, ganglioside 86.89
1nzi_A159 Complement C1S component; calcium, innate immunity 86.1
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 85.58
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 83.33
1ms9_A648 Trans-sialidase; trans-glycosylation, protein-acrb 82.78
2e26_A725 Reelin, reeler protein; signaling protein; HET: NA 82.68
2e26_A725 Reelin, reeler protein; signaling protein; HET: NA 82.54
1b9w_A95 Protein (merozoite surface protein 1); MSP-1, cand 82.31
1epw_A 1290 Bontoxilysin B, botulinum neurotoxin type B; zinc, 81.27
1nt0_A286 MAsp2, mannose-binding protein associated serine p 81.03
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
Probab=99.91  E-value=1.4e-24  Score=175.65  Aligned_cols=125  Identities=44%  Similarity=1.104  Sum_probs=108.0

Q ss_pred             CccCCCCCC--CCCCCCCCeeecCCCCeeeeCCCCccCCccccCCCcCCCCCCCCCCcceeecCCCCeeeecCCCCcCcc
Q psy3619          92 CQHLIDDCA--SEPCQNGGSCVDMLDGFMCQCRPGFVGLQCEADIDECLSDPCSPEGTDKCLDLDNKFQCECNVGYTGVM  169 (418)
Q Consensus        92 C~~~~~~C~--~~~C~~~~~C~~~~g~~~C~C~~G~~g~~C~~~~~~C~~~~c~~~~~~~C~~~~~~~~C~C~~G~~g~~  169 (418)
                      |+ |+|+|+  .+||.++++|+++.++|+|.|++||+|..|+.++++|..++|..++.  |++..++|.|.|++||+|..
T Consensus         2 c~-dideC~~~~~~C~~~g~C~~~~g~~~C~C~~Gy~G~~C~~~~~~C~~~~C~~~~~--C~~~~g~~~C~C~~G~~G~~   78 (135)
T 2vj3_A            2 AQ-DVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDAT--CLDQIGEFQCICMPGYEGVH   78 (135)
T ss_dssp             -C-CCCTTTSSSCSSSTTCEEEECSSSEEEECCTTEESTTSCEECCTTTTCCCCSSCE--EEECSSCEEEECCTTEESSS
T ss_pred             Cc-ccccccCCCCCCCCCCEeECCCCCEEEECCCCCcCCcccccCccCCCCCCCCCCE--EeCCCCCceeeCCCCCcCCc
Confidence            44 799998  67899999999999999999999999999988899999888887765  99999999999999999999


Q ss_pred             ceecCCCCCCCCCCCCcEEEeCCCCeEEeCCCCcCCCCcCcCCCCCcCCC
Q psy3619         170 CETNIDDCKSNPCLNGGICRDGVAKFTCDCPPGWTGSRCEKDIGSCTNMP  219 (418)
Q Consensus       170 C~~~~~~C~~~~C~~~~~C~~~~~~~~C~C~~G~~G~~C~~~~~~C~~~~  219 (418)
                      |+.++++|..++|.++++|++..++|+|.|++||+|..|+.++++|...+
T Consensus        79 C~~~~~~C~~~~C~~~g~C~~~~g~~~C~C~~G~~G~~C~~~i~~C~~~~  128 (135)
T 2vj3_A           79 CEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQVDLHHILDAQ  128 (135)
T ss_dssp             SCEECCTTTTCCSTTTCEEEECSSCEEEECCTTEESSSSCEECC------
T ss_pred             ceecCCcccCCCcCCCCEeECCCCCeEEECCCCCcCCccCccCccccCCC
Confidence            98888999999999999999999999999999999999998899887653



>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Back     alignment and structure
>1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Back     alignment and structure
>2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* Back     alignment and structure
>2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* Back     alignment and structure
>1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>3flp_A SAP-like pentraxin; physiological doubly-stacked heptamer, pentraxin fold, cyclic heptamer, invertebrate lectin, sugar binding protein; 2.30A {Limulus polyphemus} PDB: 3flr_A 3flt_A Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3kqr_A Serum amyloid P-component; glycoprotein, disulfide bond, lectin, metal-binding secreted; HET: NAG; 1.50A {Homo sapiens} SCOP: b.29.1.5 PDB: 1lgn_A* 1gyk_A 2a3w_A* 2a3x_A* 2a3y_A* 1sac_A* 3d5o_A* 2w08_A* Back     alignment and structure
>3pvn_A C-reactive protein; pentraxin family, immune system; 1.98A {Homo sapiens} SCOP: b.29.1.5 PDB: 1gnh_A 1lj7_A 3l2y_A 1b09_A 3pvo_A Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4dqa_A Uncharacterized protein; two domains structure, DUF 1735, laminin_G_3 concanavalin A- lectin/glucanases superfamily domain; HET: MSE; 1.50A {Bacteroides ovatus} Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1za4_A Thrombospondin 1; TSP-1, NTSP-1, HBD, arixtra, cell adhesion; HET: SGN; 1.90A {Homo sapiens} SCOP: b.29.1.4 PDB: 2ouh_A 2ouj_A Back     alignment and structure
>2erf_A Thrombospondin-1; TSP-1, N-terminal TSPN, HBD, sugar binding protein; 1.45A {Homo sapiens} SCOP: b.29.1.4 PDB: 2es3_A 1z78_A Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>2uur_A Collagen alpha-1(IX) chain; glycoprotein, hydroxylation, structural protein, NC4, collagen IX, polymorphism, extracellular matrix; 1.8A {Homo sapiens} Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>2v73_A CBM40, putative EXO-alpha-sialidase; carbohydrate-binding module, bacterial pathogen, sialic acid, sugar-binding protein; HET: SIA; 2.2A {Clostridium perfringens} Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>2jkb_A Sialidase B; intramolecular trans-sialidase, lyase, glycosidase, neuraminidase; HET: SKD; 1.54A {Streptococcus pneumoniae} PDB: 2vw2_A* 2vw1_A* 2vw0_A* Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>2sli_A Intramolecular trans-sialidase; hydrolase, neuraminidase; HET: SKD; 1.80A {Macrobdella decora} SCOP: b.29.1.9 b.68.1.1 PDB: 1sll_A 1sli_A* 3sli_A* 4sli_A* Back     alignment and structure
>1a8d_A Tetanus neurotoxin; clostridial, ganglioside binding region; 1.57A {Clostridium tetani} SCOP: b.29.1.6 b.42.4.2 PDB: 1af9_A 1fv3_A* 1fv2_A* 3hmy_A* 3hn1_A* 1d0h_A* 1dfq_A* 1dll_A* 1yxw_A* 1yyn_A* 1diw_A* Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>1b9w_A Protein (merozoite surface protein 1); MSP-1, candidate malaria vaccine, surface antigen; 1.80A {Plasmodium cynomolgi} SCOP: g.3.11.4 g.3.11.4 PDB: 2npr_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure
>3rsj_A BONT/F; clostridium botulinum type F, ganglioside binding site, GD1A; HET: NGA GAL SIA; 2.00A {Clostridium botulinum} PDB: 3fuq_A Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure
>1ms9_A Trans-sialidase; trans-glycosylation, protein-acrbohydrate interac beta-propeller, hydrolase; HET: LAT; 1.58A {Trypanosoma cruzi} SCOP: b.29.1.15 b.68.1.1 PDB: 1ms0_A* 1mr5_A* 1ms1_A 1ms4_A 1ms8_A* 1ms3_A* 2ah2_A* 3b69_A* 3opz_A 3pjq_A* 1s0i_A* 1s0j_A* 1ms5_A 1wcs_A 2ags_A* 2a75_A* 2fhr_A* 1n1t_A* 1n1s_A* 1n1v_A* ... Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>1b9w_A Protein (merozoite surface protein 1); MSP-1, candidate malaria vaccine, surface antigen; 1.80A {Plasmodium cynomolgi} SCOP: g.3.11.4 g.3.11.4 PDB: 2npr_A Back     alignment and structure
>1epw_A Bontoxilysin B, botulinum neurotoxin type B; zinc, metalloprotease, transmembrane, hydrolase; 1.90A {Clostridium botulinum} SCOP: b.29.1.6 b.42.4.2 d.92.1.7 h.4.2.1 PDB: 1f31_A* 1g9a_A* 1g9b_A* 1g9c_A* 1g9d_A* 1i1e_A* 1s0b_A 1s0c_A 1s0d_A 1s0e_A 1s0f_A 1s0g_A 2np0_A 3zuq_A 2etf_A 2xhl_A 1z0h_A 2nm1_A 3g94_A 1f82_A ... Back     alignment and structure
>1nt0_A MAsp2, mannose-binding protein associated serine proteas; CUB domain, EGF like domain., hydrolase, sugar binding protein; HET: NAG EDO; 2.70A {Rattus norvegicus} SCOP: b.23.1.1 b.23.1.1 g.3.11.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 418
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 4e-13
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 9e-12
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 2e-08
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 2e-05
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 1e-12
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 5e-11
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 7e-08
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 2e-05
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 2e-12
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 5e-11
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 8e-08
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 1e-04
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 3e-12
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 5e-11
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 7e-08
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 3e-05
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 4e-12
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 7e-11
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 1e-07
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 2e-05
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 1e-11
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 1e-10
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 1e-06
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 2e-05
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 2e-11
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 4e-10
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 2e-06
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 1e-05
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 2e-10
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 6e-09
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 3e-07
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 5e-05
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 3e-10
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 2e-09
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 1e-05
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 1e-05
d1autl148 g.3.11.1 (L:49-96) Activated protein c (autoprothr 3e-09
d1autl148 g.3.11.1 (L:49-96) Activated protein c (autoprothr 1e-07
d1autl148 g.3.11.1 (L:49-96) Activated protein c (autoprothr 2e-05
d1autl148 g.3.11.1 (L:49-96) Activated protein c (autoprothr 2e-04
d1tpga141 g.3.11.1 (A:51-91) Plasminogen activator (tissue-t 6e-09
d1tpga141 g.3.11.1 (A:51-91) Plasminogen activator (tissue-t 3e-08
d1tpga141 g.3.11.1 (A:51-91) Plasminogen activator (tissue-t 3e-05
d1nqlb_48 g.3.11.1 (B:) Epidermal growth factor, EGF {Human 7e-09
d1nqlb_48 g.3.11.1 (B:) Epidermal growth factor, EGF {Human 2e-06
d1nqlb_48 g.3.11.1 (B:) Epidermal growth factor, EGF {Human 3e-05
d1q4ga242 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG 2e-08
d1q4ga242 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG 9e-07
d1q4ga242 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG 3e-04
d3egfa_53 g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse 2e-08
d3egfa_53 g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse 2e-06
d3egfa_53 g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse 1e-04
d2slia1196 b.29.1.9 (A:81-276) Leech intramolecular trans-sia 2e-08
d1cvua241 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG 3e-08
d1cvua241 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG 2e-06
d1cvua241 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG 0.002
d1b09a_206 b.29.1.5 (A:) C-reactive protein (CRP) {Human (Hom 1e-07
d1saca_204 b.29.1.5 (A:) Serum amyloid P component (SAP) {Hum 4e-07
d1a8da1247 b.29.1.6 (A:1-247) Tetanus neurotoxin {Clostridium 7e-07
d1epwa1218 b.29.1.6 (A:862-1079) Botulinum neurotoxin {Clostr 1e-06
d1ioxa_50 g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) 2e-05
d1ioxa_50 g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) 9e-04
d1moxc_49 g.3.11.1 (C:) Transforming growth factor alpha {Hu 9e-05
d1k36a_46 g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo 1e-04
d1k36a_46 g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo 0.003
d1dyka1189 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse 1e-04
d3btaa1207 b.29.1.6 (A:872-1078) Botulinum neurotoxin {Clostr 1e-04
d2erfa1206 b.29.1.4 (A:10-215) Thrombospondin 1 N-terminal do 0.001
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 0.001
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 0.002
d1dyka2185 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse 0.002
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Neurogenic locus notch homolog protein 1, Notch1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 60.8 bits (148), Expect = 4e-13
 Identities = 16/38 (42%), Positives = 23/38 (60%)

Query: 174 IDDCKSNPCLNGGICRDGVAKFTCDCPPGWTGSRCEKD 211
           +++C SNPC N   C D + +F C C PG+ G  CE +
Sbjct: 1   VNECVSNPCQNDATCLDQIGEFQCICMPGYEGVHCEVN 38


>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d2slia1 b.29.1.9 (A:81-276) Leech intramolecular trans-sialidase, N-terminal domain {North american leech (Macrobdella decora) [TaxId: 6405]} Length = 196 Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 Back     information, alignment and structure
>d1b09a_ b.29.1.5 (A:) C-reactive protein (CRP) {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1saca_ b.29.1.5 (A:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]} Length = 204 Back     information, alignment and structure
>d1a8da1 b.29.1.6 (A:1-247) Tetanus neurotoxin {Clostridium tetani [TaxId: 1513]} Length = 247 Back     information, alignment and structure
>d1epwa1 b.29.1.6 (A:862-1079) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]} Length = 218 Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 49 Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 46 Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 46 Back     information, alignment and structure
>d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 189 Back     information, alignment and structure
>d3btaa1 b.29.1.6 (A:872-1078) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]} Length = 207 Back     information, alignment and structure
>d2erfa1 b.29.1.4 (A:10-215) Thrombospondin 1 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 185 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query418
d1dyka1189 Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 99.6
d1pz7a_195 Agrin {Chicken (Gallus gallus) [TaxId: 9031]} 99.57
d1d2sa_170 Sex hormone-binding globulin {Human (Homo sapiens) 99.46
d1dyka2185 Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 99.43
d1h30a1191 Growth-arrest-specific protein Gas6 {Human (Homo s 99.41
d2r1da1177 Ligand-binding domain of neurexin 1beta {Rat (Ratt 99.39
d1h30a2218 Growth-arrest-specific protein Gas6 {Human (Homo s 99.35
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 99.0
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.95
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.95
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.92
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.92
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 98.91
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.91
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.87
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.86
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.84
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 98.83
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 98.79
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.79
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 98.78
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 98.77
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 98.75
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.68
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.67
d1i0ua241 Low density lipoprotein (LDL) receptor, different 98.63
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 98.61
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 98.6
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 98.56
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.56
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 98.56
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 98.53
d1nt0a345 Mannose-binding protein associated serine protease 98.5
d1szba245 Mannose-binding protein associated serine protease 98.46
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.43
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.42
d1b09a_206 C-reactive protein (CRP) {Human (Homo sapiens) [Ta 98.4
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 98.37
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 98.32
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 98.32
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.3
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.29
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 98.27
d3bpse140 Low density lipoprotein (LDL) receptor, different 98.27
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.26
d1saca_204 Serum amyloid P component (SAP) {Human (Homo sapie 98.25
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.24
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 98.19
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 98.19
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.18
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 98.18
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.18
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 98.15
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 98.15
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.09
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.09
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 98.07
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.06
d1i0ua241 Low density lipoprotein (LDL) receptor, different 98.03
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 98.03
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 97.98
d1nt0a345 Mannose-binding protein associated serine protease 97.91
d1szba245 Mannose-binding protein associated serine protease 97.91
d2erfa1206 Thrombospondin 1 N-terminal domain {Human (Homo sa 97.84
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 97.82
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 97.81
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 97.8
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 97.76
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 97.76
d3bpse140 Low density lipoprotein (LDL) receptor, different 97.7
d1ijqa250 Low density lipoprotein (LDL) receptor, different 97.67
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 97.63
d2slia1196 Leech intramolecular trans-sialidase, N-terminal d 97.58
d1epwa1218 Botulinum neurotoxin {Clostridium botulinum, serot 97.55
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 97.5
d1a8da1247 Tetanus neurotoxin {Clostridium tetani [TaxId: 151 97.38
d3btaa1207 Botulinum neurotoxin {Clostridium botulinum, serot 97.29
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 97.2
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 97.08
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 96.97
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 96.83
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 96.6
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 96.38
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 96.35
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 96.22
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 96.17
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 96.0
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 95.71
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 95.59
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 95.54
d1ijqa250 Low density lipoprotein (LDL) receptor, different 94.96
d2ah2a1225 Trypanosoma sialidase, C-terminal domain {Parasiti 94.55
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 94.2
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 94.06
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 93.42
d1n1ta1222 Trypanosoma sialidase, C-terminal domain {Trypanos 93.41
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 93.22
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 92.89
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 92.69
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 92.23
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 89.38
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 89.25
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 86.68
d1oq1a_223 Hypothetical protein YesU {Bacillus subtilis [TaxI 84.77
>d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Laminin G-like module
domain: Laminin alpha2 chain
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.60  E-value=3.8e-15  Score=125.47  Aligned_cols=108  Identities=17%  Similarity=0.189  Sum_probs=79.1

Q ss_pred             EEecccCcEEEeccCccceEEeeeccccccCCCceEEEEEEeCCEEEEEEcCeeeccceecCCCcccCCCccEEecccCC
Q psy3619         248 IQAHSSGVQVSLFPELQDAFLAFHEYATINDGQWHHVAIVWTQGTLTLITEGLIAGKVENYGSGKSLPQYGWVVLGKPRP  327 (418)
Q Consensus       248 ~~~~~~~v~l~~~~~~~~~~~~~~s~~~l~dg~WH~v~v~~~~~~~~l~vD~~~~~~~~~~~~~~~l~~~~~l~iG~~~~  327 (418)
                      +.+....+.+.+.  .+.....+.+..+++||+||+|.|.|.++.++|+||+...... ..+....++..+.||||+.+.
T Consensus        69 l~l~~G~l~~~~~--~g~~~~~~~~~~~v~Dg~WH~V~v~~~~~~~~l~VD~~~~~~~-~~~~~~~l~~~~~lyiGG~p~  145 (189)
T d1dyka1          69 VQLRNGFPYFSYD--LGSGDTSTMIPTKINDGQWHKIKIVRVKQEGILYVDDASSQTI-SPKKADILDVVGILYVGGLPI  145 (189)
T ss_dssp             EEEETTEEEEEEE--SSSCEEEEECCSCCCSSSCEEEEEEEETTEEEEEETTEEEEEE-CSTTCCCCCCCSEEEESSCCT
T ss_pred             EEEECCEEEEEEE--CCCccEEecCCcEeeCCCEEEEEEEEcccEEEEEECCcceeeE-ccCcccccccccceEEecccc
Confidence            3334444444443  3445556667789999999999999999999999999765443 355667788889999988654


Q ss_pred             CCCC-Cc--cCCCceEEeeeEEecCeecChhhhh
Q psy3619         328 DNIK-AY--TEAGFEGKLTKVQIWNRALDFTNEI  358 (418)
Q Consensus       328 ~~~~-~~--~~~~F~GCi~~l~in~~~l~l~~~~  358 (418)
                      .... ..  ...+|+|||++|+||++.++|.++.
T Consensus       146 ~~~~~~~~~~~~~F~GCi~~v~in~~~~~L~~~~  179 (189)
T d1dyka1         146 NYTTRRIGPVTYSLDGCVRNLHMEQAPVDLDQPT  179 (189)
T ss_dssp             TCCCCSSCSCCSBCSEEEEEEEESSSCCCTTSCS
T ss_pred             cccccccCcCCCCcEEEEeEEEECCEEecCCCcc
Confidence            3322 21  2368999999999999999996654



>d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2r1da1 b.29.1.4 (A:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b09a_ b.29.1.5 (A:) C-reactive protein (CRP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1saca_ b.29.1.5 (A:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erfa1 b.29.1.4 (A:10-215) Thrombospondin 1 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2slia1 b.29.1.9 (A:81-276) Leech intramolecular trans-sialidase, N-terminal domain {North american leech (Macrobdella decora) [TaxId: 6405]} Back     information, alignment and structure
>d1epwa1 b.29.1.6 (A:862-1079) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8da1 b.29.1.6 (A:1-247) Tetanus neurotoxin {Clostridium tetani [TaxId: 1513]} Back     information, alignment and structure
>d3btaa1 b.29.1.6 (A:872-1078) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ah2a1 b.29.1.15 (A:409-633) Trypanosoma sialidase, C-terminal domain {Parasitic flagellate protozoan (Trypanosoma cruzi) [TaxId: 5693]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n1ta1 b.29.1.15 (A:413-634) Trypanosoma sialidase, C-terminal domain {Trypanosoma rangeli [TaxId: 5698]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oq1a_ b.29.1.17 (A:) Hypothetical protein YesU {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure