Psyllid ID: psy3778


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460------1470------1480------1490------1500------1510------1520------1530------1540------1550------1560------1570------1580------1590------1600------1610------1620------1630------1640------1650------1660------1670------1680------1690------1700------1710------1720------1730------1740------1750-
GQGRLSAPAGHPIQTYFQNARKLFVNSLLNRVTNSMASDLRRKTIQQLLYKDNSKPFLAFVGVSLASGTGILTKEDEFEGVCWEIRHAVNNMFDKLVQVETLPDVDDVKVDDIQIGKFIAKGTNAVVYEATFRGVEYALKMMFNYSAASNSHAILKAMSKELLPLRKPLRLNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPKDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYLWAPKHWLYGATPSHNEIMQWLLTLTTKVLCTGVSYGGHVRRTFVEYQLISTFLKRAEFRLITNALQYIQRLLVRYIKPLQPGHKIEFLTQPPATSSGQGRLSAPAGHPIQTYFQNARKLFVNSLLNRVTNSMASDLRRKTIQQLLYKDNSKPFLAFVGVSLASGTGILTKEDEFEGVCWEIRHAVNNMFDKLVQVETLPDVDDVKVDDIQIGKFIAKGTNAVVYEATFRGVEYALKMMFNYSAASNSHAILKAMSKELLPLRKPLRLNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPKDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYLWAPKHWLYGATPSHNEIMQWLLTLTTKVLCTGVSYGGHVRRTFVEYQLISTFLKRAEFRLITNALQYIQRNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPSALPARLNPTGGYGRNMSLFILMKKYNTDLRNYLRERCAQLSMHERILLFTQLLEGVTHLNMHRTAHRDLKSDNILLDCSEDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYLWAPKHWLYGATPSHNEIMQWLLTLTTKVLCTGVSYGGHVRRTFVEYQLISTFLKRAEFRLITNALQYIQRLLVRYIKPLQPGHKIEFLTQPPTTSSGQGRLSAPAGHPIQTYFQNARKLFVNSLLNRVTNSMASDLRRKTIQQLLYKDNSKPFLAFVGVSLASGTGILTKEDEFEGVCWEIRHAVNNMFDKLVQVETLPDVDDVKVDDIQIGKFIAKGTNAVVYEATFRGVEYALKMMFNYSAASNSHAILKAMSKELLPLRKPLRLNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPSALPARLNPTGGYGRNMSLFILMKKYNTDLRNYLRERCAQLSMHERILLFTQLLEGVTHLNMHRTAHRDLKSDNILLDCSEDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYWHRKWLWQHLVYSHSSTTPSTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYLWAPKHWLYGATPSHNEIMQWLLTLTTKVLCTGVSYGGHVRRTFVEYQLISTFLKRAEFRLITNALQYIQRVLTPKPLV
cccccccccccccccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccccccEEEEEccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccEEEcccccccccEEEEEEEEccccEEEEEEccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHcccccccEEEccEEEEccccccccccEEcccccccccEEEEccccccccccccccccccccccccccccccHHHHHccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccHHHHHHHHHHHHHHHccccccccccHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEcccccccccEEEEEEEEccccEEEEEEccccccccHHHHHHHHccccccccccccccHHHHHHHHHHcccccccccccEEEEcccccccccccccccccccccEEEEccccccccccccccccccccccccccccccHHHHHccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHcccccccccccccccEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEEcccccccccccccccccccccccccccccccEEEEEEEcccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccccEEcccccccccccEEEEccccccccccccccccccccccccccccccHHHHHcccccccccccccccHHHHHHHHHHHHHccccccccccccccHHHHccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccHHHHHHHHHHHccccccccEEEEEcccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccEEcccccccccEEEEEEEEcccEEEEEEEEcccccccHHHHHHHHHHHHccccccccHHHHHHHHccccccccccEEEEEEEEEcccccccccccccccccccccccccccccccEEEEEEEcccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccccEEcccccccccccEEEEccccccccccccccccccccccccccccccHHHHHcccccccccccccccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHccccccccccccHHccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccc
ccccccccccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccEEEEEEEEEcccccEcccHHHHHHHHHHHHHHHHHHHHccccHHHccccccccHHHEEccccccccccEEEEEEccccccHHHHHEEcccccccHHHHHHHHHHHcccHHHHHHHcHHHcccccccccccccHEEEEEEEHcccccccccEEEccccccccEEEEEccccEcccccccEEccccccccccccHcccccHEEccccccEEEEEccHHHHHHHHHHHHHHHcccccccccccccccHHHHcccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHccccccccHcHEEccccccccccEEEEEEccccccHHHHHHEcccccccHHHHHHHHHHHcccHHHHHHHcHHHcccccccccccccEEEEEEEEccccccccccEEEEcccccccEEEEEEcccccccccccccccccccccccccHHHccHHHHccccccEEEEEccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHcccccccccHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccEEEEEEEccccccEEEEEEEcccccEEEEEEcccccEHHHHHHHHcccccEEEHEEcHccccccccEEEEEEEccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHEEEcccccccccEEEEEEcccccccccccccccccccccccccHHHccHHHHccccccEEEEcccHHHHHHHHHHHHHHHccccccccccHHHHHHHHccccccccccHHHHHHHHHHHcccccccccHHHHHccccHHccccHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccccHHHHccccccccccccccccccccccccccccHHHHccHHHccccHHHHHHHHHHHHHHHcccccccHHEEEEEEccccccccccHHHHccHHHHHHHHHHHHHcccccccccccccccccccEEEccEEccccccEEEEEEccccEEEEEEEcccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccEEEEEHHcccHHHHHHHHHcccccEEEcEEcccccccccccEEEEEEccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHEEEcccccccccEEEEEEcccccccccccccccccccEcccccHHHccHHHHcccccccEEEcccHHHHHHHHHHHHHHHccccccccccccHHHHHHHHccccccccccccHHHHHHHHHccccccccEEHccccccHHHcccccccccHHHHHHHHHHHcccccccccHHHHHccccccccccccHHHcccccccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
gqgrlsapaghpiqTYFQNARKLFVNSLLNRVTNSMASDLRRKTIQQLLykdnskpfLAFVGVSLasgtgiltkedefeGVCWEIRHAVNNMFDKLVQvetlpdvddvkvddiqIGKFIAKGTNAVVYEATFRGVEYALKMMFNYSAASNSHAILKAMSKEllplrkplrlNEDMLMNSvenlpphpnvvVMHFAftdfvpsipdssliypkdntcpqlvitdfgssytnksglsmqyssadielggnvalmapevalatpglfsfvnysksdawtaGTVAYEifghdnpfyqsarntdyevnalpqlntnVPEVMRRLVAKLLendpsdrpsaELAATVCQLYLwapkhwlygatpshNEIMQWLLTLTTKVLctgvsygghvrRTFVEYQLISTFLKRAEFRLITNALQYIQRLLVRYikplqpghkiefltqppatssgqgrlsapaghpiqTYFQNARKLFVNSLLNRVTNSMASDLRRKTIQQLLykdnskpfLAFVGVSLasgtgiltkedefeGVCWEIRHAVNNMFDKLVQvetlpdvddvkvddiqIGKFIAKGTNAVVYEATFRGVEYALKMMFNYSAASNSHAILKAMSKEllplrkplrlNEDMLMNSvenlpphpnvvVMHFAftdfvpsipdssliypkdntcpqlvitdfgssytnksglsmqyssadielggnvalmapevalatpglfsfvnysksdawtaGTVAYEifghdnpfyqsarntdyevnalpqlntnVPEVMRRLVAKLLendpsdrpsaELAATVCQLYLwapkhwlygatpshNEIMQWLLTLTTKVLctgvsygghvrRTFVEYQLISTFLKRAEFRLITNALQYIQRNEDMLMNsvenlpphpnvvVMHFAftdfvpsipdssliypsalparlnptggygrnMSLFILMKKYNTDLRNYLRERCAQLSMHERILLFTQLLEGVthlnmhrtahrdlksdnilldcsedntcpqlvitdfgssytnksglsmqyssadielggnvalmapevalatpglfsfvnysksdawtaGTVAYEifghdnpfyqsarntdyevnalpqlntnVPEVMRRLVAKLLendpsdrpsaELAATVCQLYLwapkhwlygatpshNEIMQWLLTLTTKVLctgvsygghvrRTFVEYQLISTFLKRAEFRLITNALQYIQRLLVRYikplqpghkiefltqppttssgqgrlsapaghpiqTYFQNARKLFVNSLLNRVTNSMASDLRRKTIQQLLykdnskpfLAFVGVSLasgtgiltkedefeGVCWEIRHAVNNMFDKLVQvetlpdvddvkvddiqIGKFIAKGTNAVVYEATFRGVEYALKMMFNYSAASNSHAILKAMSKEllplrkplrlNEDMLMNSvenlpphpnvvVMHFAftdfvpsipdssliypsalparlnptggygrnMSLFILMKKYNTDLRNYLRERCAQLSMHERILLFTQLLEGVthlnmhrtahrdlksdnilldcsedntcpqlvitdfgssytnksglsmqyssadielggnvalmapevalatpglfsfvnysksdawtaGTVAYEifghdnpfyqsarntdyWHRKWLWQHLvyshssttpstvayeifghdnpfyqsarntdyevnalpqlntnVPEVMRRLVAKLLendpsdrpsaELAATVCQLYLwapkhwlygatpshNEIMQWLLTLTTKVLctgvsygghvrRTFVEYQLISTFLKRAEFRLITNALQYIQRVLTPKPLV
gqgrlsapaghpIQTYFQNARKLFVNSLLNRVTNSMASDLRRKTIQQLLYKDNSKPFLAFVGVSLASGTGILTKEDEFEGVCWEIRHAVNNMFDKLVQVETLPDVDDVKVDDIQIgkfiakgtnavvYEATFRGVEYALKMMFNYSAASNSHAILKAMSKELLPLRKPLRLNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPKDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYLWAPKHWLYGATPSHNEIMQWLLTLTTKVLCTGVSYGGHVRRTFVEYQLISTFLKRAEFRLITNALQYIQRLLVRYIKPLQPGHKIEFLTQPPATSSGQGRLSAPAGHPIQTYFQNARKLFVNSLLNRVTNSMASDLRRKTIQQLLYKDNSKPFLAFVGVSLASGTGILTKEDEFEGVCWEIRHAVNNMFDKLVQVETLPDVDDVKVDDIQIgkfiakgtnavvYEATFRGVEYALKMMFNYSAASNSHAILKAMSKELLPLRKPLRLNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPKDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYLWAPKHWLYGATPSHNEIMQWLLTLTTKVLCTGVSYGGHVRRTFVEYQLISTFLKRAEFRLITNALQYIQRNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPSALPARLNPTGGYGRNMSLFILMKKYNTDLRNYLRERCAQLSMHERILLFTQLLEGVTHLNMHRTAHRDLKSDNILLDCSEDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYLWAPKHWLYGATPSHNEIMQWLLTLTTKVLCTGVSYGGHVRRTFVEYQLISTFLKRAEFRLITNALQYIQRLLVRYIKPLQPGHKIEFLTQPPTTSSGQGRLSAPAGHPIQTYFQNARKLFVNSLLNRVTNSMASDLRRKTIQQLLYKDNSKPFLAFVGVSLASGTGILTKEDEFEGVCWEIRHAVNNMFDKLVQVETLPDVDDVKVDDIQIgkfiakgtnavvYEATFRGVEYALKMMFNYSAASNSHAILKAMSKELLPLRKPLRLNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPSALPARLNPTGGYGRNMSLFILMKKYNTDLRNYLRERCAQLSMHERILLFTQLLEGVTHLNMHRTAHRDLKSDNILLDCSEDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYWHRKWLWQHLVYSHSSTTPSTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYLWAPKHWLYGATPSHNEIMQWLLTLTTKVLCTGVSYGGHVRRTFVEYQLISTFLKRAEFRLITNALQYiqrvltpkplv
GQGRLSAPAGHPIQTYFQNARKLFVNSLLNRVTNSMASDLRRKTIQQLLYKDNSKPFLAFVGVSLASGTGILTKEDEFEGVCWEIRHAVNNMFDKLVQVETLPdvddvkvddIQIGKFIAKGTNAVVYEATFRGVEYALKMMFNYSAASNSHAILKAMSkellplrkplrlneDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPKDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYLWAPKHWLYGATPSHNEIMQWLLTLTTKVLCTGVSYGGHVRRTFVEYQLISTFLKRAEFRLITNALQYIQRLLVRYIKPLQPGHKIEFLTQPPATSSGQGRLSAPAGHPIQTYFQNARKLFVNSLLNRVTNSMASDLRRKTIQQLLYKDNSKPFLAFVGVSLASGTGILTKEDEFEGVCWEIRHAVNNMFDKLVQVETLPdvddvkvddIQIGKFIAKGTNAVVYEATFRGVEYALKMMFNYSAASNSHAILKAMSkellplrkplrlneDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPKDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYLWAPKHWLYGATPSHNEIMQWLLTLTTKVLCTGVSYGGHVRRTFVEYQLISTFLKRAEFRLITNALQYIQRNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPSALPARLNPTGGYGRNMSLFILMKKYNTDLRNYLRERCAQLSMHERILLFTQLLEGVTHLNMHRTAHRDLKSDNILLDCSEDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYLWAPKHWLYGATPSHNEIMQWLLTLTTKVLCTGVSYGGHVRRTFVEYQLISTFLKRAEFRLITNALQYIQRLLVRYIKPLQPGHKIEFLTQPPTTSSGQGRLSAPAGHPIQTYFQNARKLFVNSLLNRVTNSMASDLRRKTIQQLLYKDNSKPFLAFVGVSLASGTGILTKEDEFEGVCWEIRHAVNNMFDKLVQVETLPdvddvkvddIQIGKFIAKGTNAVVYEATFRGVEYALKMMFNYSAASNSHAILKAMSkellplrkplrlneDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPSALPARLNPTGGYGRNMSLFILMKKYNTDLRNYLRERCAQLSMHERILLFTQLLEGVTHLNMHRTAHRDLKSDNILLDCSEDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYWHRKWLWQHLVYSHSSTTPSTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYLWAPKHWLYGATPSHNEIMQWLLTLTTKVLCTGVSYGGHVRRTFVEYQLISTFLKRAEFRLITNALQYIQRVLTPKPLV
************IQTYFQNARKLFVNSLLNRVTNSMASDLRRKTIQQLLYKDNSKPFLAFVGVSLASGTGILTKEDEFEGVCWEIRHAVNNMFDKLVQVETLPDVDDVKVDDIQIGKFIAKGTNAVVYEATFRGVEYALKMMFNYSAASNSHAILKAMSKELLPLRKPLRLNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPKDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLL**********ELAATVCQLYLWAPKHWLYGATPSHNEIMQWLLTLTTKVLCTGVSYGGHVRRTFVEYQLISTFLKRAEFRLITNALQYIQRLLVRYIKPLQPGHKIEFL*******************PIQTYFQNARKLFVNSLLNRVTNSMASDLRRKTIQQLLYKDNSKPFLAFVGVSLASGTGILTKEDEFEGVCWEIRHAVNNMFDKLVQVETLPDVDDVKVDDIQIGKFIAKGTNAVVYEATFRGVEYALKMMFNYSAASNSHAILKAMSKELLPLRKPLRLNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPKDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLL**********ELAATVCQLYLWAPKHWLYGATPSHNEIMQWLLTLTTKVLCTGVSYGGHVRRTFVEYQLISTFLKRAEFRLITNALQYIQRNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPSALPARLNPTGGYGRNMSLFILMKKYNTDLRNYLRERCAQLSMHERILLFTQLLEGVTHLNMHRTAHRDLKSDNILLDCSEDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLL**********ELAATVCQLYLWAPKHWLYGATPSHNEIMQWLLTLTTKVLCTGVSYGGHVRRTFVEYQLISTFLKRAEFRLITNALQYIQRLLVRYIKPLQPGHKIEFL*******************PIQTYFQNARKLFVNSLLNRVTNSMASDLRRKTIQQLLYKDNSKPFLAFVGVSLASGTGILTKEDEFEGVCWEIRHAVNNMFDKLVQVETLPDVDDVKVDDIQIGKFIAKGTNAVVYEATFRGVEYALKMMFNYSAASNSHAILKAMSKELLPLRKPLRLNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPSALPARLNPTGGYGRNMSLFILMKKYNTDLRNYLRERCAQLSMHERILLFTQLLEGVTHLNMHRTAHRDLKSDNILLDCSEDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYWHRKWLWQHLVYSHSSTTPSTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLL**********ELAATVCQLYLWAPKHWLYGATPSHNEIMQWLLTLTTKVLCTGVSYGGHVRRTFVEYQLISTFLKRAEFRLITNALQYIQRVL******
***************YFQNARKLFVNSLLNRVTNSMAS***********YKDNSKPFLAFVGVSLAS****************************************VKVDDIQIGKFIAKGTNAVVYEATFRGVEYALKMMFNYSAASNSHAILKAMSKELLPLRKPLRLNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPKDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYLWAPKHW****************TLTTKVLCTGVS***HVRRTFVEYQLISTFLKRAEFRLITNALQYIQRLLVRY**************************************QNARKLFVNSL***************************PFLAFVGVSLA*******************************************VDDIQIGKFIAKGTNAVVYEATFRGVEYALKMMFNYSAASNSHAILKAMSKELLPLRKPLRLNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPKDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYLWAPKHWLYGATPSHNEIMQWLLTLTTKVLCTGVSYGGHVRRTFVEYQLISTFLKRAEFRLITNALQYIQRNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPSALPARLNPTGGYGRNMSLFILMKKYNTDLRNYLRERCAQLSMHERILLFTQLLEGVTHLNMHRTAHRDLKSDNILLDCSEDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYLWAP*****************************VSYGGHVRRTFVEYQLISTFLKRAEFRLITNALQYIQRLLVRYIKPLQPGH***************************************************************************************************************************DDIQIGKFIAKGTNAVVYEATFRGVEYALKMMFNY******************PLRKPLRLNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPSALPARLNPTGGYGRNMSLFILMKKYNTDLRNYLRERCAQLSMHERILLFTQLLEGVTHLNMHRTAHRDLKSDNILLDCSEDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYWHRKWLWQHLVYSHSSTTPSTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYLWAPKHW************QWLLTLTTKVLCT**S***H*RRTFVEYQLISTFLKRAEFRLITNALQYIQRVLTPKP**
********AGHPIQTYFQNARKLFVNSLLNRVTNSMASDLRRKTIQQLLYKDNSKPFLAFVGVSLASGTGILTKEDEFEGVCWEIRHAVNNMFDKLVQVETLPDVDDVKVDDIQIGKFIAKGTNAVVYEATFRGVEYALKMMFNYSAASNSHAILKAMSKELLPLRKPLRLNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPKDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYLWAPKHWLYGATPSHNEIMQWLLTLTTKVLCTGVSYGGHVRRTFVEYQLISTFLKRAEFRLITNALQYIQRLLVRYIKPLQPGHKIEFLTQP***********APAGHPIQTYFQNARKLFVNSLLNRVTNSMASDLRRKTIQQLLYKDNSKPFLAFVGVSLASGTGILTKEDEFEGVCWEIRHAVNNMFDKLVQVETLPDVDDVKVDDIQIGKFIAKGTNAVVYEATFRGVEYALKMMFNYSAASNSHAILKAMSKELLPLRKPLRLNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPKDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYLWAPKHWLYGATPSHNEIMQWLLTLTTKVLCTGVSYGGHVRRTFVEYQLISTFLKRAEFRLITNALQYIQRNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPSALPARLNPTGGYGRNMSLFILMKKYNTDLRNYLRERCAQLSMHERILLFTQLLEGVTHLNMHRTAHRDLKSDNILLDCSEDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYLWAPKHWLYGATPSHNEIMQWLLTLTTKVLCTGVSYGGHVRRTFVEYQLISTFLKRAEFRLITNALQYIQRLLVRYIKPLQPGHKIEFLTQP**********SAPAGHPIQTYFQNARKLFVNSLLNRVTNSMASDLRRKTIQQLLYKDNSKPFLAFVGVSLASGTGILTKEDEFEGVCWEIRHAVNNMFDKLVQVETLPDVDDVKVDDIQIGKFIAKGTNAVVYEATFRGVEYALKMMFNYSAASNSHAILKAMSKELLPLRKPLRLNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPSALPARLNPTGGYGRNMSLFILMKKYNTDLRNYLRERCAQLSMHERILLFTQLLEGVTHLNMHRTAHRDLKSDNILLDCSEDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYWHRKWLWQHLVYSHSSTTPSTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYLWAPKHWLYGATPSHNEIMQWLLTLTTKVLCTGVSYGGHVRRTFVEYQLISTFLKRAEFRLITNALQYIQRVLTPKPLV
**********HPIQTYFQNARKLFVNSLLNRVTNSMASDLRRKTIQQLLYKDNSKPFLAFVGVSLASGTGILTKEDEFEGVCWEIRHAVNNMFDKLVQVETLPDVDDVKVDDIQIGKFIAKGTNAVVYEATFRGVEYALKMMFNYSAASNSHAILKAMSKELLPLRKPLRLNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPKDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYLWAPKHWLYGATPSHNEIMQWLLTLTTKVLCTGVSYGGHVRRTFVEYQLISTFLKRAEFRLITNALQYIQRLLVRYIKPLQPGHK**********************HPIQTYFQNARKLFVNSLLNRVTNSMASDLRRKTIQQLLYKDNSKPFLAFVGVSLASGTGILTKEDEFEGVCWEIRHAVNNMFDKLVQVETLPDVDDVKVDDIQIGKFIAKGTNAVVYEATFRGVEYALKMMFNYSAASNSHAILKAMSKELLPLRKPLRLNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPKDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYLWAPKHWLYGATPSHNEIMQWLLTLTTKVLCTGVSYGGHVRRTFVEYQLISTFLKRAEFRLITNALQYIQRNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPSALPARLNPTGGYGRNMSLFILMKKYNTDLRNYLRERCAQLSMHERILLFTQLLEGVTHLNMHRTAHRDLKSDNILLDCSEDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYLWAPKHWLYGATPSHNEIMQWLLTLTTKVLCTGVSYGGHVRRTFVEYQLISTFLKRAEFRLITNALQYIQRLLVRYIKPLQPGHKI****Q*PT************GHPIQTYFQNARKLFVNSLLNRVTNSMASDLRRKTIQQLLYKDNSKPFLAFVGVSLASGTGILTKEDEFEGVCWEIRHAVNNMFDK*********VDDVKVDDIQIGKFIAKGTNAVVYEATFRGVEYALKMMFNYSAASNSHAILKAMSKELLPLRKPLRLNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPSALPARLNPTGGYGRNMSLFILMKKYNTDLRNYLRERCAQLSMHERILLFTQLLEGVTHLNMHRTAHRDLKSDNILLDCSEDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYWHRKWLWQHLVYSHSSTTPSTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYLWAPKHWLYGATPSHNEIMQWLLTLTTKVLCTGVSYGGHVRRTFVEYQLISTFLKRAEFRLITNALQYIQRVLTPKP**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GQGRLSAPAGHPIQTYFQNARKLFVNSLLNRVTNSMASDLRRKTIQQLLYKDNSKPFLAFVGVSLASGTGILTKEDEFEGVCWEIRHAVNNMFDKLVQVETLPDVDDVKVDDIQIGKFIAKGTNAVVYEATFRGVEYALKMMFNYSAASNSHAILKAMSKELLPLRKPLRLNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPKDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYLWAPKHWLYGATPSHNEIMQWLLTLTTKVLCTGVSYGGHVRRTFVEYQLISTFLKRAEFRLITNALQYIQRLLVRYIKPLQPGHKIEFLTQPPATSSGQGRLSAPAGHPIQTYFQNARKLFVNSLLNRVTNSMASDLRRKTIQQLLYKDNSKPFLAFVGVSLASGTGILTKEDEFEGVCWEIRHAVNNMFDKLVQVETLPDVDDVKVDDIQIGKFIAKGTNAVVYEATFRGVEYALKMMFNYSAASNSHAILKAMSKELLPLRKPLRLNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPKDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYLWAPKHWLYGATPSHNEIMQWLLTLTTKVLCTGVSYGGHVRRTFVEYQLISTFLKRAEFRLITNALQYIQRNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPSALPARLNPTGGYGRNMSLFILMKKYNTDLRNYLRERCAQLSMHERILLFTQLLEGVTHLNMHRTAHRDLKSDNILLDCSEDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYLWAPKHWLYGATPSHNEIMQWLLTLTTKVLCTGVSYGGHVRRTFVEYQLISTFLKRAEFRLITNALQYIQRLLVRYIKPLQPGHKIEFLTQPPTTSSGQGRLSAPAGHPIQTYFQNARKLFVNSLLNRVTNSMASDLRRKTIQQLLYKDNSKPFLAFVGVSLASGTGILTKEDEFEGVCWEIRHAVNNMFDKLVQVETLPDVDDVKVDDIQIGKFIAKGTNAVVYEATFRGVEYALKMMFNYSAASNSHAILKAMSKELLPLRKPLRLNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPSALPARLNPTGGYGRNMSLFILMKKYNTDLRNYLRERCAQLSMHERILLFTQLLEGVTHLNMHRTAHRDLKSDNILLDCSEDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYWHRKWLWQHLVYSHSSTTPSTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYLWAPKHWLYGATPSHNEIMQWLLTLTTKVLCTGVSYGGHVRRTFVEYQLISTFLKRAEFRLITNALQYIQRVLTPKPLV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1751 2.2.26 [Sep-21-2011]
Q99MQ3580 Serine/threonine-protein yes N/A 0.291 0.879 0.308 4e-59
Q9BXM7581 Serine/threonine-protein yes N/A 0.198 0.597 0.356 5e-55
Q09298641 Serine/threonine-protein yes N/A 0.141 0.385 0.354 1e-35
Q75JK0781 Dual specificity protein yes N/A 0.219 0.491 0.210 3e-11
P84390382 Serine/threonine-protein no N/A 0.105 0.484 0.247 4e-11
P28926382 Serine/threonine-protein no N/A 0.105 0.484 0.247 4e-11
P32516382 Serine/threonine-protein no N/A 0.105 0.484 0.247 4e-11
Q9BXA6273 Testis-specific serine/th no N/A 0.100 0.644 0.300 8e-11
Q925K9273 Testis-specific serine/th no N/A 0.097 0.626 0.293 1e-10
P31325406 Phosphorylase b kinase ga yes N/A 0.095 0.413 0.32 1e-10
>sp|Q99MQ3|PINK1_MOUSE Serine/threonine-protein kinase PINK1, mitochondrial OS=Mus musculus GN=Pink1 PE=2 SV=2 Back     alignment and function desciption
 Score =  231 bits (589), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 191/620 (30%), Positives = 275/620 (44%), Gaps = 110/620 (17%)

Query: 1171 ITNALQYIQRLLVRYIKPLQPGHKIEFLTQPPTTSSGQGRLSAPAGHPIQTYFQNARKLF 1230
            +   LQ  + LL+R+    +PG    +    P  + G+G        P Q     A+   
Sbjct: 7    LGRGLQLGRALLLRFAP--KPGPLFGWGKPGPAAAWGRGE------RPGQVVSPGAQPRP 58

Query: 1231 VNSLLN---RVTNSMASDLRRKTIQQLLYKDNSKPFLAFVGVSLASGTGI-LTKEDEFEG 1286
            V   L    R      + L  +  +Q + +           V LA G G+ L +E + EG
Sbjct: 59   VGLPLPDRYRFFRQSVAGLAARIQRQFMVRARGGAGPCGRAVFLAFGLGLGLIEEKQAEG 118

Query: 1287 -----VCWEIRHAVNNMFDKLVQVETLPDVDDVKVDDIQIGKFIAKGTNAVVYEAT---- 1337
                  C EI+        ++            +++D  IG+ I KG NA VYEAT    
Sbjct: 119  RRAASACQEIQAIFTQKTKRVSDPLDTRCWQGFRLEDYLIGQAIGKGCNAAVYEATMPTL 178

Query: 1338 --------------------FRGVE-----------YALKMMFNYSAASNSHAILKAMSK 1366
                                 +G +           +A+KMM+N SA S+S AIL  MS+
Sbjct: 179  PQHLEKAKHLGLIGKGPDVVLKGADGEQAPGTPTFPFAIKMMWNISAGSSSEAILSKMSQ 238

Query: 1367 ELLPLRKPLRLNEDMLM------NSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPSAL 1420
            EL+P  +     E   +      +  + L PHPN++ +  AFT  VP +P +   YP  L
Sbjct: 239  ELVPASRVALAGEYGAVTYRRSRDGPKQLAPHPNIIRVFRAFTSSVPLLPGALADYPDML 298

Query: 1421 PARLNPTG-GYGRNMSLFILMKKYNTDLRNYLRERCAQLSMHERILLFTQLLEGVTHLNM 1479
            P    P G G+GR  +LF++MK Y   LR YL E+    S     ++  QLLEGV HL  
Sbjct: 299  PPHYYPEGLGHGR--TLFLVMKNYPCTLRQYLEEQTP--SSRLATMMTLQLLEGVDHLVQ 354

Query: 1480 HRTAHRDLKSDNILLDCSEDNTCPQLVITDFGSSYTNKS-GLSMQYSSADIELGGNVALM 1538
               AHRDLKSDNIL++   D  CP LVI+DFG    ++  GL + ++S+ +E GGN +LM
Sbjct: 355  QGIAHRDLKSDNILVEWDSDG-CPWLVISDFGCCLADQHVGLRLPFNSSSVERGGNGSLM 413

Query: 1539 APEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYWHRKWLWQHLVY 1598
            APEV+ A  G  + ++YSK+D W  G +AYEIFG  NPFY                    
Sbjct: 414  APEVSTAHSGPSAVIDYSKADTWAVGAIAYEIFGLANPFY-------------------- 453

Query: 1599 SHSSTTPSTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSD 1658
                           G  +   +S     Y+   LP++  +VP   RRLV  LL+ + S 
Sbjct: 454  ---------------GQGSAHLES---RSYQEAQLPEMPESVPPEARRLVRSLLQREASK 495

Query: 1659 RPSAELAATVCQLYLWAPKHWLYGATPSHNEIMQWLLTLTTKVLCTGVSYGGHVR-RTFV 1717
            RPSA LAA V  L LW  +H L       ++++ WLL  +   L         +R ++ V
Sbjct: 496  RPSARLAANVLHLSLWG-EHLLALKNLKLDKMIAWLLQQSAATL-----LADRLREKSCV 549

Query: 1718 EYQLISTFLKRAEFRLITNA 1737
            E +L   FL   E   +  A
Sbjct: 550  ETKLQMLFLANLECEALCQA 569




Protects against mitochondrial dysfunction during cellular stress, potentially by phosphorylating mitochondrial proteins (By similarity). Involved in the clearance of damaged mitochondria via selective autophagy (mitophagy) (By similarity). It is necessary for PARK2 recruitment to dysfunctional mitochondria to initiate their degradation.
Mus musculus (taxid: 10090)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9BXM7|PINK1_HUMAN Serine/threonine-protein kinase PINK1, mitochondrial OS=Homo sapiens GN=PINK1 PE=1 SV=1 Back     alignment and function description
>sp|Q09298|PINK1_CAEEL Serine/threonine-protein kinase pink-1, mitochondrial OS=Caenorhabditis elegans GN=pink-1 PE=3 SV=2 Back     alignment and function description
>sp|Q75JK0|ZAK1_DICDI Dual specificity protein kinase zakA OS=Dictyostelium discoideum GN=zakA PE=1 SV=1 Back     alignment and function description
>sp|P84390|US03_EHV1V Serine/threonine-protein kinase US3 homolog OS=Equine herpesvirus 1 (strain V592) GN=69 PE=3 SV=1 Back     alignment and function description
>sp|P28926|US03_EHV1B Serine/threonine-protein kinase US3 homolog OS=Equine herpesvirus 1 (strain Ab4p) GN=69 PE=3 SV=1 Back     alignment and function description
>sp|P32516|KR1_EHV1K Serine/threonine-protein kinase OS=Equine herpesvirus 1 (strain Kentucky A) GN=US2 PE=3 SV=1 Back     alignment and function description
>sp|Q9BXA6|TSSK6_HUMAN Testis-specific serine/threonine-protein kinase 6 OS=Homo sapiens GN=TSSK6 PE=1 SV=1 Back     alignment and function description
>sp|Q925K9|TSSK6_MOUSE Testis-specific serine/threonine-protein kinase 6 OS=Mus musculus GN=Tssk6 PE=2 SV=1 Back     alignment and function description
>sp|P31325|PHKG2_RAT Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Rattus norvegicus GN=Phkg2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1751
193627302578 PREDICTED: serine/threonine-protein kina 0.274 0.830 0.441 1e-124
156555444614 PREDICTED: serine/threonine-protein kina 0.282 0.806 0.436 1e-120
340729581613 PREDICTED: serine/threonine-protein kina 0.273 0.781 0.451 1e-119
350411252613 PREDICTED: serine/threonine-protein kina 0.273 0.781 0.451 1e-119
66545638614 PREDICTED: serine/threonine-protein kina 0.271 0.775 0.436 1e-118
380018787614 PREDICTED: serine/threonine-protein kina 0.281 0.802 0.426 1e-118
383859216613 PREDICTED: serine/threonine-protein kina 0.292 0.835 0.430 1e-117
332030037614 Serine/threonine-protein kinase PINK1, m 0.273 0.780 0.444 1e-117
307190440612 Serine/threonine-protein kinase PINK1, m 0.273 0.782 0.431 1e-117
91083675570 PREDICTED: similar to serine/threonine p 0.302 0.928 0.424 1e-113
>gi|193627302|ref|XP_001946944.1| PREDICTED: serine/threonine-protein kinase PINK1, mitochondrial-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  454 bits (1169), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 248/562 (44%), Positives = 336/562 (59%), Gaps = 82/562 (14%)

Query: 1220 QTYFQNARKLFVNSLLNRVTNSMASDLRRKTIQQLLYKDNSKPFLAFVGVSLASGTGILT 1279
            Q  +  AR+ FV++LL+RVTNS+++DLRR+T + L+Y  NS+PF A VGVSLASG G+LT
Sbjct: 59   QNRWNLARRAFVDNLLSRVTNSLSADLRRRTARHLMY-GNSRPFFALVGVSLASGNGMLT 117

Query: 1280 KEDEFEGVCWEIRHAVNNMFDKLVQVETLPDVDDVKVDDIQIGKFIAKGTNAVVYEATFR 1339
             E++ EGVCWEIR AV  M   L   E L     + +   ++G  IAKG NAVVYEA  R
Sbjct: 118  NENQLEGVCWEIREAVGRMQKNLTVAERLKLNSSLGLKQFELGSVIAKGNNAVVYEA--R 175

Query: 1340 GVE-------------------YALKMMFNYSAASNSHAILKAMSKELLPLRK------- 1373
             +E                    A+KMMFNY A SN+ +IL+AMS+E +P R        
Sbjct: 176  KIEKDRDPSDVIKQGSSNTMYPLAVKMMFNYDAESNAMSILRAMSRETVPSRSVQHDFSR 235

Query: 1374 -----PLRLNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPSALPARLNPTG 1428
                 P+  +++++      L PHPN+V+MH  F D+VP + DS  +YP ALP R+NP  
Sbjct: 236  SDQQWPIGYDQNLI-----KLSPHPNIVMMHLCFADYVPELIDSHTLYPQALPTRINPE- 289

Query: 1429 GYGRNMSLFILMKKYNTDLRNYLRERCAQLSMHERILLFTQLLEGVTHLNMHRTAHRDLK 1488
            GYGRNMSLF++MKKY+  L+ YL  +   L + ++ILL  QLLE V+HL+    AHRD+K
Sbjct: 290  GYGRNMSLFLVMKKYDMSLKQYL-SKAPSLKIRDKILLLAQLLEAVSHLSNQNVAHRDMK 348

Query: 1489 SDNILLDCSEDN-TCPQLVITDFGSSYTNK-SGLSMQYSSADIELGGNVALMAPEVALAT 1546
            +DNILLD SE N  CP LVITDFG    +K +GL++ Y SAD + GGN+ALMAPEV  A 
Sbjct: 349  TDNILLDVSEGNDVCPALVITDFGCCLADKDNGLNLPYKSADTDRGGNIALMAPEVVTAR 408

Query: 1547 PGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYWHRKWLWQHLVYSHSSTTPS 1606
            PG F +++YSK+D W  G +AYEIF  +NPF                    YS+    P 
Sbjct: 409  PGTFGYIDYSKADVWAVGAMAYEIFSDNNPF--------------------YSYERGKPP 448

Query: 1607 TVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAA 1666
             +               RN+ Y+   LP  ++++P +++ L+  LL+   S R  A  AA
Sbjct: 449  LL---------------RNSTYKEEDLPAFSSDIPLIIQTLIHSLLQRSTSKRLDASFAA 493

Query: 1667 TVCQLYLWAPKHWLYG-ATPSHNEIMQWLLTLTTKVLCTG---VSYGGHVRRTFVEYQLI 1722
            TVCQ+YLWAP  W+     P+ NE++QW+L LTTKVLC G   +S     +RT  EYQLI
Sbjct: 494  TVCQIYLWAPSSWITKYVMPTSNEVLQWMLCLTTKVLCEGGTMMSTSSTKQRTCTEYQLI 553

Query: 1723 STFLKRAEFRLITNALQYIQRV 1744
            +TFL RA+   I NAL ++  +
Sbjct: 554  TTFLHRAKLYEIKNALYWMHSI 575




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|156555444|ref|XP_001605979.1| PREDICTED: serine/threonine-protein kinase PINK1, mitochondrial-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|340729581|ref|XP_003403078.1| PREDICTED: serine/threonine-protein kinase PINK1, mitochondrial-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350411252|ref|XP_003489286.1| PREDICTED: serine/threonine-protein kinase PINK1, mitochondrial-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|66545638|ref|XP_623327.1| PREDICTED: serine/threonine-protein kinase PINK1, mitochondrial-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380018787|ref|XP_003693303.1| PREDICTED: serine/threonine-protein kinase PINK1, mitochondrial-like [Apis florea] Back     alignment and taxonomy information
>gi|383859216|ref|XP_003705092.1| PREDICTED: serine/threonine-protein kinase PINK1, mitochondrial-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|332030037|gb|EGI69862.1| Serine/threonine-protein kinase PINK1, mitochondrial [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307190440|gb|EFN74476.1| Serine/threonine-protein kinase PINK1, mitochondrial [Camponotus floridanus] Back     alignment and taxonomy information
>gi|91083675|ref|XP_968367.1| PREDICTED: similar to serine/threonine protein kinase [Tribolium castaneum] gi|270006820|gb|EFA03268.1| hypothetical protein TcasGA2_TC013202 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1751
FB|FBgn0029891721 Pink1 "PTEN-induced putative k 0.160 0.389 0.471 6.9e-91
ZFIN|ZDB-GENE-041212-53574 pink1 "PTEN induced putative k 0.187 0.573 0.393 2.1e-57
MGI|MGI:1916193580 Pink1 "PTEN induced putative k 0.170 0.513 0.405 2e-60
UNIPROTKB|Q9BXM7581 PINK1 "Serine/threonine-protei 0.152 0.459 0.437 6.4e-60
RGD|1305769550 Pink1 "PTEN induced putative k 0.170 0.541 0.395 2.9e-59
UNIPROTKB|F1SU10599 PINK1 "Uncharacterized protein 0.171 0.500 0.403 2.1e-52
UNIPROTKB|A5PJP5588 PINK1 "Uncharacterized protein 0.170 0.508 0.406 3.4e-52
UNIPROTKB|E2RCD1405 PINK1 "Uncharacterized protein 0.170 0.738 0.406 1.3e-50
UNIPROTKB|F1NAN0498 F1NAN0 "Uncharacterized protei 0.177 0.622 0.389 6.2e-51
WB|WBGene00017137641 pink-1 [Caenorhabditis elegans 0.140 0.383 0.361 8e-33
FB|FBgn0029891 Pink1 "PTEN-induced putative kinase 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 693 (249.0 bits), Expect = 6.9e-91, Sum P(2) = 6.9e-91
 Identities = 142/301 (47%), Positives = 192/301 (63%)

Query:   858 EDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPSALPARLNPTGGYGRNMSLFI 917
             E +L N   +LP HPN+V M   F D V + PD  L+YP A P R+NP G YGRNMSL++
Sbjct:   375 ERLLQNQTVHLPRHPNIVCMFGFFCDEVRNFPDGHLLYPVAQPQRINPQG-YGRNMSLYL 433

Query:   918 LMKKYNTDLRNYLRERCAQLSMHERILLFTQLLEGVTHLNMHRTAHRDLKSDNILLDCSE 977
             LMK+Y+  LR  L  +   LS   RILL  Q+LE V HL+ H  AHRDLKSDN+L++  +
Sbjct:   434 LMKRYDHSLRGLLDSQ--DLSTRNRILLLAQMLEAVNHLSRHGVAHRDLKSDNVLIEL-Q 490

Query:   978 DNTCPQLVITDFGSSYTNK-SGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSK 1036
             D+  P LV++DFG    +K  GL + Y S D++ GGN ALMAPE+    PG F+ +NY K
Sbjct:   491 DDAAPVLVLSDFGCCLADKVHGLRLPYVSHDVDKGGNAALMAPEIFNTMPGPFAVLNYGK 550

Query:  1037 SDAWTAGTVAYEIFGHDNPFYQSA--------------RNTDYEVNALPQLNTNVPEVMR 1082
             +D W  G +AYEIFG+ NPFY S+              RN+DY  + LP ++   P +++
Sbjct:   551 ADLWACGALAYEIFGNRNPFYSSSGGMARERGEMTLSLRNSDYRQDQLPPMSDACPPLLQ 610

Query:  1083 RLVAKLLENDPSDRPSAELAATVCQLYLWAPKHWLY-GATPSHNEIMQWLLTLTTKVLCT 1141
             +LV  +L  +PS R S ++AA V QL+LWAP +WL  G  P+  EI+QWLL+LTTK++C 
Sbjct:   611 QLVYNILNPNPSKRVSPDIAANVVQLFLWAPSNWLKAGGMPNSPEILQWLLSLTTKIMCE 670

Query:  1142 G 1142
             G
Sbjct:   671 G 671


GO:0004672 "protein kinase activity" evidence=NAS
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0043524 "negative regulation of neuron apoptotic process" evidence=IDA
GO:0007005 "mitochondrion organization" evidence=IGI;IMP;IDA
GO:0043069 "negative regulation of programmed cell death" evidence=IMP
GO:0006979 "response to oxidative stress" evidence=IMP
GO:0048749 "compound eye development" evidence=IMP
GO:0016006 "Nebenkern" evidence=IDA
GO:0030382 "sperm mitochondrion organization" evidence=IMP
GO:0000266 "mitochondrial fission" evidence=IGI
GO:0010821 "regulation of mitochondrion organization" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
ZFIN|ZDB-GENE-041212-53 pink1 "PTEN induced putative kinase 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1916193 Pink1 "PTEN induced putative kinase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BXM7 PINK1 "Serine/threonine-protein kinase PINK1, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1305769 Pink1 "PTEN induced putative kinase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1SU10 PINK1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|A5PJP5 PINK1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RCD1 PINK1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NAN0 F1NAN0 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
WB|WBGene00017137 pink-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.7.11.10.737
3rd Layer2.7.110.691

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1751
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 2e-24
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 1e-23
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 3e-23
pfam00069260 pfam00069, Pkinase, Protein kinase domain 4e-22
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 1e-21
pfam00069260 pfam00069, Pkinase, Protein kinase domain 1e-20
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 3e-17
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 4e-17
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 2e-16
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 5e-15
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 7e-15
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 1e-14
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 4e-14
PHA03209357 PHA03209, PHA03209, serine/threonine kinase US3; P 7e-14
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 7e-14
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 3e-13
PHA03209357 PHA03209, PHA03209, serine/threonine kinase US3; P 5e-13
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 6e-13
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 7e-13
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 1e-12
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 2e-12
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 2e-12
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 4e-12
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 5e-12
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 9e-12
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 9e-12
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 2e-11
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 2e-11
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 3e-11
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 6e-11
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 9e-11
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 2e-10
PTZ00283496 PTZ00283, PTZ00283, serine/threonine protein kinas 3e-10
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 3e-10
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 5e-10
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 6e-10
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 6e-10
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 7e-10
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 8e-10
cd07838287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 9e-10
cd07838287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 9e-10
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 1e-09
cd07831282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 1e-09
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 2e-09
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 3e-09
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 3e-09
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 4e-09
cd08224267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 5e-09
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 6e-09
cd05038284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 7e-09
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 9e-09
cd08222260 cd08222, STKc_Nek11, Catalytic domain of the Prote 1e-08
cd08221256 cd08221, STKc_Nek9, Catalytic domain of the Protei 1e-08
cd05036277 cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro 1e-08
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 2e-08
cd05038284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 2e-08
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 2e-08
cd06620284 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of 2e-08
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 2e-08
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 3e-08
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 3e-08
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 3e-08
PHA03207392 PHA03207, PHA03207, serine/threonine kinase US3; P 3e-08
cd08225257 cd08225, STKc_Nek5, Catalytic domain of the Protei 4e-08
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 5e-08
cd05575323 cd05575, STKc_SGK, Catalytic domain of the Protein 5e-08
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 6e-08
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 6e-08
PHA03211461 PHA03211, PHA03211, serine/threonine kinase US3; P 6e-08
PHA03211461 PHA03211, PHA03211, serine/threonine kinase US3; P 6e-08
cd05605285 cd05605, STKc_GRK4_like, Catalytic domain of G pro 6e-08
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 7e-08
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 7e-08
cd08224267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 7e-08
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 8e-08
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 1e-07
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 1e-07
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 1e-07
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 1e-07
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 1e-07
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 1e-07
cd05036277 cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro 1e-07
PTZ00267478 PTZ00267, PTZ00267, NIMA-related protein kinase; P 1e-07
PTZ00283 496 PTZ00283, PTZ00283, serine/threonine protein kinas 2e-07
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 2e-07
cd07831282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 2e-07
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 2e-07
cd05574316 cd05574, STKc_phototropin_like, Catalytic domain o 2e-07
cd07843293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 2e-07
cd07843293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 2e-07
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 2e-07
cd08219255 cd08219, STKc_Nek3, Catalytic domain of the Protei 2e-07
cd05630285 cd05630, STKc_GRK6, Catalytic domain of the Protei 2e-07
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 2e-07
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 2e-07
cd05602325 cd05602, STKc_SGK1, Catalytic domain of the Protei 2e-07
pfam00069260 pfam00069, Pkinase, Protein kinase domain 3e-07
pfam00069260 pfam00069, Pkinase, Protein kinase domain 3e-07
cd08225257 cd08225, STKc_Nek5, Catalytic domain of the Protei 3e-07
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 3e-07
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 3e-07
cd05032277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 3e-07
cd06635317 cd06635, STKc_TAO1, Catalytic domain of the Protei 3e-07
cd05044269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 3e-07
PHA03207392 PHA03207, PHA03207, serine/threonine kinase US3; P 4e-07
cd05614332 cd05614, STKc_MSK2_N, N-terminal catalytic domain 4e-07
cd05112256 cd05112, PTKc_Itk, Catalytic domain of the Protein 4e-07
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 4e-07
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 4e-07
cd05084252 cd05084, PTKc_Fes, Catalytic domain of the Protein 4e-07
cd06634308 cd06634, STKc_TAO2, Catalytic domain of the Protei 4e-07
cd07844291 cd07844, STKc_PCTAIRE_like, Catalytic domain of PC 5e-07
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 5e-07
cd05051296 cd05051, PTKc_DDR, Catalytic domain of the Protein 5e-07
PHA03212391 PHA03212, PHA03212, serine/threonine kinase US3; P 7e-07
cd06607307 cd06607, STKc_TAO, Catalytic domain of the Protein 8e-07
cd05583288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 9e-07
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 1e-06
cd06633313 cd06633, STKc_TAO3, Catalytic domain of the Protei 1e-06
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 1e-06
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 1e-06
cd05605285 cd05605, STKc_GRK4_like, Catalytic domain of G pro 2e-06
cd05068261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 2e-06
cd07873301 cd07873, STKc_PCTAIRE1, Catalytic domain of the Se 2e-06
cd05083254 cd05083, PTKc_Chk, Catalytic domain of the Protein 2e-06
cd05083254 cd05083, PTKc_Chk, Catalytic domain of the Protein 2e-06
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 2e-06
cd05080283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 2e-06
cd05113256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 2e-06
cd05113256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 2e-06
cd07871288 cd07871, STKc_PCTAIRE3, Catalytic domain of the Se 2e-06
cd05114256 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro 3e-06
cd07839284 cd07839, STKc_CDK5, Catalytic domain of the Serine 3e-06
cd05081284 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) 3e-06
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 3e-06
cd07857332 cd07857, STKc_MPK1, Catalytic domain of the Serine 4e-06
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 4e-06
cd08228267 cd08228, STKc_Nek6, Catalytic domain of the Protei 4e-06
cd05032277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 5e-06
cd05632285 cd05632, STKc_GRK5, Catalytic domain of the Protei 5e-06
cd05632285 cd05632, STKc_GRK5, Catalytic domain of the Protei 5e-06
cd07854342 cd07854, STKc_MAPK4_6, Catalytic domain of the Ser 5e-06
cd07854342 cd07854, STKc_MAPK4_6, Catalytic domain of the Ser 5e-06
cd05577277 cd05577, STKc_GRK, Catalytic domain of the Protein 5e-06
cd05613290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 5e-06
cd08219255 cd08219, STKc_Nek3, Catalytic domain of the Protei 6e-06
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 6e-06
cd05608280 cd05608, STKc_GRK1, Catalytic domain of the Protei 6e-06
cd07870291 cd07870, STKc_PFTAIRE2, Catalytic domain of the Se 6e-06
cd07870291 cd07870, STKc_PFTAIRE2, Catalytic domain of the Se 6e-06
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 6e-06
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 6e-06
cd05056270 cd05056, PTKc_FAK, Catalytic domain of the Protein 6e-06
cd08223257 cd08223, STKc_Nek4, Catalytic domain of the Protei 6e-06
cd05112256 cd05112, PTKc_Itk, Catalytic domain of the Protein 7e-06
cd07871288 cd07871, STKc_PCTAIRE3, Catalytic domain of the Se 7e-06
cd06620284 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of 8e-06
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 8e-06
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 9e-06
cd08222260 cd08222, STKc_Nek11, Catalytic domain of the Prote 1e-05
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 1e-05
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 1e-05
cd07844291 cd07844, STKc_PCTAIRE_like, Catalytic domain of PC 1e-05
cd06621287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 1e-05
cd07845309 cd07845, STKc_CDK10, Catalytic domain of the Serin 1e-05
cd07845309 cd07845, STKc_CDK10, Catalytic domain of the Serin 1e-05
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 1e-05
cd07855334 cd07855, STKc_ERK5, Catalytic domain of the Serine 1e-05
cd07872309 cd07872, STKc_PCTAIRE2, Catalytic domain of the Se 1e-05
cd07875364 cd07875, STKc_JNK1, Catalytic domain of the Serine 1e-05
cd08218256 cd08218, STKc_Nek1, Catalytic domain of the Protei 1e-05
cd05067260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 1e-05
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 2e-05
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 2e-05
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 2e-05
cd05575323 cd05575, STKc_SGK, Catalytic domain of the Protein 2e-05
PTZ00267478 PTZ00267, PTZ00267, NIMA-related protein kinase; P 2e-05
cd05630285 cd05630, STKc_GRK6, Catalytic domain of the Protei 2e-05
cd05080283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 2e-05
cd08229267 cd08229, STKc_Nek7, Catalytic domain of the Protei 2e-05
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 2e-05
cd07873301 cd07873, STKc_PCTAIRE1, Catalytic domain of the Se 3e-05
cd05608280 cd05608, STKc_GRK1, Catalytic domain of the Protei 3e-05
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 3e-05
cd06638286 cd06638, STKc_myosinIIIA, Catalytic domain of the 3e-05
cd05051296 cd05051, PTKc_DDR, Catalytic domain of the Protein 4e-05
cd05068261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 4e-05
cd05102338 cd05102, PTKc_VEGFR3, Catalytic domain of the Prot 4e-05
cd05085250 cd05085, PTKc_Fer, Catalytic domain of the Protein 4e-05
cd06639291 cd06639, STKc_myosinIIIB, Catalytic domain of the 4e-05
cd05054337 cd05054, PTKc_VEGFR, Catalytic domain of the Prote 4e-05
cd08528269 cd08528, STKc_Nek10, Catalytic domain of the Prote 4e-05
cd05114256 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro 5e-05
cd07857332 cd07857, STKc_MPK1, Catalytic domain of the Serine 5e-05
cd07855334 cd07855, STKc_ERK5, Catalytic domain of the Serine 5e-05
cd05050288 cd05050, PTKc_Musk, Catalytic domain of the Protei 5e-05
cd05035273 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li 5e-05
cd05586330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 5e-05
cd05060257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 5e-05
cd06635317 cd06635, STKc_TAO1, Catalytic domain of the Protei 6e-05
cd05585312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 6e-05
cd05607277 cd05607, STKc_GRK7, Catalytic domain of the Protei 6e-05
cd05081284 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) 7e-05
cd05631285 cd05631, STKc_GRK4, Catalytic domain of the Protei 7e-05
cd06644292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 8e-05
cd05079284 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma 8e-05
cd07874355 cd07874, STKc_JNK3, Catalytic domain of the Serine 8e-05
cd06638286 cd06638, STKc_myosinIIIA, Catalytic domain of the 9e-05
cd07851343 cd07851, STKc_p38, Catalytic domain of the Serine/ 9e-05
cd05574316 cd05574, STKc_phototropin_like, Catalytic domain o 1e-04
cd05044269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 1e-04
PHA03212391 PHA03212, PHA03212, serine/threonine kinase US3; P 1e-04
cd05613290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 1e-04
cd07872309 cd07872, STKc_PCTAIRE2, Catalytic domain of the Se 1e-04
cd05102338 cd05102, PTKc_VEGFR3, Catalytic domain of the Prot 1e-04
cd06639291 cd06639, STKc_myosinIIIB, Catalytic domain of the 1e-04
cd05585312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 1e-04
cd05607277 cd05607, STKc_GRK7, Catalytic domain of the Protei 1e-04
cd05619316 cd05619, STKc_nPKC_theta, Catalytic domain of the 1e-04
cd05046275 cd05046, PTK_CCK4, Pseudokinase domain of the Prot 1e-04
cd05049280 cd05049, PTKc_Trk, Catalytic domain of the Protein 1e-04
cd05049280 cd05049, PTKc_Trk, Catalytic domain of the Protein 1e-04
cd07834330 cd07834, STKc_MAPK, Catalytic domain of the Serine 1e-04
cd05057279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 1e-04
cd05057279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 1e-04
cd05584323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 1e-04
cd05620316 cd05620, STKc_nPKC_delta, Catalytic domain of the 1e-04
cd06651266 cd06651, STKc_MEKK3, Catalytic domain of the Prote 1e-04
cd05597331 cd05597, STKc_DMPK_like, Catalytic domain of Myoto 1e-04
cd07850353 cd07850, STKc_JNK, Catalytic domain of the Serine/ 1e-04
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 1e-04
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 2e-04
cd05084252 cd05084, PTKc_Fes, Catalytic domain of the Protein 2e-04
cd06634308 cd06634, STKc_TAO2, Catalytic domain of the Protei 2e-04
cd07839284 cd07839, STKc_CDK5, Catalytic domain of the Serine 2e-04
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 2e-04
cd08528269 cd08528, STKc_Nek10, Catalytic domain of the Prote 2e-04
cd05586330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 2e-04
cd05631285 cd05631, STKc_GRK4, Catalytic domain of the Protei 2e-04
cd07851343 cd07851, STKc_p38, Catalytic domain of the Serine/ 2e-04
cd07834330 cd07834, STKc_MAPK, Catalytic domain of the Serine 2e-04
cd05055302 cd05055, PTKc_PDGFR, Catalytic domain of the Prote 2e-04
cd05065269 cd05065, PTKc_EphR_B, Catalytic domain of the Prot 2e-04
cd06659297 cd06659, STKc_PAK6, Catalytic domain of the Protei 2e-04
cd05582318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 2e-04
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 2e-04
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 3e-04
cd08228267 cd08228, STKc_Nek6, Catalytic domain of the Protei 3e-04
cd05577277 cd05577, STKc_GRK, Catalytic domain of the Protein 3e-04
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 3e-04
cd05054337 cd05054, PTKc_VEGFR, Catalytic domain of the Prote 3e-04
cd05055302 cd05055, PTKc_PDGFR, Catalytic domain of the Prote 3e-04
cd07869303 cd07869, STKc_PFTAIRE1, Catalytic domain of the Se 3e-04
cd05100334 cd05100, PTKc_FGFR3, Catalytic domain of the Prote 3e-04
cd05100334 cd05100, PTKc_FGFR3, Catalytic domain of the Prote 3e-04
cd05592316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 3e-04
cd06640277 cd06640, STKc_MST4, Catalytic domain of the Protei 3e-04
cd05045290 cd05045, PTKc_RET, Catalytic domain of the Protein 3e-04
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 4e-04
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 4e-04
cd05602325 cd05602, STKc_SGK1, Catalytic domain of the Protei 4e-04
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 4e-04
cd06644292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 4e-04
cd05592316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 4e-04
cd06641277 cd06641, STKc_MST3, Catalytic domain of the Protei 4e-04
cd07864302 cd07864, STKc_CDK12, Catalytic domain of the Serin 4e-04
cd05082256 cd05082, PTKc_Csk, Catalytic domain of the Protein 4e-04
cd05082256 cd05082, PTKc_Csk, Catalytic domain of the Protein 4e-04
cd06642277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 4e-04
cd05075272 cd05075, PTKc_Axl, Catalytic domain of the Protein 4e-04
cd06633313 cd06633, STKc_TAO3, Catalytic domain of the Protei 5e-04
cd05582318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 5e-04
cd05603321 cd05603, STKc_SGK2, Catalytic domain of the Protei 5e-04
cd05603321 cd05603, STKc_SGK2, Catalytic domain of the Protei 5e-04
cd06636282 cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr 5e-04
cd06636282 cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr 5e-04
cd05072261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 6e-04
cd05606278 cd05606, STKc_beta_ARK, Catalytic domain of the Pr 6e-04
PHA03210501 PHA03210, PHA03210, serine/threonine kinase US3; P 6e-04
PHA03210501 PHA03210, PHA03210, serine/threonine kinase US3; P 6e-04
cd05604325 cd05604, STKc_SGK3, Catalytic domain of the Protei 6e-04
cd05035273 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li 7e-04
cd05103343 cd05103, PTKc_VEGFR2, Catalytic domain of the Prot 7e-04
cd05103343 cd05103, PTKc_VEGFR2, Catalytic domain of the Prot 7e-04
cd07862290 cd07862, STKc_CDK6, Catalytic domain of the Serine 7e-04
cd05614332 cd05614, STKc_MSK2_N, N-terminal catalytic domain 8e-04
cd05099314 cd05099, PTKc_FGFR4, Catalytic domain of the Prote 8e-04
cd05099314 cd05099, PTKc_FGFR4, Catalytic domain of the Prote 8e-04
cd05060257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 9e-04
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 0.001
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 0.001
cd08221256 cd08221, STKc_Nek9, Catalytic domain of the Protei 0.001
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 0.001
cd05583288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 0.001
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 0.001
cd07850353 cd07850, STKc_JNK, Catalytic domain of the Serine/ 0.001
cd07869303 cd07869, STKc_PFTAIRE1, Catalytic domain of the Se 0.001
cd05604325 cd05604, STKc_SGK3, Catalytic domain of the Protei 0.001
cd07862290 cd07862, STKc_CDK6, Catalytic domain of the Serine 0.001
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 0.001
cd07876359 cd07876, STKc_JNK2, Catalytic domain of the Serine 0.001
cd05633279 cd05633, STKc_GRK3, Catalytic domain of the Protei 0.001
cd05571323 cd05571, STKc_PKB, Catalytic domain of the Protein 0.001
cd06637272 cd06637, STKc_TNIK, Catalytic domain of the Protei 0.001
cd06637272 cd06637, STKc_TNIK, Catalytic domain of the Protei 0.001
cd05040257 cd05040, PTKc_Ack_like, Catalytic domain of the Pr 0.001
cd07858337 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of 0.001
cd05624331 cd05624, STKc_MRCK_beta, Catalytic domain of the P 0.001
cd05098307 cd05098, PTKc_FGFR1, Catalytic domain of the Prote 0.001
cd05098307 cd05098, PTKc_FGFR1, Catalytic domain of the Prote 0.001
cd05066267 cd05066, PTKc_EphR_A, Catalytic domain of the Prot 0.001
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 0.002
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 0.002
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 0.002
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 0.002
cd05574316 cd05574, STKc_phototropin_like, Catalytic domain o 0.002
cd05574316 cd05574, STKc_phototropin_like, Catalytic domain o 0.002
cd05044269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 0.002
cd05044269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 0.002
cd08229267 cd08229, STKc_Nek7, Catalytic domain of the Protei 0.002
cd05085250 cd05085, PTKc_Fer, Catalytic domain of the Protein 0.002
cd05619316 cd05619, STKc_nPKC_theta, Catalytic domain of the 0.002
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 0.002
cd05065269 cd05065, PTKc_EphR_B, Catalytic domain of the Prot 0.002
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 0.002
cd05594325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 0.002
cd05048283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 0.002
cd05048283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 0.002
cd05101304 cd05101, PTKc_FGFR2, Catalytic domain of the Prote 0.002
cd05101304 cd05101, PTKc_FGFR2, Catalytic domain of the Prote 0.002
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 0.002
cd05091283 cd05091, PTKc_Ror2, Catalytic domain of the Protei 0.002
cd05600333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 0.002
cd06643282 cd06643, STKc_SLK, Catalytic domain of the Protein 0.002
cd06643282 cd06643, STKc_SLK, Catalytic domain of the Protein 0.002
cd05069260 cd05069, PTKc_Yes, Catalytic domain of the Protein 0.002
cd06652265 cd06652, STKc_MEKK2, Catalytic domain of the Prote 0.002
cd05033266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 0.002
cd06618296 cd06618, PKc_MKK7, Catalytic domain of the dual-sp 0.002
cd05062277 cd05062, PTKc_IGF-1R, Catalytic domain of the Prot 0.002
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 0.003
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 0.003
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 0.003
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 0.003
cd05575323 cd05575, STKc_SGK, Catalytic domain of the Protein 0.003
cd05575323 cd05575, STKc_SGK, Catalytic domain of the Protein 0.003
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 0.003
cd06607307 cd06607, STKc_TAO, Catalytic domain of the Protein 0.003
cd05056270 cd05056, PTKc_FAK, Catalytic domain of the Protein 0.003
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 0.003
cd07858337 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of 0.003
cd05600333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 0.003
cd05092280 cd05092, PTKc_TrkA, Catalytic domain of the Protei 0.003
cd05092280 cd05092, PTKc_TrkA, Catalytic domain of the Protei 0.003
cd06653264 cd06653, STKc_MEKK3_like_1, Catalytic domain of MA 0.003
PTZ002661021 PTZ00266, PTZ00266, NIMA-related protein kinase; P 0.003
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 0.004
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 0.004
cd05602325 cd05602, STKc_SGK1, Catalytic domain of the Protei 0.004
cd05602325 cd05602, STKc_SGK1, Catalytic domain of the Protei 0.004
cd06621287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 0.004
cd07875364 cd07875, STKc_JNK1, Catalytic domain of the Serine 0.004
cd05079284 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma 0.004
cd05597331 cd05597, STKc_DMPK_like, Catalytic domain of Myoto 0.004
cd05045290 cd05045, PTKc_RET, Catalytic domain of the Protein 0.004
cd06641277 cd06641, STKc_MST3, Catalytic domain of the Protei 0.004
cd07864302 cd07864, STKc_CDK12, Catalytic domain of the Serin 0.004
cd05589324 cd05589, STKc_PKN, Catalytic domain of the Protein 0.004
cd07835283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 0.004
cd07835283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 0.004
cd07837295 cd07837, STKc_CdkB_plant, Catalytic domain of the 0.004
cd07837295 cd07837, STKc_CdkB_plant, Catalytic domain of the 0.004
cd07830283 cd07830, STKc_MAK_like, Catalytic domain of Male g 0.004
cd07836284 cd07836, STKc_Pho85, Catalytic domain of the Serin 0.004
cd07860284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 0.004
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
 Score =  103 bits (258), Expect = 2e-24
 Identities = 66/250 (26%), Positives = 108/250 (43%), Gaps = 67/250 (26%)

Query: 1325 IAKGTNAVVYEATFR--GVEYALKMMFNYSAASNSHAILKAMSKELLPLRKPLRLNEDML 1382
            + +G    VY A  +  G + A+K++    ++S    +L    +E+  L+K   LN    
Sbjct: 1    LGEGGFGTVYLARDKKTGKKVAIKIIKKEDSSSLLEELL----REIEILKK---LN---- 49

Query: 1383 MNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPSALPARLNPTGGYGRNMSLFILMKK 1442
                     HPN+V ++  F D                               L+++M+ 
Sbjct: 50   ---------HPNIVKLYGVFED----------------------------ENHLYLVMEY 72

Query: 1443 Y-NTDLRNYLRERCAQLSMHERILLFTQLLEGVTHLNMHRTAHRDLKSDNILLDCSEDNT 1501
                 L++ L+E   +LS  E + +  Q+LEG+ +L+ +   HRDLK +NILL    D+ 
Sbjct: 73   CEGGSLKDLLKENEGKLSEDEILRILLQILEGLEYLHSNGIIHRDLKPENILL----DSD 128

Query: 1502 CPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYS-KSDA 1560
              ++ + DFG S    S  S+  +     + G  A MAPEV      L     YS KSD 
Sbjct: 129  NGKVKLADFGLSKLLTSDKSLLKT-----IVGTPAYMAPEV------LLGKGYYSEKSDI 177

Query: 1561 WTAGTVAYEI 1570
            W+ G + YE+
Sbjct: 178  WSLGVILYEL 187


Protein Kinases (PKs), catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The PK family is part of a larger superfamily that includes the catalytic domains of RIO kinases, aminoglycoside phosphotransferase, choline kinase, phosphoinositide 3-kinase (PI3K), and actin-fragmin kinase. PKs make up a large family of serine/threonine kinases, protein tyrosine kinases (PTKs), and dual-specificity PKs that phosphorylate both serine/threonine and tyrosine residues of target proteins. Majority of protein phosphorylation, about 95%, occurs on serine residues while only 1% occurs on tyrosine residues. Protein phosphorylation is a mechanism by which a wide variety of cellular proteins, such as enzymes and membrane channels, are reversibly regulated in response to certain stimuli. PKs often function as components of signal transduction pathways in which one kinase activates a second kinase, which in turn, may act on other kinases; this sequential action transmits a signal from the cell surface to target proteins, which results in cellular responses. The PK family is one of the largest known protein families with more than 100 homologous yeast enzymes and 550 human proteins. A fraction of PK family members are pseudokinases that lack crucial residues for catalytic activity. The mutiplicity of kinases allows for specific regulation according to substrate, tissue distribution, and cellular localization. PKs regulate many cellular processes including proliferation, division, differentiation, motility, survival, metabolism, cell-cycle progression, cytoskeletal rearrangement, immunity, and neuronal functions. Many kinases are implicated in the development of various human diseases including different types of cancer. Length = 215

>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|165473 PHA03207, PHA03207, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|223009 PHA03211, PHA03211, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|223009 PHA03211, PHA03211, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|165473 PHA03207, PHA03207, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>gnl|CDD|165478 PHA03212, PHA03212, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>gnl|CDD|143375 cd07870, STKc_PFTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|143375 cd07870, STKc_PFTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133233 cd05102, PTKc_VEGFR3, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>gnl|CDD|173635 cd05054, PTKc_VEGFR, Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|165478 PHA03212, PHA03212, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|133233 cd05102, PTKc_VEGFR3, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173635 cd05054, PTKc_VEGFR, Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|173642 cd05075, PTKc_Axl, Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>gnl|CDD|165476 PHA03210, PHA03210, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|165476 PHA03210, PHA03210, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133234 cd05103, PTKc_VEGFR2, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|133234 cd05103, PTKc_VEGFR2, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>gnl|CDD|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173647 cd05091, PTKc_Ror2, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1751
KOG0603|consensus612 100.0
KOG4158|consensus598 100.0
KOG4158|consensus598 100.0
KOG0603|consensus612 100.0
KOG0598|consensus357 100.0
KOG0694|consensus694 100.0
KOG0690|consensus516 100.0
KOG0605|consensus550 100.0
KOG0615|consensus475 100.0
KOG0616|consensus355 100.0
KOG0575|consensus 592 100.0
KOG0595|consensus429 100.0
KOG0592|consensus 604 100.0
KOG0598|consensus357 100.0
KOG0581|consensus364 100.0
KOG0588|consensus 786 100.0
KOG0615|consensus475 100.0
KOG0663|consensus419 100.0
KOG0610|consensus459 100.0
KOG0600|consensus560 100.0
KOG0583|consensus370 100.0
KOG0696|consensus683 100.0
KOG0695|consensus593 100.0
KOG0661|consensus 538 100.0
KOG0593|consensus396 100.0
KOG0033|consensus355 100.0
KOG0599|consensus411 100.0
KOG0192|consensus362 100.0
KOG0616|consensus355 100.0
KOG0605|consensus550 100.0
KOG0660|consensus359 100.0
KOG0032|consensus382 100.0
KOG0612|consensus 1317 100.0
KOG0575|consensus592 100.0
KOG0592|consensus604 100.0
KOG0658|consensus364 100.0
KOG0694|consensus694 100.0
KOG0659|consensus318 100.0
KOG0591|consensus375 100.0
KOG4717|consensus 864 100.0
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 100.0
KOG0581|consensus364 100.0
KOG0585|consensus 576 100.0
KOG0611|consensus 668 100.0
KOG0198|consensus313 100.0
KOG0595|consensus429 100.0
KOG0604|consensus400 100.0
KOG0594|consensus323 100.0
KOG0599|consensus411 100.0
KOG1035|consensus 1351 100.0
KOG0597|consensus 808 100.0
KOG0582|consensus 516 100.0
PTZ00036440 glycogen synthase kinase; Provisional 100.0
KOG0580|consensus281 100.0
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 100.0
KOG0588|consensus786 100.0
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 100.0
KOG0033|consensus355 100.0
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 100.0
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 100.0
KOG0197|consensus468 100.0
PTZ00263329 protein kinase A catalytic subunit; Provisional 100.0
KOG0578|consensus550 100.0
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 100.0
KOG0585|consensus576 100.0
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 100.0
KOG4721|consensus 904 100.0
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 100.0
KOG0192|consensus362 100.0
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 100.0
PHA03212391 serine/threonine kinase US3; Provisional 100.0
KOG0608|consensus1034 100.0
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 100.0
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 100.0
KOG0193|consensus678 100.0
KOG0583|consensus370 100.0
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 100.0
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 100.0
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 100.0
PTZ00284467 protein kinase; Provisional 100.0
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 100.0
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 100.0
PHA02988283 hypothetical protein; Provisional 100.0
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 100.0
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 100.0
KOG0667|consensus586 100.0
KOG0580|consensus281 100.0
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 100.0
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 100.0
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 100.0
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 100.0
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 100.0
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 100.0
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 100.0
KOG0607|consensus463 100.0
KOG0661|consensus538 100.0
KOG0604|consensus400 100.0
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 100.0
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 100.0
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 100.0
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 100.0
PHA03209357 serine/threonine kinase US3; Provisional 100.0
KOG0610|consensus459 100.0
PLN00034353 mitogen-activated protein kinase kinase; Provision 100.0
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 100.0
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 100.0
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 100.0
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 100.0
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 100.0
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 100.0
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 100.0
PHA03207392 serine/threonine kinase US3; Provisional 100.0
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 100.0
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 100.0
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 100.0
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 100.0
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 100.0
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 100.0
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 100.0
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 100.0
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 100.0
KOG0591|consensus375 100.0
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 100.0
PHA03211461 serine/threonine kinase US3; Provisional 100.0
KOG0201|consensus 467 100.0
KOG1989|consensus 738 100.0
KOG4717|consensus864 100.0
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 100.0
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 100.0
KOG0597|consensus808 100.0
KOG0986|consensus591 100.0
PTZ00283 496 serine/threonine protein kinase; Provisional 100.0
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 100.0
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.98
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.98
KOG4236|consensus888 99.98
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.98
KOG0198|consensus313 99.98
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.98
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.98
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.98
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.98
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.98
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.98
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.98
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.98
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.98
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.98
KOG0590|consensus601 99.98
PTZ00267478 NIMA-related protein kinase; Provisional 99.98
KOG4721|consensus904 99.98
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.98
KOG0194|consensus474 99.98
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.98
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.98
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.97
KOG0611|consensus668 99.97
KOG0690|consensus516 99.97
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.97
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.97
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.97
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.97
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.97
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.97
KOG0600|consensus560 99.97
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.97
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.97
KOG0596|consensus677 99.97
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.97
KOG0666|consensus438 99.97
KOG1026|consensus774 99.97
KOG0589|consensus426 99.97
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.97
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.97
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.97
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.97
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.97
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.97
KOG0614|consensus732 99.97
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.97
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.97
KOG0663|consensus419 99.97
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.97
KOG0586|consensus 596 99.97
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.97
KOG0577|consensus 948 99.97
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.97
KOG0579|consensus 1187 99.97
KOG4279|consensus 1226 99.97
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.97
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.97
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.97
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.97
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.97
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.97
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.97
KOG0612|consensus 1317 99.97
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.97
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.97
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.97
KOG0607|consensus463 99.97
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.97
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.97
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.97
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.97
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.97
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.97
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 99.97
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.97
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.97
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.97
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.97
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.97
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.97
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.97
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.97
PHA03210501 serine/threonine kinase US3; Provisional 99.97
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.97
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.97
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.97
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.97
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.97
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.97
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.97
KOG0032|consensus382 99.97
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.97
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.97
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.97
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.97
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.97
KOG0574|consensus 502 99.97
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.97
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.97
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.97
KOG0593|consensus396 99.97
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.97
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.97
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.97
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.97
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.97
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.97
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.97
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.97
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.97
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.97
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.97
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.97
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.97
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.97
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.97
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.97
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.97
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.97
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.97
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.97
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.97
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.97
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.97
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.97
KOG0578|consensus550 99.97
KOG1187|consensus361 99.97
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.97
KOG0662|consensus292 99.97
KOG1095|consensus1025 99.97
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.97
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.97
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.97
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.97
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.97
KOG0582|consensus516 99.97
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.97
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.97
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.97
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.97
KOG4257|consensus 974 99.97
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.97
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.97
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.97
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.97
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.97
KOG0660|consensus359 99.97
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.97
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.97
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.97
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.97
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.97
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.97
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 99.97
PLN00009294 cyclin-dependent kinase A; Provisional 99.97
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.97
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.97
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.97
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.97
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.97
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.97
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.97
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.97
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.97
PHA02882294 putative serine/threonine kinase; Provisional 99.97
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.97
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.97
KOG0659|consensus318 99.97
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.97
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.97
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.97
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.97
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.97
KOG0983|consensus391 99.97
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.97
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.97
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.97
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.97
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.96
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.96
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.96
PTZ00263329 protein kinase A catalytic subunit; Provisional 99.96
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.96
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.96
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.96
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.96
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.96
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.96
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.96
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.96
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.96
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.96
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.96
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.96
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.96
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.96
KOG0986|consensus591 99.96
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.96
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.96
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.96
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.96
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.96
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.96
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.96
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.96
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.96
KOG0594|consensus323 99.96
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.96
KOG0196|consensus996 99.96
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.96
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.96
KOG0197|consensus468 99.96
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.96
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.96
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.96
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.96
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.96
KOG0696|consensus683 99.96
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.96
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.96
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.96
KOG0658|consensus364 99.96
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.96
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.96
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.96
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.96
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.96
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.96
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.96
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.96
KOG4645|consensus1509 99.96
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.96
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.96
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.96
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.96
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.96
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.96
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.96
KOG1035|consensus1351 99.96
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.96
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.96
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.96
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.96
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.96
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.96
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.96
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.96
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 99.96
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.96
KOG2345|consensus302 99.96
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.96
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.96
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.96
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.96
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.96
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.96
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.96
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.96
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.96
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.96
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.96
KOG0614|consensus732 99.96
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.96
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.96
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.96
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.96
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.96
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.96
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.96
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.96
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.96
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.96
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.96
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.96
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.96
KOG0669|consensus376 99.96
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.96
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.96
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 99.96
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.96
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.96
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.96
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.96
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.96
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.96
PTZ00036440 glycogen synthase kinase; Provisional 99.96
PHA03212391 serine/threonine kinase US3; Provisional 99.96
KOG0589|consensus426 99.96
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.96
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.96
KOG0590|consensus601 99.96
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.96
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 99.96
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.96
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.96
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.96
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.96
PHA02988283 hypothetical protein; Provisional 99.96
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.96
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.96
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.96
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.96
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.96
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.96
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.96
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.96
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.96
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.96
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.96
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.96
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.96
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.96
KOG0596|consensus677 99.96
KOG2052|consensus513 99.96
KOG1027|consensus903 99.96
KOG4279|consensus1226 99.96
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.96
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 99.96
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.96
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.96
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.96
KOG1027|consensus903 99.96
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.96
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.96
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.96
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.96
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.95
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.95
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.95
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.95
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.95
PTZ00267478 NIMA-related protein kinase; Provisional 99.95
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.95
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.95
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.95
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.95
KOG4250|consensus 732 99.95
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.95
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.95
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.95
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 99.95
KOG0201|consensus467 99.95
KOG0608|consensus1034 99.95
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.95
KOG0606|consensus1205 99.95
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 99.95
KOG1989|consensus738 99.95
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.95
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.95
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 99.95
PHA03207392 serine/threonine kinase US3; Provisional 99.95
KOG0579|consensus 1187 99.95
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.95
KOG4236|consensus888 99.95
KOG4645|consensus1509 99.95
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.95
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.95
KOG0587|consensus 953 99.95
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.95
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.95
PHA03209357 serine/threonine kinase US3; Provisional 99.95
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.95
KOG0586|consensus596 99.95
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.95
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.95
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.95
>KOG0603|consensus Back     alignment and domain information
Probab=100.00  E-value=1.2e-81  Score=760.91  Aligned_cols=458  Identities=22%  Similarity=0.320  Sum_probs=363.1

Q ss_pred             ccccccceEEEeeecc-----chhHHHHHhhccccccchHHHHhhhccccccccccccchhhhhhhccccCCCCCcEEEe
Q psy3778         559 FIAKGTNAVVYEATFR-----GVEYALKMMFNYSAASNSHAILKAMSKELLPLRKPLRLNEDMLMNSVENLPPHPNVVVM  633 (1751)
Q Consensus       559 vlg~g~~gkVflvrk~-----~~~yamkvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~pf~v~l  633 (1751)
                      |||+|||||||||||+     |++|||||+                +|+|+++|+++  |+++||++|+++++|||+|+|
T Consensus         1 vlg~g~~gkvfLvrk~~g~da~~~yamkvl----------------~k~t~~~~~~~--~t~~er~il~~~~~~~f~v~l   62 (612)
T KOG0603|consen    1 VLGQGSYGKVFLVRKAGGADAGHLYAMKVL----------------KKATLKVRDRT--HTKQERIILAFVHNTPFLVKL   62 (612)
T ss_pred             CCCcCCCcchHHHHHhccccccchhhhhcc----------------ccccccccccc--ccccHHHHHhhccCCCceeee
Confidence            7999999999999999     999999999                58999999855  899999999999999999999


Q ss_pred             eeecc---------ccCCCC-------------------------------CCCCccccCC-------CCCCCeEeeccc
Q psy3778         634 HFAFT---------DFVPSI-------------------------------PDSSLIYPKD-------NTCPQLVITDFG  666 (1751)
Q Consensus       634 ~yafq---------d~~~g~-------------------------------~~~~iiyrd~-------~~~ghi~ltdfg  666 (1751)
                      |||||         ||++|+                               |++||||||+       +.+|||++||||
T Consensus        63 hyafqt~~kl~l~ld~~rgg~lft~l~~~~~f~~~~~~~~~aelaLald~lh~l~iiyrd~k~enilld~~Ghi~~tdfg  142 (612)
T KOG0603|consen   63 HYAFQTDGKLYLILDFLRGGDLFTRLSKEVMFDELDVAFYLAELALALDHLHKLGIAYRDYKLENVLLLLEGHIKLTDFG  142 (612)
T ss_pred             eeeeccccchhHhhhhcccchhhhccccCCchHHHHHHHHHHHHHHHHhhcchhHHHHhcccccceeecccCccccCCch
Confidence            99999         999992                               7999999999       489999999999


Q ss_pred             ccccccCcccccccccccccccccccccceeeccCCCCcccccCCccchhhhhhhHhhhccCCCCCcccccccccc--cc
Q psy3778         667 SSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYE--VN  744 (1751)
Q Consensus       667 lske~~~~~~~~~~~~~~s~cgtieymAPEvv~~~~~~~~~~~~~~~DwWSlGvlmyEmltG~~PF~~~~~~~~~~--~~  744 (1751)
                      +||++++++.      +   |||+|||||||+|   ||     .+++||||||||||||+||.+||++    +++.  .+
T Consensus       143 lske~v~~~~------~---cgt~eymApEI~~---gh-----~~a~D~ws~gvl~felltg~~pf~~----~~~~~Il~  201 (612)
T KOG0603|consen  143 LSKEAVKEKI------A---CGTYEYRAPEIIN---GH-----LSAADWWSFGVLAFELLTGTLPFGG----DTMKRILK  201 (612)
T ss_pred             hhhHhHhhhh------c---ccchhhhhhHhhh---cc-----CCcccchhhhhhHHHHhhCCCCCch----HHHHHHhh
Confidence            9999986432      1   9999999999997   56     5589999999999999999999987    3333  36


Q ss_pred             ccCCCCCCCCHHHHHHHHHHhccCCCCCCChh--HHHHHHhhhccCCcCcC--CCC--C----C---Ccccchhhee--e
Q psy3778         745 ALPQLNTNVPEVMRRLVAKLLENDPSDRPSAE--LAATVCQLYLWAPKHWL--YGA--T----P---SHNEIMQWLL--T  809 (1751)
Q Consensus       745 ~~p~~p~~ls~~a~~Ll~~l~~~dP~~Rlg~~--g~~ei~~~~~~~~~~~~--y~~--~----p---~~~~~~~~~~--~  809 (1751)
                      +.+++|+.++.+|++++++++++||.||||++  ++++|++|.|+..++|+  +..  +    |   ...+.++|..  +
T Consensus       202 ~~~~~p~~l~~~a~~~~~~l~~r~p~nrLg~~~~~~~eik~h~f~~~i~~~~l~~r~~~~~fkp~~~~e~~~~~fd~eft  281 (612)
T KOG0603|consen  202 AELEMPRELSAEARSLFRQLFKRNPENRLGAGPDGVDEIKQHEFFQSIDWNELEARSRPPPFKPGSITERDVAQFDPEFT  281 (612)
T ss_pred             hccCCchhhhHHHHHHHHHHHhhCHHHHhccCcchhHHHhccchheeeeHhhHhhcCCCCCCCCcccchhhhhhcCchhc
Confidence            79999999999999999999999999999994  99999999999999996  331  1    1   1223444433  3


Q ss_pred             ecc-------------eeccccccccee-------eeeeeEEeehhhhhhhhhhhHH----------hHHHHHHHHHHHH
Q psy3778         810 LTT-------------KVLCTGVSYGGH-------VRRTFVEYQLISTFLKRAEFRL----------ITNALQYIQRNED  859 (1751)
Q Consensus       810 ~~~-------------~~~~~G~s~~~~-------v~~~~~~y~l~~~~l~~~~~~~----------~~~avk~i~~~e~  859 (1751)
                      ..+             +.+++|++|.+.       ...+...|++... ++.+.++.          ...++|+|.+...
T Consensus       282 ~~~P~dsp~~~~~~s~~~if~g~sfva~~il~~~~~~~~~~~y~~~~~-~~~gs~s~~~~~~~~~t~~~~~vkii~~~~~  360 (612)
T KOG0603|consen  282 SQVPADSPLLSASGSDHTIFSGPSFVAPGVLEDAVTAPFTESYEFREE-LGEGSFSAVKYCESSPTDQEPAVKIISKRAD  360 (612)
T ss_pred             cCCcccCCCCCCCccccchhcCCCccChHHhhccccCCcchhhccccc-cCCCCccceeeeeccccccchhheecccccc
Confidence            221             356778777542       2346777777543 22222222          3468888876644


Q ss_pred             HHHHHH---hcCCCCCCceEEEEEEEeCCCCCCCCCcccCCCCccccCCCCCCCCccEEEEEeeccCC-CHHHHHHHhcC
Q psy3778         860 MLMNSV---ENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPSALPARLNPTGGYGRNMSLFILMKKYNT-DLRNYLRERCA  935 (1751)
Q Consensus       860 ~~~~el---~~L~~HPNIV~l~~vf~D~~~~~~~~~~iY~~alp~~l~~~GG~g~~~~LyiVME~~~g-dL~~~L~~~~~  935 (1751)
                      +..+++   ....+|||||+++++|.|.                            ..+|+|||.++| .|.+-++... 
T Consensus       361 ~~~~e~~~~~~~~~h~niv~~~~v~~~~----------------------------~~~~~v~e~l~g~ell~ri~~~~-  411 (612)
T KOG0603|consen  361 DNQDEIPISLLVRDHPNIVKSHDVYEDG----------------------------KEIYLVMELLDGGELLRRIRSKP-  411 (612)
T ss_pred             ccccccchhhhhcCCCcceeecceecCC----------------------------ceeeeeehhccccHHHHHHHhcc-
Confidence            444443   2345899999999999762                            358999999864 4444444432 


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHhCCCeeccCCCCCEEeccCCCCCCCcEEEeecccccccCCCCcccccccccccccccc
Q psy3778         936 QLSMHERILLFTQLLEGVTHLNMHRTAHRDLKSDNILLDCSEDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVA 1015 (1751)
Q Consensus       936 ~Lse~ea~~i~~QIl~gL~yLHs~gIIHRDLKPeNILLd~~~~~~~~~VKLsDFGlAk~~~~~~~~~~ss~~~~~~GT~~ 1015 (1751)
                      .++ .++..|++||+.|+.|||++|||||||||+|||++.+    .++++|+|||+++.....        ..+.|=|..
T Consensus       412 ~~~-~e~~~w~~~lv~Av~~LH~~gvvhRDLkp~NIL~~~~----~g~lrltyFG~a~~~~~~--------~~tp~~t~~  478 (612)
T KOG0603|consen  412 EFC-SEASQWAAELVSAVDYLHEQGVVHRDLKPGNILLDGS----AGHLRLTYFGFWSELERS--------CDTPALTLQ  478 (612)
T ss_pred             hhH-HHHHHHHHHHHHHHHHHHhcCeeecCCChhheeecCC----CCcEEEEEechhhhCchh--------hcccchhhc
Confidence            233 8888999999999999999999999999999999611    237999999999875543        113456889


Q ss_pred             cccchhcccCCCccccccCCCCcccchhHHHHHHhcCCCCCcccccc-ccccccccCCCCCCccHHHHHHHHHhcccCCC
Q psy3778        1016 LMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARN-TDYEVNALPQLNTNVPEVMRRLVAKLLENDPS 1094 (1751)
Q Consensus      1016 YmAPEvl~~~~~~~s~~~y~ksDVWSlGVILYEmLtG~~PF~~~~~~-~~~~~~~~p~lp~~vp~~~kdLI~k~L~~DP~ 1094 (1751)
                      |.|||++...+      +..+|||||||++||+||+|..||...... ........++....+|+++++||++||+.||.
T Consensus       479 y~APEvl~~~~------yt~acD~WSLGvlLy~ML~G~tp~~~~P~~~ei~~~i~~~~~s~~vS~~AKdLl~~LL~~dP~  552 (612)
T KOG0603|consen  479 YVAPEVLAIQE------YTEACDWWSLGVLLYEMLTGRTLFAAHPAGIEIHTRIQMPKFSECVSDEAKDLLQQLLQVDPA  552 (612)
T ss_pred             ccChhhhccCC------CCcchhhHHHHHHHHHHHhCCCccccCCchHHHHHhhcCCccccccCHHHHHHHHHhccCChh
Confidence            99999987543      234799999999999999999999865443 11222334455588999999999999999999


Q ss_pred             CCCCHHHHHH
Q psy3778        1095 DRPSAELAAT 1104 (1751)
Q Consensus      1095 kRPTA~ea~~ 1104 (1751)
                      +||+++++..
T Consensus       553 ~Rl~~~~i~~  562 (612)
T KOG0603|consen  553 LRLGADEIGA  562 (612)
T ss_pred             hCcChhhhcc
Confidence            9999999864



>KOG4158|consensus Back     alignment and domain information
>KOG4158|consensus Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>KOG0575|consensus Back     alignment and domain information
>KOG0595|consensus Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>KOG0588|consensus Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>KOG0663|consensus Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>KOG0600|consensus Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>KOG0695|consensus Back     alignment and domain information
>KOG0661|consensus Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>KOG0192|consensus Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>KOG0660|consensus Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>KOG0575|consensus Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>KOG0658|consensus Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>KOG4717|consensus Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>KOG0595|consensus Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information
>KOG0594|consensus Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>KOG0582|consensus Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>KOG0588|consensus Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG4721|consensus Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>KOG0192|consensus Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0608|consensus Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>KOG0193|consensus Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0667|consensus Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>KOG0607|consensus Back     alignment and domain information
>KOG0661|consensus Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>KOG1989|consensus Back     alignment and domain information
>KOG4717|consensus Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG4721|consensus Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>KOG0600|consensus Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>KOG0596|consensus Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>KOG0666|consensus Back     alignment and domain information
>KOG1026|consensus Back     alignment and domain information
>KOG0589|consensus Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>KOG0663|consensus Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>KOG0586|consensus Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>KOG0577|consensus Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>KOG0579|consensus Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>KOG0607|consensus Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>KOG0574|consensus Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>KOG1187|consensus Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0662|consensus Back     alignment and domain information
>KOG1095|consensus Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>KOG0582|consensus Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>KOG4257|consensus Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>KOG0660|consensus Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>KOG0983|consensus Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0594|consensus Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0658|consensus Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>KOG4645|consensus Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>KOG2345|consensus Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>KOG0669|consensus Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0589|consensus Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>KOG0596|consensus Back     alignment and domain information
>KOG2052|consensus Back     alignment and domain information
>KOG1027|consensus Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>KOG1027|consensus Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>KOG4250|consensus Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>KOG0608|consensus Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>KOG1989|consensus Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0579|consensus Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>KOG4645|consensus Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>KOG0587|consensus Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0586|consensus Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1751
2y7j_A365 Structure Of Human Phosphorylase Kinase, Gamma 2 Le 8e-12
2y7j_A365 Structure Of Human Phosphorylase Kinase, Gamma 2 Le 5e-09
2jam_A304 Crystal Structure Of Human Calmodulin-Dependent Pro 4e-11
2jam_A304 Crystal Structure Of Human Calmodulin-Dependent Pro 7e-09
2wei_A287 Crystal Structure Of The Kinase Domain Of Cryptospo 9e-11
2wei_A287 Crystal Structure Of The Kinase Domain Of Cryptospo 1e-08
3dfa_A286 Crystal Structure Of Kinase Domain Of Calcium-depen 9e-11
3dfa_A286 Crystal Structure Of Kinase Domain Of Calcium-depen 1e-08
3og7_A289 B-Raf Kinase V600e Oncogenic Mutant In Complex With 2e-10
3og7_A289 B-Raf Kinase V600e Oncogenic Mutant In Complex With 5e-07
4fk3_A292 B-Raf Kinase V600e Oncogenic Mutant In Complex With 2e-10
4fk3_A292 B-Raf Kinase V600e Oncogenic Mutant In Complex With 6e-07
3igo_A486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 2e-10
3igo_A486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 2e-08
3c4c_A280 B-Raf Kinase In Complex With Plx4720 Length = 280 3e-10
3c4c_A280 B-Raf Kinase In Complex With Plx4720 Length = 280 7e-07
3udb_A317 Crystal Structure Of Snrk2.6 Length = 317 3e-09
3udb_A317 Crystal Structure Of Snrk2.6 Length = 317 7e-08
3lm0_A327 Crystal Structure Of Human SerineTHREONINE KINASE 1 4e-09
3lm0_A327 Crystal Structure Of Human SerineTHREONINE KINASE 1 3e-06
1uwj_A276 The Complex Of Mutant V599e B-raf And Bay439006 Len 5e-09
1uwj_A276 The Complex Of Mutant V599e B-raf And Bay439006 Len 8e-06
3idp_A300 B-Raf V600e Kinase Domain In Complex With An Aminoi 6e-09
3idp_A300 B-Raf V600e Kinase Domain In Complex With An Aminoi 9e-06
3uc3_A361 The Crystal Structure Of Snf1-Related Kinase 2.3 Le 6e-09
3uc3_A361 The Crystal Structure Of Snf1-Related Kinase 2.3 Le 1e-07
3q96_A282 B-Raf Kinase Domain In Complex With A Tetrahydronap 6e-09
3q96_A282 B-Raf Kinase Domain In Complex With A Tetrahydronap 1e-05
4g9r_A307 B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr 7e-09
4g9r_A307 B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr 1e-05
1uwh_A276 The Complex Of Wild Type B-Raf And Bay439006 Length 7e-09
1uwh_A276 The Complex Of Wild Type B-Raf And Bay439006 Length 1e-05
4h58_A275 Braf In Complex With Compound 3 Length = 275 7e-09
4h58_A275 Braf In Complex With Compound 3 Length = 275 1e-05
2fb8_A281 Structure Of The B-Raf Kinase Domain Bound To Sb-59 8e-09
2fb8_A281 Structure Of The B-Raf Kinase Domain Bound To Sb-59 1e-05
4dbn_A284 Crystal Structure Of The Kinase Domain Of Human B-R 8e-09
4dbn_A284 Crystal Structure Of The Kinase Domain Of Human B-R 1e-05
3ii5_A306 The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi 1e-08
3ii5_A306 The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi 1e-05
3d4q_A307 Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 1e-08
3d4q_A307 Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 1e-05
3bhy_A283 Crystal Structure Of Human Death Associated Protein 1e-08
3bhy_A283 Crystal Structure Of Human Death Associated Protein 2e-06
1yrp_A278 Catalytic Domain Of Human Zip Kinase Phosphorylated 1e-08
1yrp_A278 Catalytic Domain Of Human Zip Kinase Phosphorylated 2e-06
2jc6_A334 Crystal Structure Of Human Calmodulin-Dependent Pro 2e-08
2jc6_A334 Crystal Structure Of Human Calmodulin-Dependent Pro 2e-06
3ujg_A361 Crystal Structure Of Snrk2.6 In Complex With Hab1 L 3e-08
3ujg_A361 Crystal Structure Of Snrk2.6 In Complex With Hab1 L 8e-07
3uc4_A362 The Crystal Structure Of Snf1-Related Kinase 2.6 Le 3e-08
3uc4_A362 The Crystal Structure Of Snf1-Related Kinase 2.6 Le 8e-07
3vw6_A269 Crystal Structure Of Human Apoptosis Signal-Regulat 3e-08
3vw6_A269 Crystal Structure Of Human Apoptosis Signal-Regulat 2e-06
3omv_A307 Crystal Structure Of C-Raf (Raf-1) Length = 307 3e-08
3omv_A307 Crystal Structure Of C-Raf (Raf-1) Length = 307 6e-06
2clq_A295 Structure Of Mitogen-Activated Protein Kinase Kinas 4e-08
2clq_A295 Structure Of Mitogen-Activated Protein Kinase Kinas 2e-06
3dxn_A287 Crystal Structure Of The Calcium-dependent Kinase F 5e-08
3dxn_A287 Crystal Structure Of The Calcium-dependent Kinase F 2e-05
2r5t_A373 Crystal Structure Of Inactive Serum And Glucocortic 5e-08
2r5t_A373 Crystal Structure Of Inactive Serum And Glucocortic 6e-05
2j0l_A276 Crystal Structure Of A The Active Conformation Of T 7e-08
2j0l_A276 Crystal Structure Of A The Active Conformation Of T 1e-05
2phk_A277 The Crystal Structure Of A Phosphorylase Kinase Pep 8e-08
2phk_A277 The Crystal Structure Of A Phosphorylase Kinase Pep 1e-07
2j90_A304 Crystal Structure Of Human Zip Kinase In Complex Wi 8e-08
2j90_A304 Crystal Structure Of Human Zip Kinase In Complex Wi 7e-06
1phk_A298 Two Structures Of The Catalytic Domain Of Phosphory 1e-07
1phk_A298 Two Structures Of The Catalytic Domain Of Phosphory 1e-07
4ebw_A304 Structure Of Focal Adhesion Kinase Catalytic Domain 1e-07
4ebw_A304 Structure Of Focal Adhesion Kinase Catalytic Domain 2e-05
1mp8_A281 Crystal Structure Of Focal Adhesion Kinase (Fak) Le 1e-07
1mp8_A281 Crystal Structure Of Focal Adhesion Kinase (Fak) Le 2e-05
2j0m_B276 Crystal Structure A Two-Chain Complex Between The F 1e-07
2j0m_B276 Crystal Structure A Two-Chain Complex Between The F 2e-05
2jkm_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 1e-07
2jkm_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 2e-05
3hzt_A467 Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 1e-07
3hzt_A467 Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 8e-05
3dak_A290 Crystal Structure Of Domain-Swapped Osr1 Kinase Dom 1e-07
3dak_A290 Crystal Structure Of Domain-Swapped Osr1 Kinase Dom 2e-05
3pxk_A282 Focal Adhesion Kinase Catalytic Domain In Complex W 1e-07
3pxk_A282 Focal Adhesion Kinase Catalytic Domain In Complex W 3e-05
3bz3_A276 Crystal Structure Analysis Of Focal Adhesion Kinase 1e-07
3bz3_A276 Crystal Structure Analysis Of Focal Adhesion Kinase 3e-05
2etm_A281 Crystal Structure Of Focal Adhesion Kinase Domain C 2e-07
2etm_A281 Crystal Structure Of Focal Adhesion Kinase Domain C 3e-05
4apc_A350 Crystal Structure Of Human Nima-Related Kinase 1 (N 2e-07
2vwi_A303 Structure Of The Osr1 Kinase, A Hypertension Drug T 2e-07
2vwi_A303 Structure Of The Osr1 Kinase, A Hypertension Drug T 3e-05
4fg9_A320 Crystal Structure Of Human Calcium/calmodulin-depen 2e-07
4fg9_A320 Crystal Structure Of Human Calcium/calmodulin-depen 2e-05
4fg8_A315 Crystal Structure Of Human Calcium/calmodulin-depen 2e-07
4fg8_A315 Crystal Structure Of Human Calcium/calmodulin-depen 2e-05
4fg7_A293 Crystal Structure Of Human Calcium/calmodulin-depen 2e-07
4fg7_A293 Crystal Structure Of Human Calcium/calmodulin-depen 2e-05
3nyn_A576 Crystal Structure Of G Protein-Coupled Receptor Kin 2e-07
3nyn_A576 Crystal Structure Of G Protein-Coupled Receptor Kin 1e-04
2vd5_A412 Structure Of Human Myotonic Dystrophy Protein Kinas 2e-07
2vd5_A412 Structure Of Human Myotonic Dystrophy Protein Kinas 2e-04
1a06_A332 Calmodulin-Dependent Protein Kinase From Rat Length 2e-07
1a06_A332 Calmodulin-Dependent Protein Kinase From Rat Length 5e-05
2acx_A576 Crystal Structure Of G Protein Coupled Receptor Kin 3e-07
2acx_A576 Crystal Structure Of G Protein Coupled Receptor Kin 1e-04
2jkk_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 3e-07
2jkk_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 5e-05
3zut_A362 The Structure Of Ost1 (D160a) Kinase Length = 362 3e-07
3zut_A362 The Structure Of Ost1 (D160a) Kinase Length = 362 8e-06
3i6w_A443 Structure And Activation Mechanism Of The Chk2 Dna- 3e-07
3i6w_A443 Structure And Activation Mechanism Of The Chk2 Dna- 3e-04
2cn5_A329 Crystal Structure Of Human Chk2 In Complex With Adp 3e-07
2cn5_A329 Crystal Structure Of Human Chk2 In Complex With Adp 3e-04
2ycf_A322 Crystal Structure Of Checkpoint Kinase 2 In Complex 3e-07
2ycf_A322 Crystal Structure Of Checkpoint Kinase 2 In Complex 3e-04
2yhv_A342 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 3e-07
2yhv_A342 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 3e-05
2yfx_A327 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 3e-07
2yfx_A327 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 3e-05
3lij_A494 Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) 3e-07
3lij_A494 Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) 1e-05
3i6u_A419 Structure And Activation Mechanism Of The Chk2 Dna- 3e-07
3i6u_A419 Structure And Activation Mechanism Of The Chk2 Dna- 3e-04
2w0j_A323 Crystal Structure Of Chk2 In Complex With Nsc 10955 3e-07
2w0j_A323 Crystal Structure Of Chk2 In Complex With Nsc 10955 3e-04
2ycr_A323 Crystal Structure Of Checkpoint Kinase 2 In Complex 4e-07
2ycr_A323 Crystal Structure Of Checkpoint Kinase 2 In Complex 3e-04
3mfr_A351 Cask-4m Cam Kinase Domain, Native Length = 351 4e-07
3mfr_A351 Cask-4m Cam Kinase Domain, Native Length = 351 1e-04
2xk9_A322 Structural Analysis Of Checkpoint Kinase 2 (Chk2) I 4e-07
2xk9_A322 Structural Analysis Of Checkpoint Kinase 2 (Chk2) I 4e-04
2j0j_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 4e-07
2j0j_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 5e-05
1ql6_A298 The Catalytic Mechanism Of Phosphorylase Kinase Pro 4e-07
1ql6_A298 The Catalytic Mechanism Of Phosphorylase Kinase Pro 5e-07
2xru_A280 Aurora-A T288e Complexed With Pha-828300 Length = 2 5e-07
2yjs_A342 Structure Of C1156y Mutant Anaplastic Lymphoma Kina 7e-07
2yjs_A342 Structure Of C1156y Mutant Anaplastic Lymphoma Kina 6e-05
2xb7_A315 Structure Of Human Anaplastic Lymphoma Kinase In Co 7e-07
2xb7_A315 Structure Of Human Anaplastic Lymphoma Kinase In Co 7e-05
3zuu_A362 The Structure Of Ost1 (D160a, S175d) Kinase In Comp 8e-07
3zuu_A362 The Structure Of Ost1 (D160a, S175d) Kinase In Comp 2e-05
2j0k_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 9e-07
2j0k_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 1e-04
2xp2_A327 Structure Of The Human Anaplastic Lymphoma Kinase I 9e-07
2xp2_A327 Structure Of The Human Anaplastic Lymphoma Kinase I 7e-05
4fnx_A327 Crystal Structure Of The Apo R1275q Anaplastic Lymp 9e-07
4fnx_A327 Crystal Structure Of The Apo R1275q Anaplastic Lymp 8e-05
2yjr_A342 Structure Of F1174l Mutant Anaplastic Lymphoma Kina 1e-06
2yjr_A342 Structure Of F1174l Mutant Anaplastic Lymphoma Kina 8e-05
4fnz_A327 Crystal Structure Of Human Anaplastic Lymphoma Kina 1e-06
4fnz_A327 Crystal Structure Of Human Anaplastic Lymphoma Kina 9e-05
4fnw_A327 Crystal Structure Of The Apo F1174l Anaplastic Lymp 1e-06
4fnw_A327 Crystal Structure Of The Apo F1174l Anaplastic Lymp 8e-05
3aox_A344 X-Ray Crystal Structure Of Human Anaplastic Lymphom 1e-06
3aox_A344 X-Ray Crystal Structure Of Human Anaplastic Lymphom 9e-05
4dce_A333 Crystal Structure Of Human Anaplastic Lymphoma Kina 1e-06
4dce_A333 Crystal Structure Of Human Anaplastic Lymphoma Kina 9e-05
1wmk_A321 Human Death-Associated Kinase Drp-1, Mutant S308d D 1e-06
1wmk_A321 Human Death-Associated Kinase Drp-1, Mutant S308d D 3e-06
2v7o_A336 Crystal Structure Of Human Calcium-Calmodulin-Depen 1e-06
2v7o_A336 Crystal Structure Of Human Calcium-Calmodulin-Depen 6e-04
4fob_A353 Crystal Structure Of Human Anaplastic Lymphoma Kina 1e-06
4fob_A353 Crystal Structure Of Human Anaplastic Lymphoma Kina 1e-04
2a27_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 1e-06
2a27_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 3e-06
3fdn_A279 Structure-Based Drug Design Of Novel Aurora Kinase 1e-06
2c6d_A275 Aurora A Kinase Activated Mutant (T287d) In Complex 1e-06
2c6e_A283 Aurora A Kinase Activated Mutant (T287d) In Complex 1e-06
3lau_A287 Crystal Structure Of Aurora2 Kinase In Complex With 1e-06
2eva_A307 Structural Basis For The Interaction Of Tak1 Kinase 2e-06
4gs6_A315 Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxoz 2e-06
1zws_A288 Crystal Structure Of The Catalytic Domain Of Human 2e-06
1zws_A288 Crystal Structure Of The Catalytic Domain Of Human 2e-06
3r21_A271 Design, Synthesis, And Biological Evaluation Of Pyr 2e-06
2a2a_A321 High-resolution Crystallographic Analysis Of The Au 2e-06
2a2a_A321 High-resolution Crystallographic Analysis Of The Au 3e-06
2ya9_A361 Crystal Structure Of The Autoinhibited Form Of Mous 2e-06
2ya9_A361 Crystal Structure Of The Autoinhibited Form Of Mous 3e-06
3e5a_A268 Crystal Structure Of Aurora A In Complex With Vx-68 2e-06
1z9x_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 2e-06
1z9x_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 3e-06
3qbn_A281 Structure Of Human Aurora A In Complex With A Diami 2e-06
2g01_A370 Pyrazoloquinolones As Novel, Selective Jnk1 Inhibit 2e-06
2g01_A370 Pyrazoloquinolones As Novel, Selective Jnk1 Inhibit 6e-04
2w1c_A275 Structure Determination Of Aurora Kinase In Complex 2e-06
3l9p_A367 Crystal Structure Of The Anaplastic Lymphoma Kinase 3e-06
3l9p_A367 Crystal Structure Of The Anaplastic Lymphoma Kinase 2e-04
3ha6_A268 Crystal Structure Of Aurora A In Complex With Tpx2 3e-06
3lct_A344 Crystal Structure Of The Anaplastic Lymphoma Kinase 3e-06
3lct_A344 Crystal Structure Of The Anaplastic Lymphoma Kinase 2e-04
3h0y_A268 Aurora A In Complex With A Bisanilinopyrimidine Len 3e-06
1mq4_A272 Crystal Structure Of Aurora-A Protein Kinase Length 3e-06
3o50_A267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 3e-06
2wqe_A262 Structure Of S155r Aurora-A Somatic Mutant Length = 3e-06
2xuu_A334 Crystal Structure Of A Dap-Kinase 1 Mutant Length = 3e-06
2xuu_A334 Crystal Structure Of A Dap-Kinase 1 Mutant Length = 4e-05
1ol5_A282 Structure Of Aurora-A 122-403, Phosphorylated On Th 3e-06
2w1d_A275 Structure Determination Of Aurora Kinase In Complex 3e-06
2j50_A280 Structure Of Aurora-2 In Complex With Pha-739358 Le 3e-06
2wtv_A285 Aurora-A Inhibitor Structure Length = 285 3e-06
2x6d_A285 Aurora-A Bound To An Inhibitor Length = 285 3e-06
3nrm_A283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 3e-06
2xng_A283 Structure Of Aurora-A Bound To A Selective Imidazop 3e-06
2wtw_A285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 3e-06
3gu8_A295 Crystal Structure Of Dapkl93g With N6-Cyclopentylad 4e-06
3gu8_A295 Crystal Structure Of Dapkl93g With N6-Cyclopentylad 6e-05
2bmc_A306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 4e-06
3ma6_A298 Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr 4e-06
3ma6_A298 Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr 9e-05
3dls_A335 Crystal Structure Of Human Pas Kinase Bound To Adp 4e-06
3dls_A335 Crystal Structure Of Human Pas Kinase Bound To Adp 4e-05
2j4z_A306 Structure Of Aurora-2 In Complex With Pha-680626 Le 5e-06
3gu4_A295 Crystal Structure Of Dapkq23v-Amppnp Length = 295 5e-06
3gu4_A295 Crystal Structure Of Dapkq23v-Amppnp Length = 295 9e-05
3cok_A278 Crystal Structure Of Plk4 Kinase Length = 278 5e-06
3cok_A278 Crystal Structure Of Plk4 Kinase Length = 278 7e-04
1p4f_A293 Death Associated Protein Kinase Catalytic Domain Wi 5e-06
1p4f_A293 Death Associated Protein Kinase Catalytic Domain Wi 8e-05
1wvw_A278 Crystal Structures Of Kinase Domain Of Dap Kinase I 5e-06
1wvw_A278 Crystal Structures Of Kinase Domain Of Dap Kinase I 9e-05
3miy_A266 X-Ray Crystal Structure Of Itk Complexed With Sunit 5e-06
3miy_A266 X-Ray Crystal Structure Of Itk Complexed With Sunit 2e-05
1muo_A297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 5e-06
2w4j_A277 X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 5e-06
2w4j_A277 X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 9e-05
1ig1_A294 1.8a X-Ray Structure Of Ternary Complex Of A Cataly 5e-06
1ig1_A294 1.8a X-Ray Structure Of Ternary Complex Of A Cataly 9e-05
3unz_A279 Aurora A In Complex With Rpm1679 Length = 279 5e-06
3dfc_B295 Crystal Structure Of A Glycine-Rich Loop Mutant Of 5e-06
3dfc_B295 Crystal Structure Of A Glycine-Rich Loop Mutant Of 9e-05
3v3v_A379 Structural And Functional Analysis Of Quercetagetin 5e-06
3f5u_A295 Crystal Structure Of The Death Associated Protein K 6e-06
3f5u_A295 Crystal Structure Of The Death Associated Protein K 9e-05
3mtl_A324 Crystal Structure Of The Pctaire1 Kinase In Complex 6e-06
2w4k_A302 X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 7e-06
2w4k_A302 X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 1e-04
2yak_A285 Structure Of Death-Associated Protein Kinase 1 (Dap 7e-06
2yak_A285 Structure Of Death-Associated Protein Kinase 1 (Dap 1e-04
2vn9_A301 Crystal Structure Of Human Calcium Calmodulin Depen 7e-06
2gcd_A309 Tao2 Kinase Domain-Staurosporine Structure Length = 7e-06
1u5q_A348 Crystal Structure Of The Tao2 Kinase Domain: Activa 7e-06
2xzs_A312 Death Associated Protein Kinase 1 Residues 1-312 Le 7e-06
2xzs_A312 Death Associated Protein Kinase 1 Residues 1-312 Le 1e-04
3v5j_A266 Crystal Structure Of Interleukin-2 Inducible T-Cell 7e-06
3v5j_A266 Crystal Structure Of Interleukin-2 Inducible T-Cell 3e-05
1sm2_A264 Crystal Structure Of The Phosphorylated Interleukin 7e-06
1sm2_A264 Crystal Structure Of The Phosphorylated Interleukin 3e-05
1luf_A343 Crystal Structure Of The Musk Tyrosine Kinase: Insi 8e-06
1luf_A343 Crystal Structure Of The Musk Tyrosine Kinase: Insi 5e-04
3qgw_A286 Crystal Structure Of Itk Kinase Bound To An Inhibit 8e-06
3qgw_A286 Crystal Structure Of Itk Kinase Bound To An Inhibit 3e-05
4hct_A269 Crystal Structure Of Itk In Complex With Compound 5 8e-06
4hct_A269 Crystal Structure Of Itk In Complex With Compound 5 2e-05
3coh_A268 Crystal Structure Of Aurora-A In Complex With A Pen 9e-06
2y0a_A326 Structure Of Dapk1 Construct Residues 1-304 Length 9e-06
2y0a_A326 Structure Of Dapk1 Construct Residues 1-304 Length 1e-04
2dwb_A285 Aurora-A Kinase Complexed With Amppnp Length = 285 9e-06
3t9t_A267 Crystal Structure Of Btk Mutant (F435t,K596r) Compl 1e-05
3t9t_A267 Crystal Structure Of Btk Mutant (F435t,K596r) Compl 3e-05
2x0g_A334 X-ray Structure Of A Dap-kinase Calmodulin Complex 1e-05
2x0g_A334 X-ray Structure Of A Dap-kinase Calmodulin Complex 2e-04
1fot_A318 Structure Of The Unliganded Camp-Dependent Protein 1e-05
3o17_A370 Crystal Structure Of Jnk1-Alpha1 Isoform Length = 3 1e-05
3o17_A370 Crystal Structure Of Jnk1-Alpha1 Isoform Length = 3 6e-04
2wel_A327 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 1e-05
2xne_A272 Structure Of Aurora-A Bound To An Imidazopyrazine I 1e-05
3dtc_A271 Crystal Structure Of Mixed-Lineage Kinase Mlk1 Comp 1e-05
1ol6_A282 Structure Of Unphosphorylated D274n Mutant Of Auror 1e-05
3hng_A360 Crystal Structure Of Vegfr1 In Complex With N-(4-ch 1e-05
3hng_A360 Crystal Structure Of Vegfr1 In Complex With N-(4-ch 2e-04
2jed_A352 The Crystal Structure Of The Kinase Domain Of The P 2e-05
4h36_A356 Crystal Structure Of Jnk3 In Complex With Atf2 Pept 2e-05
2xs0_A386 Linear Binding Motifs For Jnk And For Calcineurin A 2e-05
2b1p_A355 Inhibitor Complex Of Jnk3 Length = 355 2e-05
3ptg_A363 Design And Synthesis Of A Novel, Orally Efficacious 2e-05
2exc_X356 Inhibitor Complex Of Jnk3 Length = 356 2e-05
3elj_A369 Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine 2e-05
2ok1_A365 Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3 2e-05
1pmn_A364 Crystal Structure Of Jnk3 In Complex With An Imidaz 2e-05
3oxi_A362 Design And Synthesis Of Disubstituted Thiophene And 2e-05
2o0u_A364 Crystal Structure Of Human Jnk3 Complexed With N-{3 2e-05
3pze_A358 Jnk1 In Complex With Inhibitor Length = 358 2e-05
1jnk_A423 The C-Jun N-Terminal Kinase (Jnk3s) Complexed With 2e-05
2x4f_A373 The Crystal Structure Of The Human Myosin Light Cha 2e-05
2x4f_A373 The Crystal Structure Of The Human Myosin Light Cha 3e-05
1vzo_A355 The Structure Of The N-Terminal Kinase Domain Of Ms 2e-05
3sxr_A268 Crystal Structure Of Bmx Non-Receptor Tyrosine Kina 2e-05
3sxr_A268 Crystal Structure Of Bmx Non-Receptor Tyrosine Kina 2e-05
3i79_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 2e-05
3i79_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 3e-04
4f1o_A287 Crystal Structure Of The L1180t Mutant Roco4 Kinase 2e-05
3ttj_A464 Crystal Structure Of Jnk3 Complexed With Cc-359, A 2e-05
2wqm_A310 Structure Of Apo Human Nek7 Length = 310 2e-05
3p23_A432 Crystal Structure Of The Human Kinase And Rnase Dom 2e-05
3i7c_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 3e-05
3i7c_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 4e-04
3tac_A361 Crystal Structure Of The Liprin-AlphaCASK COMPLEX L 3e-05
1jpa_A312 Crystal Structure Of Unphosphorylated Ephb2 Recepto 3e-05
4f0f_A287 Crystal Structure Of The Roco4 Kinase Domain Bound 3e-05
3ku2_A507 Crystal Structure Of Inactivated Form Of Cdpk1 From 3e-05
3ku2_A507 Crystal Structure Of Inactivated Form Of Cdpk1 From 5e-04
2bil_B313 The Human Protein Kinase Pim1 In Complex With Its C 3e-05
2biy_A310 Structure Of Pdk1-S241a Mutant Kinase Domain Length 3e-05
3hx4_A508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 3e-05
3hx4_A508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 5e-04
3c0g_A351 Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Len 4e-05
3jpv_A313 Crystal Structure Of Human Proto-Oncogene Serine Th 4e-05
2xrw_A371 Linear Binding Motifs For Jnk And For Calcineurin A 4e-05
3cxw_A314 Crystal Structure Of Human Proto-Oncogene Serine Th 4e-05
2j2i_B312 Crystal Structure Of The Humab Pim1 In Complex With 4e-05
1ukh_A369 Structural Basis For The Selective Inhibition Of Jn 4e-05
4alv_A328 Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 4e-05
2r9s_A356 C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Qu 4e-05
3uto_A573 Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- 4e-05
3uto_A573 Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- 5e-04
3qc9_A543 Crystal Structure Of Cross-Linked Bovine Grk1 T8cN4 4e-05
3qc9_A543 Crystal Structure Of Cross-Linked Bovine Grk1 T8cN4 5e-04
3kvx_A364 Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Le 4e-05
4aw5_A291 Complex Of The Ephb4 Kinase Domain With An Oxindole 4e-05
4aw5_A291 Complex Of The Ephb4 Kinase Domain With An Oxindole 4e-04
2zv2_A298 Crystal Structure Of Human CalciumCALMODULIN-Depend 4e-05
2zv2_A298 Crystal Structure Of Human CalciumCALMODULIN-Depend 7e-04
1xws_A313 Crystal Structure Of The Human Pim1 Kinase Domain L 4e-05
3c4x_A543 Crystal Structure Of G Protein Coupled Receptor Kin 5e-05
3c4x_A543 Crystal Structure Of G Protein Coupled Receptor Kin 5e-04
3c4w_A543 Crystal Structure Of G Protein Coupled Receptor Kin 5e-05
3c4w_A543 Crystal Structure Of G Protein Coupled Receptor Kin 5e-04
3nus_A286 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fra 5e-05
3nax_A311 Pdk1 In Complex With Inhibitor Mp7 Length = 311 5e-05
2y94_A476 Structure Of An Active Form Of Mammalian Ampk Lengt 5e-05
2y94_A476 Structure Of An Active Form Of Mammalian Ampk Lengt 5e-05
3fi3_A364 Crystal Structure Of Jnk3 With Indazole Inhibitor, 5e-05
1z5m_A286 Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrr 5e-05
3nay_A311 Pdk1 In Complex With Inhibitor Mp6 Length = 311 5e-05
3t8o_A543 Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolu 5e-05
3t8o_A543 Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolu 5e-04
1h1w_A289 High Resolution Crystal Structure Of The Human Pdk1 5e-05
1uu9_A286 Structure Of Human Pdk1 Kinase Domain In Complex Wi 5e-05
3nun_A292 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lea 5e-05
4alu_A328 Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 5e-05
3hrc_A311 Crystal Structure Of A Mutant Of Human Pdk1 Kinase 5e-05
1koa_A491 Twitchin Kinase Fragment (C.Elegans), Autoregulated 6e-05
1koa_A491 Twitchin Kinase Fragment (C.Elegans), Autoregulated 6e-04
3cy3_A314 Crystal Structure Of Human Proto-Oncogene Serine Th 6e-05
2qon_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 6e-05
2qon_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 6e-04
4a07_A311 Human Pdk1 Kinase Domain In Complex With Allosteric 6e-05
3fi2_A353 Crystal Structure Of Jnk3 With Amino-Pyrazole Inhib 6e-05
3orx_A316 Pdk1 Mutant Bound To Allosteric Disulfide Fragment 6e-05
2rku_A294 Structure Of Plk1 In Complex With Bi2536 Length = 2 6e-05
2bik_B313 Human Pim1 Phosphorylated On Ser261 Length = 313 6e-05
3rwp_A311 Discovery Of A Novel, Potent And Selective Inhibito 6e-05
3ma3_A313 Crystal Structure Of Human Proto-Oncogene Serine Th 6e-05
3dcv_A328 Crystal Structure Of Human Pim1 Kinase Complexed Wi 6e-05
4fr4_A384 Crystal Structure Of Human SerineTHREONINE-Protein 6e-05
4fr4_A384 Crystal Structure Of Human SerineTHREONINE-Protein 9e-04
2r7b_A312 Crystal Structure Of The Phosphoinositide-Dependent 6e-05
3sc1_A311 Novel Isoquinolone Pdk1 Inhibitors Discovered Throu 7e-05
1kob_A387 Twitchin Kinase Fragment (Aplysia), Autoregulated P 7e-05
4eqm_A294 Structural Analysis Of Staphylococcus Aureus Serine 7e-05
2xck_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 7e-05
1uu3_A310 Structure Of Human Pdk1 Kinase Domain In Complex Wi 7e-05
3is5_A285 Crystal Structure Of Cdpk Kinase Domain From Toxopl 7e-05
3h9o_A311 Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) 7e-05
2xch_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 7e-05
3iop_A312 Pdk-1 In Complex With The Inhibitor Compound-8i Len 7e-05
2vz6_A313 Structure Of Human Calcium Calmodulin Dependent Pro 7e-05
2obj_A333 Crystal Structure Of Human Pim-1 Kinase In Complex 7e-05
3vud_A370 Crystal Structure Of A Cysteine-deficient Mutant M1 7e-05
3q5i_A504 Crystal Structure Of Pbanka_031420 Length = 504 7e-05
3q5i_A504 Crystal Structure Of Pbanka_031420 Length = 504 7e-05
2v5q_A315 Crystal Structure Of Wild-type Plk-1 Kinase Domain 7e-05
2yac_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 7e-05
3kb7_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 8e-05
3thb_A333 Structure Of Plk1 Kinase Domain In Complex With A B 8e-05
2ou7_A335 Structure Of The Catalytic Domain Of Human Polo-Lik 8e-05
3pwy_A311 Crystal Structure Of An Extender (Spd28345)-Modifie 9e-05
3com_A314 Crystal Structure Of Mst1 Kinase Length = 314 9e-05
3com_A314 Crystal Structure Of Mst1 Kinase Length = 314 1e-04
3fv8_A355 Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Le 9e-05
1xjd_A345 Crystal Structure Of Pkc-Theta Complexed With Staur 9e-05
3fxx_A371 Human Epha3 Kinase And Juxtamembrane Region Bound T 9e-05
2rio_A434 Structure Of The Dual Enzyme Ire1 Reveals The Basis 9e-05
3vug_A370 Crystal Structure Of A Cysteine-deficient Mutant M2 1e-04
3dzq_A361 Human Epha3 Kinase Domain In Complex With Inhibitor 1e-04
2qoc_A344 Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp 1e-04
2qoc_A344 Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp 9e-04
3gbz_A329 Structure Of The Cmgc Cdk Kinase From Giardia Lambl 1e-04
3gbz_A329 Structure Of The Cmgc Cdk Kinase From Giardia Lambl 1e-04
2qoi_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 1e-04
2qof_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f 1e-04
2qod_A373 Human Epha3 Kinase And Juxtamembrane Region, Y602f 1e-04
2qoo_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 1e-04
2gsf_A373 The Human Epha3 Receptor Tyrosine Kinase And Juxtam 1e-04
2qob_A344 Human Epha3 Kinase Domain, Base Structure Length = 1e-04
2qkw_B321 Structural Basis For Activation Of Plant Immunity B 1e-04
2qkw_B321 Structural Basis For Activation Of Plant Immunity B 3e-04
2qo7_A373 Human Epha3 Kinase And Juxtamembrane Region, Dephos 1e-04
2qnj_A328 Kinase And Ubiquitin-Associated Domains Of Mark3PAR 1e-04
2qnj_A328 Kinase And Ubiquitin-Associated Domains Of Mark3PAR 1e-04
2h6d_A276 Protein Kinase Domain Of The Human 5'-Amp-Activated 1e-04
2h6d_A276 Protein Kinase Domain Of The Human 5'-Amp-Activated 6e-04
3fe3_A328 Crystal Structure Of The Kinase Mark3PAR-1: T211a-S 1e-04
3fe3_A328 Crystal Structure Of The Kinase Mark3PAR-1: T211a-S 1e-04
3hgk_A327 Crystal Structure Of Effect Protein Avrptob Complex 2e-04
3hgk_A327 Crystal Structure Of Effect Protein Avrptob Complex 4e-04
4ic7_A442 Crystal Structure Of The Erk5 Kinase Domain In Comp 2e-04
4ic7_A442 Crystal Structure Of The Erk5 Kinase Domain In Comp 2e-04
1mqb_A333 Crystal Structure Of Ephrin A2 (Epha2) Receptor Pro 2e-04
1mqb_A333 Crystal Structure Of Ephrin A2 (Epha2) Receptor Pro 6e-04
3niz_A311 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 2e-04
3niz_A311 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 2e-04
3kul_A325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 2e-04
2gph_A364 Docking Motif Interactions In The Map Kinase Erk2 L 2e-04
2gph_A364 Docking Motif Interactions In The Map Kinase Erk2 L 2e-04
2qkr_A313 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 2e-04
2qkr_A313 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 2e-04
4as0_A273 Cyclometalated Phthalimides As Protein Kinase Inhib 2e-04
2yza_A276 Crystal Structure Of Kinase Domain Of Human 5'-Amp- 2e-04
2yza_A276 Crystal Structure Of Kinase Domain Of Human 5'-Amp- 8e-04
3mn3_A271 An Inhibited Conformation For The Protein Kinase Do 2e-04
3mn3_A271 An Inhibited Conformation For The Protein Kinase Do 2e-04
4b99_A398 Crystal Structure Of Mapk7 (Erk5) With Inhibitor Le 2e-04
4b99_A398 Crystal Structure Of Mapk7 (Erk5) With Inhibitor Le 2e-04
1ywv_A293 Crystal Structures Of Proto-Oncogene Kinase Pim1: A 2e-04
1yxs_A293 Crystal Structure Of Kinase Pim1 With P123m Mutatio 2e-04
4dtk_A276 Novel And Selective Pan-Pim Kinase Inhibitor Length 2e-04
3r00_A299 The Discovery Of Novel Benzofuran-2-Carboxylic Acid 2e-04
2xj0_A301 Protein Kinase Pim-1 In Complex With Fragment-4 Fro 2e-04
3jxw_A294 Discovery Of 3h-Benzo[4,5]thieno[3,2-D]pyrimidin-4- 2e-04
3c4e_A273 Pim-1 Kinase Domain In Complex With 3-Aminophenyl-7 2e-04
2qok_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 2e-04
4f1m_A287 Crystal Structure Of The G1179s Roco4 Kinase Domain 2e-04
3d5v_A317 Crystal Structure Of An Activated (Thr->asp) Polo-L 2e-04
3bkb_A377 Crystal Structure Of Human Feline Sarcoma Viral Onc 2e-04
3a99_A320 Structure Of Pim-1 Kinase Crystallized In The Prese 2e-04
1yhs_A273 Crystal Structure Of Pim-1 Bound To Staurosporine L 2e-04
2fh9_A274 Structure And Dimerization Of The Kinase Domain Fro 2e-04
2fh9_A274 Structure And Dimerization Of The Kinase Domain Fro 2e-04
3db6_A301 Crystal Structure Of An Activated (Thr->asp) Polo-L 2e-04
3hyh_A275 Crystal Structure Of The Protein Kinase Domain Of Y 2e-04
3hyh_A275 Crystal Structure Of The Protein Kinase Domain Of Y 2e-04
3uix_A298 Crystal Structure Of Pim1 Kinase In Complex With Sm 2e-04
1xqz_A300 Crystal Structure Of Hpim-1 Kinase At 2.1 A Resolut 2e-04
3qc4_A314 Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 2e-04
3dae_A283 Crystal Structure Of Phosphorylated Snf1 Kinase Dom 2e-04
3dae_A283 Crystal Structure Of Phosphorylated Snf1 Kinase Dom 2e-04
1yvj_A290 Crystal Structure Of The Jak3 Kinase Domain In Comp 2e-04
1yvj_A290 Crystal Structure Of The Jak3 Kinase Domain In Comp 2e-04
2iwi_A312 Crystal Structure Of The Human Pim2 In Complex With 3e-04
2xik_A294 Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related K 3e-04
2qol_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596:y 3e-04
3soa_A444 Full-Length Human Camkii Length = 444 3e-04
3nup_A307 Cdk6 (Monomeric) In Complex With Inhibitor Length = 3e-04
3nup_A307 Cdk6 (Monomeric) In Complex With Inhibitor Length = 3e-04
3kul_B325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 3e-04
2c30_A321 Crystal Structure Of The Human P21-Activated Kinase 3e-04
3e87_A335 Crystal Structures Of The Kinase Domain Of Akt2 In 3e-04
1gzk_A315 Molecular Mechanism For The Regulation Of Protein K 3e-04
3d5u_A317 Crystal Structure Of A Wildtype Polo-Like Kinase 1 3e-04
1gzn_A335 Structure Of Pkb Kinase Domain Length = 335 3e-04
3d5w_A317 Crystal Structure Of A Phosphorylated Polo-Like Kin 3e-04
1mrv_A339 Crystal Structure Of An Inactive Akt2 Kinase Domain 3e-04
2hen_A286 Crystal Structure Of The Ephb2 Receptor Kinase Doma 3e-04
3vum_A370 Crystal Structure Of A Cysteine-deficient Mutant M7 3e-04
3lj0_A434 Ire1 Complexed With Adp And Quercetin Length = 434 3e-04
3cd3_A377 Crystal Structure Of Phosphorylated Human Feline Sa 4e-04
3ggf_A301 Crystal Structure Of Human SerineTHREONINE-Protein 4e-04
1o6k_A336 Structure Of Activated Form Of Pkb Kinase Domain S4 4e-04
1o6l_A337 Crystal Structure Of An Activated Akt/protein Kinas 4e-04
4af3_A292 Human Aurora B Kinase In Complex With Incenp And Vx 4e-04
2xiy_A301 Protein Kinase Pim-1 In Complex With Fragment-2 Fro 4e-04
4a7c_A308 Crystal Structure Of Pim1 Kinase With Etp46546 Leng 4e-04
3vul_A370 Crystal Structure Of A Cysteine-deficient Mutant M1 4e-04
2j7t_A302 Crystal Structure Of Human Serine Threonine Kinase- 4e-04
2j7t_A302 Crystal Structure Of Human Serine Threonine Kinase- 4e-04
1jow_B308 Crystal Structure Of A Complex Of Human Cdk6 And A 4e-04
1jow_B308 Crystal Structure Of A Complex Of Human Cdk6 And A 4e-04
2jdo_A342 Structure Of Pkb-Beta (Akt2) Complexed With Isoquin 4e-04
4bc6_A293 Crystal Structure Of Human Serine Threonine Kinase- 4e-04
4bc6_A293 Crystal Structure Of Human Serine Threonine Kinase- 4e-04
2wd1_A292 Human C-Met Kinase In Complex With Azaindole Inhibi 4e-04
2wd1_A292 Human C-Met Kinase In Complex With Azaindole Inhibi 9e-04
1bi8_A326 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 4e-04
1bi8_A326 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 4e-04
3f2a_A300 Crystal Structure Of Human Pim-1 In Complex With Da 4e-04
4gv1_A340 Pkb Alpha In Complex With Azd5363 Length = 340 4e-04
3lpb_A295 Crystal Structure Of Jak2 Complexed With A Potent 2 4e-04
3lpb_A295 Crystal Structure Of Jak2 Complexed With A Potent 2 4e-04
3vuk_A370 Crystal Structure Of A Cysteine-deficient Mutant M5 4e-04
3rvg_A303 Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido 4e-04
3rvg_A303 Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido 4e-04
2ac5_A316 Structure Of Human Mnk2 Kinase Domain Mutant D228g 4e-04
2w1i_A326 Structure Determination Of Aurora Kinase In Complex 4e-04
2w1i_A326 Structure Determination Of Aurora Kinase In Complex 4e-04
3vuh_A370 Crystal Structure Of A Cysteine-deficient Mutant M3 4e-04
3pjc_A315 Crystal Structure Of Jak3 Complexed With A Potent A 4e-04
3pjc_A315 Crystal Structure Of Jak3 Complexed With A Potent A 4e-04
3e62_A293 Fragment Based Discovery Of Jak-2 Inhibitors Length 4e-04
3e62_A293 Fragment Based Discovery Of Jak-2 Inhibitors Length 4e-04
3tjc_A298 Co-Crystal Structure Of Jak2 With Thienopyridine 8 4e-04
3tjc_A298 Co-Crystal Structure Of Jak2 With Thienopyridine 8 4e-04
4hge_A300 Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 4e-04
4hge_A300 Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 4e-04
4aqc_A301 Triazolopyridine-Based Inhibitor Of Janus Kinase 2 4e-04
4aqc_A301 Triazolopyridine-Based Inhibitor Of Janus Kinase 2 4e-04
2xa4_A298 Inhibitors Of Jak2 Kinase Domain Length = 298 4e-04
2xa4_A298 Inhibitors Of Jak2 Kinase Domain Length = 298 4e-04
3lxk_A327 Structural And Thermodynamic Characterization Of Th 5e-04
3lxk_A327 Structural And Thermodynamic Characterization Of Th 5e-04
3f66_A298 Human C-Met Kinase In Complex With Quinoxaline Inhi 5e-04
4gg5_A319 Crystal Structure Of Cmet In Complex With Novel Inh 5e-04
3cqu_A342 Crystal Structure Of Akt-1 Complexed With Substrate 5e-04
2b7a_A293 The Structural Basis Of Janus Kinase 2 Inhibition B 5e-04
2b7a_A293 The Structural Basis Of Janus Kinase 2 Inhibition B 5e-04
3i5n_A309 Crystal Structure Of C-Met With Triazolopyridazine 5e-04
3ocb_A341 Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor 5e-04
3q32_A301 Structure Of Janus Kinase 2 With A Pyrrolotriazine 5e-04
3q32_A301 Structure Of Janus Kinase 2 With A Pyrrolotriazine 5e-04
4hvd_A314 Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h 5e-04
4hvd_A314 Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h 5e-04
4e4m_A302 Jak2 Kinase (Jh1 Domain) In Complex With Compound 3 5e-04
4e4m_A302 Jak2 Kinase (Jh1 Domain) In Complex With Compound 3 5e-04
3h4j_B336 Crystal Structure Of Pombe Ampk Kdaid Fragment Leng 5e-04
4e20_A290 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 5e-04
3jy9_A311 Janus Kinase 2 Inhibitors Length = 311 5e-04
3jy9_A311 Janus Kinase 2 Inhibitors Length = 311 5e-04
3lq8_A302 Structure Of The Kinase Domain Of C-Met Bound To Xl 5e-04
3io7_A313 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Sel 5e-04
3io7_A313 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Sel 5e-04
4e1z_A291 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 5e-04
2wgj_A306 X-Ray Structure Of Pf-02341066 Bound To The Kinase 5e-04
3vui_A370 Crystal Structure Of A Cysteine-deficient Mutant M2 5e-04
3gc8_A370 The Structure Of P38beta C162s In Complex With A Di 5e-04
3gp0_A348 Crystal Structure Of Human Mitogen Activated Protei 5e-04
3q6u_A308 Structure Of The Apo Met Receptor Kinase In The Dua 5e-04
2rfn_A310 X-ray Structure Of C-met With Inhibitor. Length = 3 5e-04
4e6d_A298 Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex W 5e-04
4e6d_A298 Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex W 5e-04
2psq_A370 Crystal Structure Of Unphosphorylated Unactivated W 5e-04
2psq_A370 Crystal Structure Of Unphosphorylated Unactivated W 5e-04
3dkg_A317 Sgx Clone 5698a109kfg1h1 Length = 317 5e-04
1k3a_A299 Structure Of The Insulin-Like Growth Factor 1 Recep 6e-04
3lxn_A318 Structural And Thermodynamic Characterization Of Th 6e-04
3lxn_A318 Structural And Thermodynamic Characterization Of Th 6e-04
2g15_A318 Structural Characterization Of Autoinhibited C-Met 6e-04
3o96_A446 Crystal Structure Of Human Akt1 With An Allosteric 6e-04
3a7f_A303 Human Mst3 Kinase Length = 303 6e-04
3cly_A334 Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase 6e-04
3cly_A334 Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase 6e-04
3b2t_A311 Structure Of Phosphotransferase Length = 311 6e-04
3b2t_A311 Structure Of Phosphotransferase Length = 311 6e-04
4ejn_A446 Crystal Structure Of Autoinhibited Form Of Akt1 In 6e-04
3ckx_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 6e-04
3qfv_A415 Mrck Beta In Complex With Tpca-1 Length = 415 6e-04
3ckw_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 7e-04
3c4f_A302 Fgfr Tyrosine Kinase Domain In Complex With 3-(3- M 7e-04
3c4f_A302 Fgfr Tyrosine Kinase Domain In Complex With 3-(3- M 7e-04
3tku_A433 Mrck Beta In Complex With Fasudil Length = 433 7e-04
2pvf_A334 Crystal Structure Of Tyrosine Phosphorylated Activa 7e-04
2pvf_A334 Crystal Structure Of Tyrosine Phosphorylated Activa 7e-04
2zm3_A308 Complex Structure Of Insulin-Like Growth Factor Rec 7e-04
3ri1_A313 Crystal Structure Of The Catalytic Domain Of Fgfr2 7e-04
3ri1_A313 Crystal Structure Of The Catalytic Domain Of Fgfr2 7e-04
2vwu_A302 Ephb4 Kinase Domain Inhibitor Complex Length = 302 7e-04
2pzp_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 7e-04
2pzp_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 7e-04
1gjo_A316 The Fgfr2 Tyrosine Kinase Domain Length = 316 7e-04
1gjo_A316 The Fgfr2 Tyrosine Kinase Domain Length = 316 7e-04
3bhh_A295 Crystal Structure Of Human Calcium/calmodulin-depen 7e-04
4g3g_A350 Crystal Structure Of Murine Nf-kappab Inducing Kina 7e-04
4g3g_A350 Crystal Structure Of Murine Nf-kappab Inducing Kina 7e-04
4g3f_A336 Crystal Structure Of Murine Nf-kappab Inducing Kina 7e-04
4g3f_A336 Crystal Structure Of Murine Nf-kappab Inducing Kina 7e-04
4g3c_A352 Crystal Structure Of Apo Murine Nf-kappab Inducing 7e-04
4g3c_A352 Crystal Structure Of Apo Murine Nf-kappab Inducing 7e-04
3kl8_A269 Camkiintide Inhibitor Complex Length = 269 7e-04
1h4l_A292 Structure And Regulation Of The Cdk5-P25(Nck5a) Com 8e-04
3zhp_C294 Human Mst3 (stk24) In Complex With Mo25beta Length 8e-04
2pzr_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 8e-04
2pzr_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 8e-04
3e7o_A360 Crystal Structure Of Jnk2 Length = 360 9e-04
3kn5_A325 Crystal Structure Of The C-Terminal Kinase Domain O 9e-04
3fhr_A336 High Resolution Crystal Structure Of Mitogen-Activa 9e-04
3ll6_A337 Crystal Structure Of The Human Cyclin G Associated 9e-04
3gql_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 9e-04
3gql_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 9e-04
>pdb|2Y7J|A Chain A, Structure Of Human Phosphorylase Kinase, Gamma 2 Length = 365 Back     alignment and structure

Iteration: 1

Score = 70.5 bits (171), Expect = 8e-12, Method: Compositional matrix adjust. Identities = 102/401 (25%), Positives = 163/401 (40%), Gaps = 78/401 (19%) Query: 727 GHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYL 786 G DN F + R E+ LP LN RR + L +DPS SA L A +L Sbjct: 10 GVDNKFNKERRRARREIRHLPNLNRE----QRRAFIRSLRDDPSQ--SANLLAEAKKLND 63 Query: 787 WAPK---HWLYGATPSHNEIMQWLLTLT-------TKVLCTGVSYGGHVRRTF---VEYQ 833 PK + + + +E+ W V+ GVS VRR ++ Sbjct: 64 AQPKGTENLYFQSMGPEDELPDWAAAKEFYQKYDPKDVIGRGVS--SVVRRCVHRATGHE 121 Query: 834 LISTFLKRAEFRLITNALQYIQRNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSL 893 ++ RL L+ ++ + + + HP+++ + + S SS Sbjct: 122 FAVKIMEVTAERLSPEQLEEVREATRRETHILRQVAGHPHIITL-------IDSYESSSF 174 Query: 894 IYPSALPARLNPTGGYGRNMSLFILMKKYNTDLRNYLRERCAQLSMHERILLFTQLLEGV 953 ++ +F LM+K +L +YL E+ A LS E + LLE V Sbjct: 175 MF------------------LVFDLMRK--GELFDYLTEKVA-LSEKETRSIMRSLLEAV 213 Query: 954 THLNMHRTAHRDLKSDNILLDCSEDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGN 1013 + L+ + HRDLK +NILLD DN Q+ ++DFG S + G ++ EL G Sbjct: 214 SFLHANNIVHRDLKPENILLD---DNM--QIRLSDFGFSCHLEPGEKLR------ELCGT 262 Query: 1014 VALMAPEVALAT-----PGLFSFVNYSKS-DAWTAGTVAYEIFGHDNPFYQSARNTDYEV 1067 +APE+ + PG Y K D W G + + + PF+ + + Sbjct: 263 PGYLAPEILKCSMDETHPG------YGKEVDLWACGVILFTLLAGSPPFWHRRQILMLRM 316 Query: 1068 NALPQLNTNVPE------VMRRLVAKLLENDPSDRPSAELA 1102 Q + PE ++ L+++LL+ DP R +AE A Sbjct: 317 IMEGQYQFSSPEWDDRSSTVKDLISRLLQVDPEARLTAEQA 357
>pdb|2Y7J|A Chain A, Structure Of Human Phosphorylase Kinase, Gamma 2 Length = 365 Back     alignment and structure
>pdb|2JAM|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase I G Length = 304 Back     alignment and structure
>pdb|2JAM|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase I G Length = 304 Back     alignment and structure
>pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 Back     alignment and structure
>pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 Back     alignment and structure
>pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 Back     alignment and structure
>pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 Back     alignment and structure
>pdb|3OG7|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx4032 Length = 289 Back     alignment and structure
>pdb|3OG7|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx4032 Length = 289 Back     alignment and structure
>pdb|4FK3|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx3203 Length = 292 Back     alignment and structure
>pdb|4FK3|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx3203 Length = 292 Back     alignment and structure
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure
>pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 Back     alignment and structure
>pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 Back     alignment and structure
>pdb|3UDB|A Chain A, Crystal Structure Of Snrk2.6 Length = 317 Back     alignment and structure
>pdb|3UDB|A Chain A, Crystal Structure Of Snrk2.6 Length = 317 Back     alignment and structure
>pdb|3LM0|A Chain A, Crystal Structure Of Human SerineTHREONINE KINASE 17B (STK17B) Length = 327 Back     alignment and structure
>pdb|3LM0|A Chain A, Crystal Structure Of Human SerineTHREONINE KINASE 17B (STK17B) Length = 327 Back     alignment and structure
>pdb|1UWJ|A Chain A, The Complex Of Mutant V599e B-raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|1UWJ|A Chain A, The Complex Of Mutant V599e B-raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|3IDP|A Chain A, B-Raf V600e Kinase Domain In Complex With An Aminoisoquinoline Inhibitor Length = 300 Back     alignment and structure
>pdb|3IDP|A Chain A, B-Raf V600e Kinase Domain In Complex With An Aminoisoquinoline Inhibitor Length = 300 Back     alignment and structure
>pdb|3UC3|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.3 Length = 361 Back     alignment and structure
>pdb|3UC3|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.3 Length = 361 Back     alignment and structure
>pdb|3Q96|A Chain A, B-Raf Kinase Domain In Complex With A Tetrahydronaphthalene Inhibitor Length = 282 Back     alignment and structure
>pdb|3Q96|A Chain A, B-Raf Kinase Domain In Complex With A Tetrahydronaphthalene Inhibitor Length = 282 Back     alignment and structure
>pdb|4G9R|A Chain A, B-Raf V600e Kinase Domain Bound To A Type Ii Dihydroquinazoline Inhibitor Length = 307 Back     alignment and structure
>pdb|4G9R|A Chain A, B-Raf V600e Kinase Domain Bound To A Type Ii Dihydroquinazoline Inhibitor Length = 307 Back     alignment and structure
>pdb|1UWH|A Chain A, The Complex Of Wild Type B-Raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|1UWH|A Chain A, The Complex Of Wild Type B-Raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|4H58|A Chain A, Braf In Complex With Compound 3 Length = 275 Back     alignment and structure
>pdb|4H58|A Chain A, Braf In Complex With Compound 3 Length = 275 Back     alignment and structure
>pdb|2FB8|A Chain A, Structure Of The B-Raf Kinase Domain Bound To Sb-590885 Length = 281 Back     alignment and structure
>pdb|2FB8|A Chain A, Structure Of The B-Raf Kinase Domain Bound To Sb-590885 Length = 281 Back     alignment and structure
>pdb|4DBN|A Chain A, Crystal Structure Of The Kinase Domain Of Human B-Raf With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 284 Back     alignment and structure
>pdb|4DBN|A Chain A, Crystal Structure Of The Kinase Domain Of Human B-Raf With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 284 Back     alignment and structure
>pdb|3II5|A Chain A, The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimidine Inhibitor Length = 306 Back     alignment and structure
>pdb|3II5|A Chain A, The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimidine Inhibitor Length = 306 Back     alignment and structure
>pdb|3D4Q|A Chain A, Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 307 Back     alignment and structure
>pdb|3D4Q|A Chain A, Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 307 Back     alignment and structure
>pdb|3BHY|A Chain A, Crystal Structure Of Human Death Associated Protein Kinase 3 (Dapk3) In Complex With A Beta-Carboline Ligand Length = 283 Back     alignment and structure
>pdb|3BHY|A Chain A, Crystal Structure Of Human Death Associated Protein Kinase 3 (Dapk3) In Complex With A Beta-Carboline Ligand Length = 283 Back     alignment and structure
>pdb|1YRP|A Chain A, Catalytic Domain Of Human Zip Kinase Phosphorylated At Thr265 Length = 278 Back     alignment and structure
>pdb|1YRP|A Chain A, Catalytic Domain Of Human Zip Kinase Phosphorylated At Thr265 Length = 278 Back     alignment and structure
>pdb|2JC6|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase 1d Length = 334 Back     alignment and structure
>pdb|2JC6|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase 1d Length = 334 Back     alignment and structure
>pdb|3UJG|A Chain A, Crystal Structure Of Snrk2.6 In Complex With Hab1 Length = 361 Back     alignment and structure
>pdb|3UJG|A Chain A, Crystal Structure Of Snrk2.6 In Complex With Hab1 Length = 361 Back     alignment and structure
>pdb|3UC4|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.6 Length = 362 Back     alignment and structure
>pdb|3UC4|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.6 Length = 362 Back     alignment and structure
>pdb|3VW6|A Chain A, Crystal Structure Of Human Apoptosis Signal-Regulating Kinase 1 (Ask1) With Imidazopyridine Inhibitor Length = 269 Back     alignment and structure
>pdb|3VW6|A Chain A, Crystal Structure Of Human Apoptosis Signal-Regulating Kinase 1 (Ask1) With Imidazopyridine Inhibitor Length = 269 Back     alignment and structure
>pdb|3OMV|A Chain A, Crystal Structure Of C-Raf (Raf-1) Length = 307 Back     alignment and structure
>pdb|3OMV|A Chain A, Crystal Structure Of C-Raf (Raf-1) Length = 307 Back     alignment and structure
>pdb|2CLQ|A Chain A, Structure Of Mitogen-Activated Protein Kinase Kinase Kinase 5 Length = 295 Back     alignment and structure
>pdb|2CLQ|A Chain A, Structure Of Mitogen-Activated Protein Kinase Kinase Kinase 5 Length = 295 Back     alignment and structure
>pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 Back     alignment and structure
>pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 Back     alignment and structure
>pdb|2R5T|A Chain A, Crystal Structure Of Inactive Serum And Glucocorticoid- Regulated Kinase 1 In Complex With Amp-Pnp Length = 373 Back     alignment and structure
>pdb|2R5T|A Chain A, Crystal Structure Of Inactive Serum And Glucocorticoid- Regulated Kinase 1 In Complex With Amp-Pnp Length = 373 Back     alignment and structure
>pdb|2J0L|A Chain A, Crystal Structure Of A The Active Conformation Of The Kinase Domain Of Focal Adhesion Kinase With A Phosphorylated Activation Loop Length = 276 Back     alignment and structure
>pdb|2J0L|A Chain A, Crystal Structure Of A The Active Conformation Of The Kinase Domain Of Focal Adhesion Kinase With A Phosphorylated Activation Loop Length = 276 Back     alignment and structure
>pdb|2PHK|A Chain A, The Crystal Structure Of A Phosphorylase Kinase Peptide Substrate Complex: Kinase Substrate Recognition Length = 277 Back     alignment and structure
>pdb|2PHK|A Chain A, The Crystal Structure Of A Phosphorylase Kinase Peptide Substrate Complex: Kinase Substrate Recognition Length = 277 Back     alignment and structure
>pdb|2J90|A Chain A, Crystal Structure Of Human Zip Kinase In Complex With A Tetracyclic Pyridone Inhibitor (pyridone 6) Length = 304 Back     alignment and structure
>pdb|2J90|A Chain A, Crystal Structure Of Human Zip Kinase In Complex With A Tetracyclic Pyridone Inhibitor (pyridone 6) Length = 304 Back     alignment and structure
>pdb|1PHK|A Chain A, Two Structures Of The Catalytic Domain Of Phosphorylase, Kinase: An Active Protein Kinase Complexed With Nucleotide, Substrate-Analogue And Product Length = 298 Back     alignment and structure
>pdb|1PHK|A Chain A, Two Structures Of The Catalytic Domain Of Phosphorylase, Kinase: An Active Protein Kinase Complexed With Nucleotide, Substrate-Analogue And Product Length = 298 Back     alignment and structure
>pdb|4EBW|A Chain A, Structure Of Focal Adhesion Kinase Catalytic Domain In Complex With Novel Allosteric Inhibitor Length = 304 Back     alignment and structure
>pdb|4EBW|A Chain A, Structure Of Focal Adhesion Kinase Catalytic Domain In Complex With Novel Allosteric Inhibitor Length = 304 Back     alignment and structure
>pdb|1MP8|A Chain A, Crystal Structure Of Focal Adhesion Kinase (Fak) Length = 281 Back     alignment and structure
>pdb|1MP8|A Chain A, Crystal Structure Of Focal Adhesion Kinase (Fak) Length = 281 Back     alignment and structure
>pdb|2J0M|B Chain B, Crystal Structure A Two-Chain Complex Between The Ferm And Kinase Domains Of Focal Adhesion Kinase. Length = 276 Back     alignment and structure
>pdb|2J0M|B Chain B, Crystal Structure A Two-Chain Complex Between The Ferm And Kinase Domains Of Focal Adhesion Kinase. Length = 276 Back     alignment and structure
>pdb|2JKM|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|2JKM|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 Back     alignment and structure
>pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 Back     alignment and structure
>pdb|3DAK|A Chain A, Crystal Structure Of Domain-Swapped Osr1 Kinase Domain Length = 290 Back     alignment and structure
>pdb|3DAK|A Chain A, Crystal Structure Of Domain-Swapped Osr1 Kinase Domain Length = 290 Back     alignment and structure
>pdb|3PXK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Pyrrolo[2,3- D]thiazole Length = 282 Back     alignment and structure
>pdb|3PXK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Pyrrolo[2,3- D]thiazole Length = 282 Back     alignment and structure
>pdb|3BZ3|A Chain A, Crystal Structure Analysis Of Focal Adhesion Kinase With A Methanesulfonamide Diaminopyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|3BZ3|A Chain A, Crystal Structure Analysis Of Focal Adhesion Kinase With A Methanesulfonamide Diaminopyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|2ETM|A Chain A, Crystal Structure Of Focal Adhesion Kinase Domain Complexed With 7h-Pyrrolo [2,3-D] Pyrimidine Derivative Length = 281 Back     alignment and structure
>pdb|2ETM|A Chain A, Crystal Structure Of Focal Adhesion Kinase Domain Complexed With 7h-Pyrrolo [2,3-D] Pyrimidine Derivative Length = 281 Back     alignment and structure
>pdb|4APC|A Chain A, Crystal Structure Of Human Nima-Related Kinase 1 (Nek1) Length = 350 Back     alignment and structure
>pdb|2VWI|A Chain A, Structure Of The Osr1 Kinase, A Hypertension Drug Target Length = 303 Back     alignment and structure
>pdb|2VWI|A Chain A, Structure Of The Osr1 Kinase, A Hypertension Drug Target Length = 303 Back     alignment and structure
>pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 Back     alignment and structure
>pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 Back     alignment and structure
>pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 Back     alignment and structure
>pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 Back     alignment and structure
>pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 Back     alignment and structure
>pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 Back     alignment and structure
>pdb|3NYN|A Chain A, Crystal Structure Of G Protein-Coupled Receptor Kinase 6 In Complex With Sangivamycin Length = 576 Back     alignment and structure
>pdb|3NYN|A Chain A, Crystal Structure Of G Protein-Coupled Receptor Kinase 6 In Complex With Sangivamycin Length = 576 Back     alignment and structure
>pdb|2VD5|A Chain A, Structure Of Human Myotonic Dystrophy Protein Kinase In Complex With The Bisindoylmaleide Inhibitor Bim Viii Length = 412 Back     alignment and structure
>pdb|2VD5|A Chain A, Structure Of Human Myotonic Dystrophy Protein Kinase In Complex With The Bisindoylmaleide Inhibitor Bim Viii Length = 412 Back     alignment and structure
>pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 Back     alignment and structure
>pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 Back     alignment and structure
>pdb|2ACX|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 6 Bound To Amppnp Length = 576 Back     alignment and structure
>pdb|2ACX|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 6 Bound To Amppnp Length = 576 Back     alignment and structure
>pdb|2JKK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|2JKK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|3ZUT|A Chain A, The Structure Of Ost1 (D160a) Kinase Length = 362 Back     alignment and structure
>pdb|3ZUT|A Chain A, The Structure Of Ost1 (D160a) Kinase Length = 362 Back     alignment and structure
>pdb|3I6W|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 443 Back     alignment and structure
>pdb|3I6W|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 443 Back     alignment and structure
>pdb|2CN5|A Chain A, Crystal Structure Of Human Chk2 In Complex With Adp Length = 329 Back     alignment and structure
>pdb|2CN5|A Chain A, Crystal Structure Of Human Chk2 In Complex With Adp Length = 329 Back     alignment and structure
>pdb|2YCF|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv1531 Length = 322 Back     alignment and structure
>pdb|2YCF|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv1531 Length = 322 Back     alignment and structure
>pdb|2YHV|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|2YHV|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|2YFX|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase In Complex With Crizotinib Length = 327 Back     alignment and structure
>pdb|2YFX|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase In Complex With Crizotinib Length = 327 Back     alignment and structure
>pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 Back     alignment and structure
>pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 Back     alignment and structure
>pdb|3I6U|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 419 Back     alignment and structure
>pdb|3I6U|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 419 Back     alignment and structure
>pdb|2W0J|A Chain A, Crystal Structure Of Chk2 In Complex With Nsc 109555, A Specific Inhibitor Length = 323 Back     alignment and structure
>pdb|2W0J|A Chain A, Crystal Structure Of Chk2 In Complex With Nsc 109555, A Specific Inhibitor Length = 323 Back     alignment and structure
>pdb|2YCR|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv976 Length = 323 Back     alignment and structure
>pdb|2YCR|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv976 Length = 323 Back     alignment and structure
>pdb|3MFR|A Chain A, Cask-4m Cam Kinase Domain, Native Length = 351 Back     alignment and structure
>pdb|3MFR|A Chain A, Cask-4m Cam Kinase Domain, Native Length = 351 Back     alignment and structure
>pdb|2XK9|A Chain A, Structural Analysis Of Checkpoint Kinase 2 (Chk2) In Complex With Inhibitor Pv1533 Length = 322 Back     alignment and structure
>pdb|2XK9|A Chain A, Structural Analysis Of Checkpoint Kinase 2 (Chk2) In Complex With Inhibitor Pv1533 Length = 322 Back     alignment and structure
>pdb|2J0J|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains Length = 656 Back     alignment and structure
>pdb|2J0J|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains Length = 656 Back     alignment and structure
>pdb|1QL6|A Chain A, The Catalytic Mechanism Of Phosphorylase Kinase Probed By Mutational Studies Length = 298 Back     alignment and structure
>pdb|1QL6|A Chain A, The Catalytic Mechanism Of Phosphorylase Kinase Probed By Mutational Studies Length = 298 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|2YJS|A Chain A, Structure Of C1156y Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|2YJS|A Chain A, Structure Of C1156y Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|2XB7|A Chain A, Structure Of Human Anaplastic Lymphoma Kinase In Complex With Nvp- Tae684 Length = 315 Back     alignment and structure
>pdb|2XB7|A Chain A, Structure Of Human Anaplastic Lymphoma Kinase In Complex With Nvp- Tae684 Length = 315 Back     alignment and structure
>pdb|3ZUU|A Chain A, The Structure Of Ost1 (D160a, S175d) Kinase In Complex With Gold Length = 362 Back     alignment and structure
>pdb|3ZUU|A Chain A, The Structure Of Ost1 (D160a, S175d) Kinase In Complex With Gold Length = 362 Back     alignment and structure
>pdb|2J0K|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains. Length = 656 Back     alignment and structure
>pdb|2J0K|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains. Length = 656 Back     alignment and structure
>pdb|2XP2|A Chain A, Structure Of The Human Anaplastic Lymphoma Kinase In Complex With Crizotinib (Pf-02341066) Length = 327 Back     alignment and structure
>pdb|2XP2|A Chain A, Structure Of The Human Anaplastic Lymphoma Kinase In Complex With Crizotinib (Pf-02341066) Length = 327 Back     alignment and structure
>pdb|4FNX|A Chain A, Crystal Structure Of The Apo R1275q Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|4FNX|A Chain A, Crystal Structure Of The Apo R1275q Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|2YJR|A Chain A, Structure Of F1174l Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|2YJR|A Chain A, Structure Of F1174l Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|4FNZ|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Piperidine-Carboxamide Inhibitor 2 Length = 327 Back     alignment and structure
>pdb|4FNZ|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Piperidine-Carboxamide Inhibitor 2 Length = 327 Back     alignment and structure
>pdb|4FNW|A Chain A, Crystal Structure Of The Apo F1174l Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|4FNW|A Chain A, Crystal Structure Of The Apo F1174l Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|3AOX|A Chain A, X-Ray Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Ch5424802 Length = 344 Back     alignment and structure
>pdb|3AOX|A Chain A, X-Ray Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Ch5424802 Length = 344 Back     alignment and structure
>pdb|4DCE|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With A Piperidine-Carboxamide Inhibitor Length = 333 Back     alignment and structure
>pdb|4DCE|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With A Piperidine-Carboxamide Inhibitor Length = 333 Back     alignment and structure
>pdb|1WMK|A Chain A, Human Death-Associated Kinase Drp-1, Mutant S308d D40 Length = 321 Back     alignment and structure
>pdb|1WMK|A Chain A, Human Death-Associated Kinase Drp-1, Mutant S308d D40 Length = 321 Back     alignment and structure
>pdb|2V7O|A Chain A, Crystal Structure Of Human Calcium-Calmodulin-Dependent Protein Kinase Ii Gamma Length = 336 Back     alignment and structure
>pdb|2V7O|A Chain A, Crystal Structure Of Human Calcium-Calmodulin-Dependent Protein Kinase Ii Gamma Length = 336 Back     alignment and structure
>pdb|4FOB|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Acyliminobenzimidazole Inhibitor 1 Length = 353 Back     alignment and structure
>pdb|4FOB|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Acyliminobenzimidazole Inhibitor 1 Length = 353 Back     alignment and structure
>pdb|2A27|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 8 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|2A27|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 8 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|2EVA|A Chain A, Structural Basis For The Interaction Of Tak1 Kinase With Its Activating Protein Tab1 Length = 307 Back     alignment and structure
>pdb|4GS6|A Chain A, Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxozeaenol Length = 315 Back     alignment and structure
>pdb|1ZWS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Drp-1 Kinase Length = 288 Back     alignment and structure
>pdb|1ZWS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Drp-1 Kinase Length = 288 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|2A2A|A Chain A, High-resolution Crystallographic Analysis Of The Autoinhibited Conformation Of A Human Death-associated Protein Kinase Length = 321 Back     alignment and structure
>pdb|2A2A|A Chain A, High-resolution Crystallographic Analysis Of The Autoinhibited Conformation Of A Human Death-associated Protein Kinase Length = 321 Back     alignment and structure
>pdb|2YA9|A Chain A, Crystal Structure Of The Autoinhibited Form Of Mouse Dapk2 Length = 361 Back     alignment and structure
>pdb|2YA9|A Chain A, Crystal Structure Of The Autoinhibited Form Of Mouse Dapk2 Length = 361 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|1Z9X|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 3 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|1Z9X|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 3 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|2G01|A Chain A, Pyrazoloquinolones As Novel, Selective Jnk1 Inhibitors Length = 370 Back     alignment and structure
>pdb|2G01|A Chain A, Pyrazoloquinolones As Novel, Selective Jnk1 Inhibitors Length = 370 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|3L9P|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 367 Back     alignment and structure
>pdb|3L9P|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 367 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|3LCT|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 344 Back     alignment and structure
>pdb|3LCT|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 344 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 Back     alignment and structure
>pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|3GU8|A Chain A, Crystal Structure Of Dapkl93g With N6-Cyclopentyladenosine Length = 295 Back     alignment and structure
>pdb|3GU8|A Chain A, Crystal Structure Of Dapkl93g With N6-Cyclopentyladenosine Length = 295 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 Back     alignment and structure
>pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 Back     alignment and structure
>pdb|3DLS|A Chain A, Crystal Structure Of Human Pas Kinase Bound To Adp Length = 335 Back     alignment and structure
>pdb|3DLS|A Chain A, Crystal Structure Of Human Pas Kinase Bound To Adp Length = 335 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|3GU4|A Chain A, Crystal Structure Of Dapkq23v-Amppnp Length = 295 Back     alignment and structure
>pdb|3GU4|A Chain A, Crystal Structure Of Dapkq23v-Amppnp Length = 295 Back     alignment and structure
>pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 Back     alignment and structure
>pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 Back     alignment and structure
>pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 Back     alignment and structure
>pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 Back     alignment and structure
>pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 Back     alignment and structure
>pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 Back     alignment and structure
>pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 Back     alignment and structure
>pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 Back     alignment and structure
>pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 Back     alignment and structure
>pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 Back     alignment and structure
>pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 Back     alignment and structure
>pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 Back     alignment and structure
>pdb|3V3V|A Chain A, Structural And Functional Analysis Of Quercetagetin, A Natural Jnk1 Inhibitor Length = 379 Back     alignment and structure
>pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 Back     alignment and structure
>pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 Back     alignment and structure
>pdb|3MTL|A Chain A, Crystal Structure Of The Pctaire1 Kinase In Complex With Ind E804 Length = 324 Back     alignment and structure
>pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 Back     alignment and structure
>pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 Back     alignment and structure
>pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 Back     alignment and structure
>pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 Back     alignment and structure
>pdb|2VN9|A Chain A, Crystal Structure Of Human Calcium Calmodulin Dependent Protein Kinase Ii Delta Isoform 1, Camkd Length = 301 Back     alignment and structure
>pdb|2GCD|A Chain A, Tao2 Kinase Domain-Staurosporine Structure Length = 309 Back     alignment and structure
>pdb|1U5Q|A Chain A, Crystal Structure Of The Tao2 Kinase Domain: Activation And Specifity Of A Ste20p Map3k Length = 348 Back     alignment and structure
>pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 Back     alignment and structure
>pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 Back     alignment and structure
>pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 Back     alignment and structure
>pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 Back     alignment and structure
>pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 Back     alignment and structure
>pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 Back     alignment and structure
>pdb|1LUF|A Chain A, Crystal Structure Of The Musk Tyrosine Kinase: Insights Into Receptor Autoregulation Length = 343 Back     alignment and structure
>pdb|1LUF|A Chain A, Crystal Structure Of The Musk Tyrosine Kinase: Insights Into Receptor Autoregulation Length = 343 Back     alignment and structure
>pdb|3QGW|A Chain A, Crystal Structure Of Itk Kinase Bound To An Inhibitor Length = 286 Back     alignment and structure
>pdb|3QGW|A Chain A, Crystal Structure Of Itk Kinase Bound To An Inhibitor Length = 286 Back     alignment and structure
>pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 Back     alignment and structure
>pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 Back     alignment and structure
>pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|3T9T|A Chain A, Crystal Structure Of Btk Mutant (F435t,K596r) Complexed With Imidazo[1,5-A]quinoxaline Length = 267 Back     alignment and structure
>pdb|3T9T|A Chain A, Crystal Structure Of Btk Mutant (F435t,K596r) Complexed With Imidazo[1,5-A]quinoxaline Length = 267 Back     alignment and structure
>pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 Back     alignment and structure
>pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 Back     alignment and structure
>pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 Back     alignment and structure
>pdb|3O17|A Chain A, Crystal Structure Of Jnk1-Alpha1 Isoform Length = 370 Back     alignment and structure
>pdb|3O17|A Chain A, Crystal Structure Of Jnk1-Alpha1 Isoform Length = 370 Back     alignment and structure
>pdb|2WEL|A Chain A, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 327 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|3DTC|A Chain A, Crystal Structure Of Mixed-Lineage Kinase Mlk1 Complexed With Compound 16 Length = 271 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|3HNG|A Chain A, Crystal Structure Of Vegfr1 In Complex With N-(4-chlorophenyl)-2- ((pyridin-4-ylmethyl)amino)benzamide Length = 360 Back     alignment and structure
>pdb|3HNG|A Chain A, Crystal Structure Of Vegfr1 In Complex With N-(4-chlorophenyl)-2- ((pyridin-4-ylmethyl)amino)benzamide Length = 360 Back     alignment and structure
>pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 Back     alignment and structure
>pdb|4H36|A Chain A, Crystal Structure Of Jnk3 In Complex With Atf2 Peptide Length = 356 Back     alignment and structure
>pdb|2XS0|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 386 Back     alignment and structure
>pdb|2B1P|A Chain A, Inhibitor Complex Of Jnk3 Length = 355 Back     alignment and structure
>pdb|3PTG|A Chain A, Design And Synthesis Of A Novel, Orally Efficacious Tri-Substituted Thiophene Based Jnk Inhibitor Length = 363 Back     alignment and structure
>pdb|2EXC|X Chain X, Inhibitor Complex Of Jnk3 Length = 356 Back     alignment and structure
>pdb|3ELJ|A Chain A, Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine Inhibitor Length = 369 Back     alignment and structure
>pdb|2OK1|A Chain A, Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3- Chlorophenyl)-1h-Pyrazol-3-Yl)-1h-Pyrrole-2-Carboxamide Length = 365 Back     alignment and structure
>pdb|1PMN|A Chain A, Crystal Structure Of Jnk3 In Complex With An Imidazole- Pyrimidine Inhibitor Length = 364 Back     alignment and structure
>pdb|3OXI|A Chain A, Design And Synthesis Of Disubstituted Thiophene And Thiazole Based Inhibitors Of Jnk For The Treatment Of Neurodegenerative Diseases Length = 362 Back     alignment and structure
>pdb|2O0U|A Chain A, Crystal Structure Of Human Jnk3 Complexed With N-{3-Cyano-6-[3-(1- Piperidinyl)propanoyl]-4,5,6,7-Tetrahydrothieno[2, 3-C]pyridin-2-Yl}- 1-Naphthalenecarboxamide Length = 364 Back     alignment and structure
>pdb|3PZE|A Chain A, Jnk1 In Complex With Inhibitor Length = 358 Back     alignment and structure
>pdb|1JNK|A Chain A, The C-Jun N-Terminal Kinase (Jnk3s) Complexed With Mgamp-Pnp Length = 423 Back     alignment and structure
>pdb|2X4F|A Chain A, The Crystal Structure Of The Human Myosin Light Chain Kinase Loc340156. Length = 373 Back     alignment and structure
>pdb|2X4F|A Chain A, The Crystal Structure Of The Human Myosin Light Chain Kinase Loc340156. Length = 373 Back     alignment and structure
>pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 Back     alignment and structure
>pdb|3SXR|A Chain A, Crystal Structure Of Bmx Non-Receptor Tyrosine Kinase Complex With Dasatinib Length = 268 Back     alignment and structure
>pdb|3SXR|A Chain A, Crystal Structure Of Bmx Non-Receptor Tyrosine Kinase Complex With Dasatinib Length = 268 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|4F1O|A Chain A, Crystal Structure Of The L1180t Mutant Roco4 Kinase Domain From D. Discoideum Bound To Appcp Length = 287 Back     alignment and structure
>pdb|3TTJ|A Chain A, Crystal Structure Of Jnk3 Complexed With Cc-359, A Jnk Inhibitor For The Prevention Of Ischemia-Reperfusion Injury Length = 464 Back     alignment and structure
>pdb|2WQM|A Chain A, Structure Of Apo Human Nek7 Length = 310 Back     alignment and structure
>pdb|3P23|A Chain A, Crystal Structure Of The Human Kinase And Rnase Domains In Complex With Adp Length = 432 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|3TAC|A Chain A, Crystal Structure Of The Liprin-AlphaCASK COMPLEX Length = 361 Back     alignment and structure
>pdb|1JPA|A Chain A, Crystal Structure Of Unphosphorylated Ephb2 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 312 Back     alignment and structure
>pdb|4F0F|A Chain A, Crystal Structure Of The Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|2BIL|B Chain B, The Human Protein Kinase Pim1 In Complex With Its Consensus Peptide Pimtide Length = 313 Back     alignment and structure
>pdb|2BIY|A Chain A, Structure Of Pdk1-S241a Mutant Kinase Domain Length = 310 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|3C0G|A Chain A, Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Length = 351 Back     alignment and structure
>pdb|3JPV|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Pyrrolo[2,3- A]carbazole Ligand Length = 313 Back     alignment and structure
>pdb|2XRW|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 371 Back     alignment and structure
>pdb|3CXW|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Beta Carboline Ligand I Length = 314 Back     alignment and structure
>pdb|2J2I|B Chain B, Crystal Structure Of The Humab Pim1 In Complex With Ly333531 Length = 312 Back     alignment and structure
>pdb|1UKH|A Chain A, Structural Basis For The Selective Inhibition Of Jnk1 By The Scaffolding Protein Jip1 And Sp600125 Length = 369 Back     alignment and structure
>pdb|4ALV|A Chain A, Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 328 Back     alignment and structure
>pdb|2R9S|A Chain A, C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Quinoline Inhibitor Length = 356 Back     alignment and structure
>pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 Back     alignment and structure
>pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 Back     alignment and structure
>pdb|3QC9|A Chain A, Crystal Structure Of Cross-Linked Bovine Grk1 T8cN480C DOUBLE MUTANT Complexed With Adp And Mg Length = 543 Back     alignment and structure
>pdb|3QC9|A Chain A, Crystal Structure Of Cross-Linked Bovine Grk1 T8cN480C DOUBLE MUTANT Complexed With Adp And Mg Length = 543 Back     alignment and structure
>pdb|3KVX|A Chain A, Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Length = 364 Back     alignment and structure
>pdb|4AW5|A Chain A, Complex Of The Ephb4 Kinase Domain With An Oxindole Inhibitor Length = 291 Back     alignment and structure
>pdb|4AW5|A Chain A, Complex Of The Ephb4 Kinase Domain With An Oxindole Inhibitor Length = 291 Back     alignment and structure
>pdb|2ZV2|A Chain A, Crystal Structure Of Human CalciumCALMODULIN-Dependent Protein Kinase Kinase 2, Beta, Camkk2 Kinase Domain In Complex With Sto-609 Length = 298 Back     alignment and structure
>pdb|2ZV2|A Chain A, Crystal Structure Of Human CalciumCALMODULIN-Dependent Protein Kinase Kinase 2, Beta, Camkk2 Kinase Domain In Complex With Sto-609 Length = 298 Back     alignment and structure
>pdb|1XWS|A Chain A, Crystal Structure Of The Human Pim1 Kinase Domain Length = 313 Back     alignment and structure
>pdb|3C4X|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.9a Length = 543 Back     alignment and structure
>pdb|3C4X|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.9a Length = 543 Back     alignment and structure
>pdb|3C4W|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.7a Length = 543 Back     alignment and structure
>pdb|3C4W|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.7a Length = 543 Back     alignment and structure
>pdb|3NUS|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fragment8 Length = 286 Back     alignment and structure
>pdb|3NAX|A Chain A, Pdk1 In Complex With Inhibitor Mp7 Length = 311 Back     alignment and structure
>pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 Back     alignment and structure
>pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 Back     alignment and structure
>pdb|3FI3|A Chain A, Crystal Structure Of Jnk3 With Indazole Inhibitor, Sr-3737 Length = 364 Back     alignment and structure
>pdb|1Z5M|A Chain A, Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrrolidinylcarbonyl) Amino]phenyl]amino]-4-pyrimidinyl]amino]propyl]-2,2- Dimethylpropanediamide Complexed With Human Pdk1 Length = 286 Back     alignment and structure
>pdb|3NAY|A Chain A, Pdk1 In Complex With Inhibitor Mp6 Length = 311 Back     alignment and structure
>pdb|3T8O|A Chain A, Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolution Length = 543 Back     alignment and structure
>pdb|3T8O|A Chain A, Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolution Length = 543 Back     alignment and structure
>pdb|1H1W|A Chain A, High Resolution Crystal Structure Of The Human Pdk1 Catalytic Domain Length = 289 Back     alignment and structure
>pdb|1UU9|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Bim-3 Length = 286 Back     alignment and structure
>pdb|3NUN|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lead Compound Length = 292 Back     alignment and structure
>pdb|4ALU|A Chain A, Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 328 Back     alignment and structure
>pdb|3HRC|A Chain A, Crystal Structure Of A Mutant Of Human Pdk1 Kinase Domain In Complex With Atp Length = 311 Back     alignment and structure
>pdb|1KOA|A Chain A, Twitchin Kinase Fragment (C.Elegans), Autoregulated Protein Kinase And Immunoglobulin Domains Length = 491 Back     alignment and structure
>pdb|1KOA|A Chain A, Twitchin Kinase Fragment (C.Elegans), Autoregulated Protein Kinase And Immunoglobulin Domains Length = 491 Back     alignment and structure
>pdb|3CY3|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And The Jnk Inhibitor V Length = 314 Back     alignment and structure
>pdb|2QON|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742a Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QON|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742a Triple Mutant Length = 373 Back     alignment and structure
>pdb|4A07|A Chain A, Human Pdk1 Kinase Domain In Complex With Allosteric Activator Ps171 Bound To The Pif-Pocket Length = 311 Back     alignment and structure
>pdb|3FI2|A Chain A, Crystal Structure Of Jnk3 With Amino-Pyrazole Inhibitor, Sr- 3451 Length = 353 Back     alignment and structure
>pdb|3ORX|A Chain A, Pdk1 Mutant Bound To Allosteric Disulfide Fragment Inhibitor 1f8 Length = 316 Back     alignment and structure
>pdb|2RKU|A Chain A, Structure Of Plk1 In Complex With Bi2536 Length = 294 Back     alignment and structure
>pdb|2BIK|B Chain B, Human Pim1 Phosphorylated On Ser261 Length = 313 Back     alignment and structure
>pdb|3RWP|A Chain A, Discovery Of A Novel, Potent And Selective Inhibitor Of 3- Phosphoinositide Dependent Kinase (Pdk1) Length = 311 Back     alignment and structure
>pdb|3MA3|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Naphtho-Difuran Ligand Length = 313 Back     alignment and structure
>pdb|3DCV|A Chain A, Crystal Structure Of Human Pim1 Kinase Complexed With 4-(4- Hydroxy-3-Methyl-Phenyl)-6-Phenylpyrimidin-2(1h)-One Length = 328 Back     alignment and structure
>pdb|4FR4|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase 32a (Yank1) Length = 384 Back     alignment and structure
>pdb|4FR4|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase 32a (Yank1) Length = 384 Back     alignment and structure
>pdb|2R7B|A Chain A, Crystal Structure Of The Phosphoinositide-Dependent Kinase- 1 (Pdk-1)catalytic Domain Bound To A Dibenzonaphthyridine Inhibitor Length = 312 Back     alignment and structure
>pdb|3SC1|A Chain A, Novel Isoquinolone Pdk1 Inhibitors Discovered Through Fragment-Based Lead Discovery Length = 311 Back     alignment and structure
>pdb|1KOB|A Chain A, Twitchin Kinase Fragment (Aplysia), Autoregulated Protein Kinase Domain Length = 387 Back     alignment and structure
>pdb|4EQM|A Chain A, Structural Analysis Of Staphylococcus Aureus SerineTHREONINE KINASE Pknb Length = 294 Back     alignment and structure
>pdb|2XCK|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|1UU3|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Ly333531 Length = 310 Back     alignment and structure
>pdb|3IS5|A Chain A, Crystal Structure Of Cdpk Kinase Domain From Toxoplasma Gondii, Tgme49_018720 Length = 285 Back     alignment and structure
>pdb|3H9O|A Chain A, Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) In Complex With Compound 9 Length = 311 Back     alignment and structure
>pdb|2XCH|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|3IOP|A Chain A, Pdk-1 In Complex With The Inhibitor Compound-8i Length = 312 Back     alignment and structure
>pdb|2VZ6|A Chain A, Structure Of Human Calcium Calmodulin Dependent Protein Kinase Type Ii Alpha (Camk2a) In Complex With Indirubin E804 Length = 313 Back     alignment and structure
>pdb|2OBJ|A Chain A, Crystal Structure Of Human Pim-1 Kinase In Complex With Inhibitor Length = 333 Back     alignment and structure
>pdb|3VUD|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 Back     alignment and structure
>pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 Back     alignment and structure
>pdb|2V5Q|A Chain A, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 315 Back     alignment and structure
>pdb|2YAC|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With Nms-P937 Length = 311 Back     alignment and structure
>pdb|3KB7|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 311 Back     alignment and structure
>pdb|3THB|A Chain A, Structure Of Plk1 Kinase Domain In Complex With A Benzolactam-Derived Inhibitor Length = 333 Back     alignment and structure
>pdb|2OU7|A Chain A, Structure Of The Catalytic Domain Of Human Polo-Like Kinase 1 Length = 335 Back     alignment and structure
>pdb|3PWY|A Chain A, Crystal Structure Of An Extender (Spd28345)-Modified Human Pdk1 Complex 2 Length = 311 Back     alignment and structure
>pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 Back     alignment and structure
>pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 Back     alignment and structure
>pdb|3FV8|A Chain A, Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Length = 355 Back     alignment and structure
>pdb|1XJD|A Chain A, Crystal Structure Of Pkc-Theta Complexed With Staurosporine At 2a Resolution Length = 345 Back     alignment and structure
>pdb|3FXX|A Chain A, Human Epha3 Kinase And Juxtamembrane Region Bound To Substrate Kqwdnye[ptyr]iw Length = 371 Back     alignment and structure
>pdb|2RIO|A Chain A, Structure Of The Dual Enzyme Ire1 Reveals The Basis For Catalysis And Regulation Of Non-conventional Splicing Length = 434 Back     alignment and structure
>pdb|3VUG|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3DZQ|A Chain A, Human Epha3 Kinase Domain In Complex With Inhibitor Awl-Ii- 38.3 Length = 361 Back     alignment and structure
>pdb|2QOC|A Chain A, Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp Bound Structure Length = 344 Back     alignment and structure
>pdb|2QOC|A Chain A, Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp Bound Structure Length = 344 Back     alignment and structure
>pdb|3GBZ|A Chain A, Structure Of The Cmgc Cdk Kinase From Giardia Lamblia Length = 329 Back     alignment and structure
>pdb|3GBZ|A Chain A, Structure Of The Cmgc Cdk Kinase From Giardia Lamblia Length = 329 Back     alignment and structure
>pdb|2QOI|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f Double Mutant Length = 373 Back     alignment and structure
>pdb|2QOF|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f Mutant Length = 373 Back     alignment and structure
>pdb|2QOD|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y602f Mutant Length = 373 Back     alignment and structure
>pdb|2QOO|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742f Triple Mutant Length = 373 Back     alignment and structure
>pdb|2GSF|A Chain A, The Human Epha3 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 373 Back     alignment and structure
>pdb|2QOB|A Chain A, Human Epha3 Kinase Domain, Base Structure Length = 344 Back     alignment and structure
>pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 Back     alignment and structure
>pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 Back     alignment and structure
>pdb|2QO7|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Dephosphorylated, Amp-Pnp Bound Length = 373 Back     alignment and structure
>pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 Back     alignment and structure
>pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 Back     alignment and structure
>pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 Back     alignment and structure
>pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 Back     alignment and structure
>pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 Back     alignment and structure
>pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 Back     alignment and structure
>pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 Back     alignment and structure
>pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 Back     alignment and structure
>pdb|4IC7|A Chain A, Crystal Structure Of The Erk5 Kinase Domain In Complex With An Mkk5 Binding Fragment Length = 442 Back     alignment and structure
>pdb|4IC7|A Chain A, Crystal Structure Of The Erk5 Kinase Domain In Complex With An Mkk5 Binding Fragment Length = 442 Back     alignment and structure
>pdb|1MQB|A Chain A, Crystal Structure Of Ephrin A2 (Epha2) Receptor Protein Kinase Length = 333 Back     alignment and structure
>pdb|1MQB|A Chain A, Crystal Structure Of Ephrin A2 (Epha2) Receptor Protein Kinase Length = 333 Back     alignment and structure
>pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 Back     alignment and structure
>pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 Back     alignment and structure
>pdb|3KUL|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|2GPH|A Chain A, Docking Motif Interactions In The Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|2GPH|A Chain A, Docking Motif Interactions In The Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 Back     alignment and structure
>pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 Back     alignment and structure
>pdb|4AS0|A Chain A, Cyclometalated Phthalimides As Protein Kinase Inhibitors Length = 273 Back     alignment and structure
>pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 Back     alignment and structure
>pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 Back     alignment and structure
>pdb|3MN3|A Chain A, An Inhibited Conformation For The Protein Kinase Domain Of The Saccharomyces Cerevisiae Ampk Homolog Snf1 Length = 271 Back     alignment and structure
>pdb|3MN3|A Chain A, An Inhibited Conformation For The Protein Kinase Domain Of The Saccharomyces Cerevisiae Ampk Homolog Snf1 Length = 271 Back     alignment and structure
>pdb|4B99|A Chain A, Crystal Structure Of Mapk7 (Erk5) With Inhibitor Length = 398 Back     alignment and structure
>pdb|4B99|A Chain A, Crystal Structure Of Mapk7 (Erk5) With Inhibitor Length = 398 Back     alignment and structure
>pdb|1YWV|A Chain A, Crystal Structures Of Proto-Oncogene Kinase Pim1: A Target Of Aberrant Somatic Hypermutations In Diffuse Large Cell Lymphoma Length = 293 Back     alignment and structure
>pdb|1YXS|A Chain A, Crystal Structure Of Kinase Pim1 With P123m Mutation Length = 293 Back     alignment and structure
>pdb|4DTK|A Chain A, Novel And Selective Pan-Pim Kinase Inhibitor Length = 276 Back     alignment and structure
>pdb|3R00|A Chain A, The Discovery Of Novel Benzofuran-2-Carboxylic Acids As Potent Pim-1 Inhibitors Length = 299 Back     alignment and structure
>pdb|2XJ0|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-4 From Crystallographic Fragment Screen Length = 301 Back     alignment and structure
>pdb|3JXW|A Chain A, Discovery Of 3h-Benzo[4,5]thieno[3,2-D]pyrimidin-4-Ones As Potent, Highly Selective And Orally Bioavailable Pim Kinases Inhibitors Length = 294 Back     alignment and structure
>pdb|3C4E|A Chain A, Pim-1 Kinase Domain In Complex With 3-Aminophenyl-7- Azaindole Length = 273 Back     alignment and structure
>pdb|2QOK|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:s768a Triple Mutant Length = 373 Back     alignment and structure
>pdb|4F1M|A Chain A, Crystal Structure Of The G1179s Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|3D5V|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain. Length = 317 Back     alignment and structure
>pdb|3BKB|A Chain A, Crystal Structure Of Human Feline Sarcoma Viral Oncogene Homologue (V- Fes) Length = 377 Back     alignment and structure
>pdb|3A99|A Chain A, Structure Of Pim-1 Kinase Crystallized In The Presence Of P27kip1 Carboxy-Terminal Peptide Length = 320 Back     alignment and structure
>pdb|1YHS|A Chain A, Crystal Structure Of Pim-1 Bound To Staurosporine Length = 273 Back     alignment and structure
>pdb|2FH9|A Chain A, Structure And Dimerization Of The Kinase Domain From Yeast Snf1 Length = 274 Back     alignment and structure
>pdb|2FH9|A Chain A, Structure And Dimerization Of The Kinase Domain From Yeast Snf1 Length = 274 Back     alignment and structure
>pdb|3DB6|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Compound 902 Length = 301 Back     alignment and structure
>pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 Back     alignment and structure
>pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 Back     alignment and structure
>pdb|3UIX|A Chain A, Crystal Structure Of Pim1 Kinase In Complex With Small Molecule Inhibitor Length = 298 Back     alignment and structure
>pdb|1XQZ|A Chain A, Crystal Structure Of Hpim-1 Kinase At 2.1 A Resolution Length = 300 Back     alignment and structure
>pdb|3QC4|A Chain A, Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 314 Back     alignment and structure
>pdb|3DAE|A Chain A, Crystal Structure Of Phosphorylated Snf1 Kinase Domain Length = 283 Back     alignment and structure
>pdb|3DAE|A Chain A, Crystal Structure Of Phosphorylated Snf1 Kinase Domain Length = 283 Back     alignment and structure
>pdb|1YVJ|A Chain A, Crystal Structure Of The Jak3 Kinase Domain In Complex With A Staurosporine Analogue Length = 290 Back     alignment and structure
>pdb|1YVJ|A Chain A, Crystal Structure Of The Jak3 Kinase Domain In Complex With A Staurosporine Analogue Length = 290 Back     alignment and structure
>pdb|2IWI|A Chain A, Crystal Structure Of The Human Pim2 In Complex With A Ruthenium Organometallic Ligand Ru1 Length = 312 Back     alignment and structure
>pdb|2XIK|A Chain A, Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1) Length = 294 Back     alignment and structure
>pdb|2QOL|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596:y602:s768g Triple Mutant Length = 373 Back     alignment and structure
>pdb|3SOA|A Chain A, Full-Length Human Camkii Length = 444 Back     alignment and structure
>pdb|3NUP|A Chain A, Cdk6 (Monomeric) In Complex With Inhibitor Length = 307 Back     alignment and structure
>pdb|3NUP|A Chain A, Cdk6 (Monomeric) In Complex With Inhibitor Length = 307 Back     alignment and structure
>pdb|3KUL|B Chain B, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|2C30|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 6 Length = 321 Back     alignment and structure
>pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 Back     alignment and structure
>pdb|1GZK|A Chain A, Molecular Mechanism For The Regulation Of Protein Kinase B Akt By Hydrophobic Motif Phosphorylation Length = 315 Back     alignment and structure
>pdb|3D5U|A Chain A, Crystal Structure Of A Wildtype Polo-Like Kinase 1 (Plk1) Catalytic Domain Length = 317 Back     alignment and structure
>pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 Back     alignment and structure
>pdb|3D5W|A Chain A, Crystal Structure Of A Phosphorylated Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Adp Length = 317 Back     alignment and structure
>pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 Back     alignment and structure
>pdb|2HEN|A Chain A, Crystal Structure Of The Ephb2 Receptor Kinase Domain In Complex With Adp Length = 286 Back     alignment and structure
>pdb|3VUM|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M7 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3LJ0|A Chain A, Ire1 Complexed With Adp And Quercetin Length = 434 Back     alignment and structure
>pdb|3CD3|A Chain A, Crystal Structure Of Phosphorylated Human Feline Sarcoma Viral Oncogene Homologue (V-Fes) In Complex With Staurosporine And A Consensus Peptide Length = 377 Back     alignment and structure
>pdb|3GGF|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase Mst4 In Complex With An Quinazolin Length = 301 Back     alignment and structure
>pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 Back     alignment and structure
>pdb|1O6L|A Chain A, Crystal Structure Of An Activated Akt/protein Kinase B (pkb-pif Chimera) Ternary Complex With Amp-pnp And Gsk3 Peptide Length = 337 Back     alignment and structure
>pdb|4AF3|A Chain A, Human Aurora B Kinase In Complex With Incenp And Vx-680 Length = 292 Back     alignment and structure
>pdb|2XIY|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-2 From Crystallographic Fragment Screen Length = 301 Back     alignment and structure
>pdb|4A7C|A Chain A, Crystal Structure Of Pim1 Kinase With Etp46546 Length = 308 Back     alignment and structure
>pdb|3VUL|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|2J7T|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Su11274 Length = 302 Back     alignment and structure
>pdb|2J7T|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Su11274 Length = 302 Back     alignment and structure
>pdb|1JOW|B Chain B, Crystal Structure Of A Complex Of Human Cdk6 And A Viral Cyclin Length = 308 Back     alignment and structure
>pdb|1JOW|B Chain B, Crystal Structure Of A Complex Of Human Cdk6 And A Viral Cyclin Length = 308 Back     alignment and structure
>pdb|2JDO|A Chain A, Structure Of Pkb-Beta (Akt2) Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 342 Back     alignment and structure
>pdb|4BC6|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Novel Bosutinib Isoform 1, Previously Thought To Be Bosutinib Length = 293 Back     alignment and structure
>pdb|4BC6|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Novel Bosutinib Isoform 1, Previously Thought To Be Bosutinib Length = 293 Back     alignment and structure
>pdb|2WD1|A Chain A, Human C-Met Kinase In Complex With Azaindole Inhibitor Length = 292 Back     alignment and structure
>pdb|2WD1|A Chain A, Human C-Met Kinase In Complex With Azaindole Inhibitor Length = 292 Back     alignment and structure
>pdb|1BI8|A Chain A, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 326 Back     alignment and structure
>pdb|1BI8|A Chain A, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 326 Back     alignment and structure
>pdb|3F2A|A Chain A, Crystal Structure Of Human Pim-1 In Complex With Dappa Length = 300 Back     alignment and structure
>pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 Back     alignment and structure
>pdb|3LPB|A Chain A, Crystal Structure Of Jak2 Complexed With A Potent 2,8-Diaryl Quinoxaline Inhibitor Length = 295 Back     alignment and structure
>pdb|3LPB|A Chain A, Crystal Structure Of Jak2 Complexed With A Potent 2,8-Diaryl Quinoxaline Inhibitor Length = 295 Back     alignment and structure
>pdb|3VUK|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M5 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3RVG|A Chain A, Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido[4,3-B]indol-4- Carboxamide Inhibitor Length = 303 Back     alignment and structure
>pdb|3RVG|A Chain A, Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido[4,3-B]indol-4- Carboxamide Inhibitor Length = 303 Back     alignment and structure
>pdb|2AC5|A Chain A, Structure Of Human Mnk2 Kinase Domain Mutant D228g Length = 316 Back     alignment and structure
>pdb|2W1I|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 326 Back     alignment and structure
>pdb|2W1I|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 326 Back     alignment and structure
>pdb|3VUH|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M3 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3PJC|A Chain A, Crystal Structure Of Jak3 Complexed With A Potent Atp Site Inhibitor Showing High Selectivity Within The Janus Kinase Family Length = 315 Back     alignment and structure
>pdb|3PJC|A Chain A, Crystal Structure Of Jak3 Complexed With A Potent Atp Site Inhibitor Showing High Selectivity Within The Janus Kinase Family Length = 315 Back     alignment and structure
>pdb|3E62|A Chain A, Fragment Based Discovery Of Jak-2 Inhibitors Length = 293 Back     alignment and structure
>pdb|3E62|A Chain A, Fragment Based Discovery Of Jak-2 Inhibitors Length = 293 Back     alignment and structure
>pdb|3TJC|A Chain A, Co-Crystal Structure Of Jak2 With Thienopyridine 8 Length = 298 Back     alignment and structure
>pdb|3TJC|A Chain A, Co-Crystal Structure Of Jak2 With Thienopyridine 8 Length = 298 Back     alignment and structure
>pdb|4HGE|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 Length = 300 Back     alignment and structure
>pdb|4HGE|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 Length = 300 Back     alignment and structure
>pdb|4AQC|A Chain A, Triazolopyridine-Based Inhibitor Of Janus Kinase 2 Length = 301 Back     alignment and structure
>pdb|4AQC|A Chain A, Triazolopyridine-Based Inhibitor Of Janus Kinase 2 Length = 301 Back     alignment and structure
>pdb|2XA4|A Chain A, Inhibitors Of Jak2 Kinase Domain Length = 298 Back     alignment and structure
>pdb|2XA4|A Chain A, Inhibitors Of Jak2 Kinase Domain Length = 298 Back     alignment and structure
>pdb|3LXK|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 327 Back     alignment and structure
>pdb|3LXK|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 327 Back     alignment and structure
>pdb|3F66|A Chain A, Human C-Met Kinase In Complex With Quinoxaline Inhibitor Length = 298 Back     alignment and structure
>pdb|4GG5|A Chain A, Crystal Structure Of Cmet In Complex With Novel Inhibitor Length = 319 Back     alignment and structure
>pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 Back     alignment and structure
>pdb|2B7A|A Chain A, The Structural Basis Of Janus Kinase 2 Inhibition By A Potent And Specific Pan-Janus Kinase Inhibitor Length = 293 Back     alignment and structure
>pdb|2B7A|A Chain A, The Structural Basis Of Janus Kinase 2 Inhibition By A Potent And Specific Pan-Janus Kinase Inhibitor Length = 293 Back     alignment and structure
>pdb|3I5N|A Chain A, Crystal Structure Of C-Met With Triazolopyridazine Inhibitor 13 Length = 309 Back     alignment and structure
>pdb|3OCB|A Chain A, Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor Length = 341 Back     alignment and structure
>pdb|3Q32|A Chain A, Structure Of Janus Kinase 2 With A Pyrrolotriazine Inhibitor Length = 301 Back     alignment and structure
>pdb|3Q32|A Chain A, Structure Of Janus Kinase 2 With A Pyrrolotriazine Inhibitor Length = 301 Back     alignment and structure
>pdb|4HVD|A Chain A, Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h-pyrrolo[2,3- B]pyrazine-7-carboxylic Acid ((s)-1,2,2-trimethyl-propyl)-amide Length = 314 Back     alignment and structure
>pdb|4HVD|A Chain A, Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h-pyrrolo[2,3- B]pyrazine-7-carboxylic Acid ((s)-1,2,2-trimethyl-propyl)-amide Length = 314 Back     alignment and structure
>pdb|4E4M|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|4E4M|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|3H4J|B Chain B, Crystal Structure Of Pombe Ampk Kdaid Fragment Length = 336 Back     alignment and structure
>pdb|4E20|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 290 Back     alignment and structure
>pdb|3JY9|A Chain A, Janus Kinase 2 Inhibitors Length = 311 Back     alignment and structure
>pdb|3JY9|A Chain A, Janus Kinase 2 Inhibitors Length = 311 Back     alignment and structure
>pdb|3LQ8|A Chain A, Structure Of The Kinase Domain Of C-Met Bound To Xl880 (Gsk1 Length = 302 Back     alignment and structure
>pdb|3IO7|A Chain A, 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Selective Inhibitors Of Jak2 Length = 313 Back     alignment and structure
>pdb|3IO7|A Chain A, 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Selective Inhibitors Of Jak2 Length = 313 Back     alignment and structure
>pdb|4E1Z|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 291 Back     alignment and structure
>pdb|2WGJ|A Chain A, X-Ray Structure Of Pf-02341066 Bound To The Kinase Domain Of C-Met Length = 306 Back     alignment and structure
>pdb|3VUI|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3GC8|A Chain A, The Structure Of P38beta C162s In Complex With A Dihydroquinazolinone Length = 370 Back     alignment and structure
>pdb|3GP0|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 11 (p38 Beta) In Complex With Nilotinib Length = 348 Back     alignment and structure
>pdb|3Q6U|A Chain A, Structure Of The Apo Met Receptor Kinase In The Dually-Phosphorylated, Activated State Length = 308 Back     alignment and structure
>pdb|2RFN|A Chain A, X-ray Structure Of C-met With Inhibitor. Length = 310 Back     alignment and structure
>pdb|4E6D|A Chain A, Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex With Compound 7 Length = 298 Back     alignment and structure
>pdb|4E6D|A Chain A, Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex With Compound 7 Length = 298 Back     alignment and structure
>pdb|2PSQ|A Chain A, Crystal Structure Of Unphosphorylated Unactivated Wild Type Fgf Receptor 2 (Fgfr2) Kinase Domain Length = 370 Back     alignment and structure
>pdb|2PSQ|A Chain A, Crystal Structure Of Unphosphorylated Unactivated Wild Type Fgf Receptor 2 (Fgfr2) Kinase Domain Length = 370 Back     alignment and structure
>pdb|3DKG|A Chain A, Sgx Clone 5698a109kfg1h1 Length = 317 Back     alignment and structure
>pdb|1K3A|A Chain A, Structure Of The Insulin-Like Growth Factor 1 Receptor Kinase Length = 299 Back     alignment and structure
>pdb|3LXN|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 318 Back     alignment and structure
>pdb|3LXN|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 318 Back     alignment and structure
>pdb|2G15|A Chain A, Structural Characterization Of Autoinhibited C-Met Kinase Length = 318 Back     alignment and structure
>pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 Back     alignment and structure
>pdb|3A7F|A Chain A, Human Mst3 Kinase Length = 303 Back     alignment and structure
>pdb|3CLY|A Chain A, Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase Domains Trapped In Trans-Phosphorylation Reaction Length = 334 Back     alignment and structure
>pdb|3CLY|A Chain A, Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase Domains Trapped In Trans-Phosphorylation Reaction Length = 334 Back     alignment and structure
>pdb|3B2T|A Chain A, Structure Of Phosphotransferase Length = 311 Back     alignment and structure
>pdb|3B2T|A Chain A, Structure Of Phosphotransferase Length = 311 Back     alignment and structure
>pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 Back     alignment and structure
>pdb|3CKX|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) In Complex With Staurosporine Length = 304 Back     alignment and structure
>pdb|3QFV|A Chain A, Mrck Beta In Complex With Tpca-1 Length = 415 Back     alignment and structure
>pdb|3CKW|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) Length = 304 Back     alignment and structure
>pdb|3C4F|A Chain A, Fgfr Tyrosine Kinase Domain In Complex With 3-(3- Methoxybenzyl)-7-Azaindole Length = 302 Back     alignment and structure
>pdb|3C4F|A Chain A, Fgfr Tyrosine Kinase Domain In Complex With 3-(3- Methoxybenzyl)-7-Azaindole Length = 302 Back     alignment and structure
>pdb|3TKU|A Chain A, Mrck Beta In Complex With Fasudil Length = 433 Back     alignment and structure
>pdb|2PVF|A Chain A, Crystal Structure Of Tyrosine Phosphorylated Activated Fgf Receptor 2 (Fgfr2) Kinase Domain In Complex With Atp Analog And Substrate Peptide Length = 334 Back     alignment and structure
>pdb|2PVF|A Chain A, Crystal Structure Of Tyrosine Phosphorylated Activated Fgf Receptor 2 (Fgfr2) Kinase Domain In Complex With Atp Analog And Substrate Peptide Length = 334 Back     alignment and structure
>pdb|2ZM3|A Chain A, Complex Structure Of Insulin-Like Growth Factor Receptor And Isoquinolinedione Inhibitor Length = 308 Back     alignment and structure
>pdb|3RI1|A Chain A, Crystal Structure Of The Catalytic Domain Of Fgfr2 Kinase In Complex With Arq 069 Length = 313 Back     alignment and structure
>pdb|3RI1|A Chain A, Crystal Structure Of The Catalytic Domain Of Fgfr2 Kinase In Complex With Arq 069 Length = 313 Back     alignment and structure
>pdb|2VWU|A Chain A, Ephb4 Kinase Domain Inhibitor Complex Length = 302 Back     alignment and structure
>pdb|2PZP|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K526e Mutation Responsible For Crouzon Syndrome Length = 324 Back     alignment and structure
>pdb|2PZP|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K526e Mutation Responsible For Crouzon Syndrome Length = 324 Back     alignment and structure
>pdb|1GJO|A Chain A, The Fgfr2 Tyrosine Kinase Domain Length = 316 Back     alignment and structure
>pdb|1GJO|A Chain A, The Fgfr2 Tyrosine Kinase Domain Length = 316 Back     alignment and structure
>pdb|3BHH|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase Iib Isoform 1 (camk2b) Length = 295 Back     alignment and structure
>pdb|4G3G|A Chain A, Crystal Structure Of Murine Nf-kappab Inducing Kinase (nik) V408l Bound To A 2-(aminothiazolyl)phenol (cmp3) Length = 350 Back     alignment and structure
>pdb|4G3G|A Chain A, Crystal Structure Of Murine Nf-kappab Inducing Kinase (nik) V408l Bound To A 2-(aminothiazolyl)phenol (cmp3) Length = 350 Back     alignment and structure
>pdb|4G3F|A Chain A, Crystal Structure Of Murine Nf-kappab Inducing Kinase (nik) Bound To A 2-(aminothiazoly)phenol (cmp2) Length = 336 Back     alignment and structure
>pdb|4G3F|A Chain A, Crystal Structure Of Murine Nf-kappab Inducing Kinase (nik) Bound To A 2-(aminothiazoly)phenol (cmp2) Length = 336 Back     alignment and structure
>pdb|4G3C|A Chain A, Crystal Structure Of Apo Murine Nf-kappab Inducing Kinase (nik) Length = 352 Back     alignment and structure
>pdb|4G3C|A Chain A, Crystal Structure Of Apo Murine Nf-kappab Inducing Kinase (nik) Length = 352 Back     alignment and structure
>pdb|3KL8|A Chain A, Camkiintide Inhibitor Complex Length = 269 Back     alignment and structure
>pdb|1H4L|A Chain A, Structure And Regulation Of The Cdk5-P25(Nck5a) Complex Length = 292 Back     alignment and structure
>pdb|3ZHP|C Chain C, Human Mst3 (stk24) In Complex With Mo25beta Length = 294 Back     alignment and structure
>pdb|2PZR|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K641r Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2PZR|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K641r Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|3E7O|A Chain A, Crystal Structure Of Jnk2 Length = 360 Back     alignment and structure
>pdb|3KN5|A Chain A, Crystal Structure Of The C-Terminal Kinase Domain Of Msk1 In With Amp-Pnp Length = 325 Back     alignment and structure
>pdb|3FHR|A Chain A, High Resolution Crystal Structure Of Mitogen-Activated Protein Kinase-Activated Protein Kinase 3 (Mk3)-Inhibitor Complex Length = 336 Back     alignment and structure
>pdb|3LL6|A Chain A, Crystal Structure Of The Human Cyclin G Associated Kinase (gak) Length = 337 Back     alignment and structure
>pdb|3GQL|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|3GQL|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1751
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 1e-27
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 1e-23
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 1e-12
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 1e-12
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 4e-24
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 7e-23
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 4e-10
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 4e-10
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 8e-24
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 9e-23
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 2e-09
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 2e-09
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 1e-23
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 2e-21
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 4e-08
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 4e-08
2a19_B284 Interferon-induced, double-stranded RNA-activated 1e-22
2a19_B284 Interferon-induced, double-stranded RNA-activated 7e-20
2a19_B284 Interferon-induced, double-stranded RNA-activated 3e-06
2a19_B284 Interferon-induced, double-stranded RNA-activated 3e-06
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 4e-22
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 9e-22
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 2e-05
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 2e-05
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 2e-21
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 2e-21
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 9e-09
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 9e-09
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 8e-21
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 7e-19
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 7e-06
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 7e-06
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 2e-20
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 6e-18
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 4e-06
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 4e-06
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 3e-20
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 5e-20
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 1e-05
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 1e-05
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 5e-20
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 3e-18
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 9e-08
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 9e-08
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 1e-19
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 5e-15
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 3e-19
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 2e-16
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 4e-06
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 4e-06
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 3e-19
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 7e-15
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 6e-05
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 6e-05
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 2e-04
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 2e-04
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 6e-19
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 8e-19
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 1e-06
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 1e-06
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 1e-18
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 9e-17
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 3e-06
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-18
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-07
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 4e-18
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 5e-14
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 5e-18
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 5e-15
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 8e-07
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 8e-07
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 6e-18
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 6e-18
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 3e-06
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 3e-06
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 6e-18
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 4e-15
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 3e-08
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 3e-08
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 9e-18
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 1e-16
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 1e-17
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 3e-15
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 2e-17
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 3e-16
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 4e-17
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 7e-17
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 2e-05
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 2e-05
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 4e-17
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 1e-14
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 5e-06
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 5e-06
3q4u_A301 Activin receptor type-1; structural genomics conso 4e-17
3q4u_A301 Activin receptor type-1; structural genomics conso 3e-14
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 5e-17
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 5e-16
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 9e-17
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 4e-15
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 1e-06
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 1e-06
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 1e-16
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 5e-14
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 1e-05
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 1e-05
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 1e-16
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 1e-16
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 2e-16
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 7e-13
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 2e-16
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 2e-13
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 3e-16
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 2e-15
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 4e-04
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 4e-04
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 4e-16
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 1e-11
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 4e-16
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 2e-13
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 4e-16
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 1e-12
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 5e-16
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 3e-13
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 6e-04
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 6e-04
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 6e-16
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 2e-14
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 2e-04
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 2e-04
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 9e-16
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 5e-14
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 6e-15
3qa8_A676 MGC80376 protein; kinase ubiquitin-like domain, ph 2e-13
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 8e-15
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 1e-12
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 1e-14
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 2e-13
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 1e-04
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 1e-04
3soc_A322 Activin receptor type-2A; structural genomics cons 1e-14
3soc_A322 Activin receptor type-2A; structural genomics cons 4e-12
3ork_A311 Serine/threonine protein kinase; structural genomi 2e-14
3ork_A311 Serine/threonine protein kinase; structural genomi 2e-11
3ork_A311 Serine/threonine protein kinase; structural genomi 3e-06
3ork_A311 Serine/threonine protein kinase; structural genomi 3e-06
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 3e-14
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 4e-11
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 5e-14
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 8e-14
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 5e-05
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 5e-05
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 6e-14
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 1e-08
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 7e-14
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 3e-12
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 7e-14
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 2e-12
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 9e-14
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 3e-12
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 1e-13
3lij_A494 Calcium/calmodulin dependent protein kinase with A 1e-13
3lij_A494 Calcium/calmodulin dependent protein kinase with A 8e-05
3lij_A494 Calcium/calmodulin dependent protein kinase with A 8e-05
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 1e-13
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 3e-12
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 2e-13
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 2e-11
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 2e-13
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 1e-11
3bhy_A283 Death-associated protein kinase 3; death associate 2e-13
3bhy_A283 Death-associated protein kinase 3; death associate 1e-11
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 3e-13
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 4e-13
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 3e-04
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 3e-04
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 3e-13
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 1e-07
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 1e-04
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 1e-04
2y0a_A326 Death-associated protein kinase 1; transferase, ca 3e-13
2y0a_A326 Death-associated protein kinase 1; transferase, ca 1e-11
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 4e-13
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 2e-11
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 6e-13
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 4e-12
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 6e-13
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 8e-11
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 7e-04
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 7e-04
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 7e-13
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 3e-11
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 8e-13
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 2e-09
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 1e-12
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 2e-12
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 1e-12
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 7e-12
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 1e-12
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 2e-10
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 2e-12
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 2e-10
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 2e-12
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 2e-12
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 2e-12
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 3e-10
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 3e-12
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 3e-11
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 3e-12
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 4e-11
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 4e-12
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 9e-10
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 2e-05
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 2e-05
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 4e-12
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 4e-09
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 4e-12
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 7e-11
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 4e-12
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 3e-10
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 1e-04
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 1e-04
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 5e-12
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 4e-11
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 5e-12
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 7e-11
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 5e-12
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 4e-10
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 6e-12
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 2e-11
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 6e-12
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 2e-11
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 7e-12
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 2e-11
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 7e-12
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 5e-11
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 8e-12
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 8e-11
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 8e-12
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 4e-09
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 8e-12
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 8e-12
3dls_A335 PAS domain-containing serine/threonine-protein KI; 9e-12
3dls_A335 PAS domain-containing serine/threonine-protein KI; 5e-11
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 9e-12
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 5e-09
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 9e-12
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 5e-10
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 1e-11
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 5e-11
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 1e-11
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 3e-11
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 1e-11
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 3e-11
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 2e-11
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 2e-08
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 2e-11
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 2e-11
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 2e-11
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 4e-11
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 2e-11
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 5e-09
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 3e-04
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 3e-04
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 2e-11
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 4e-09
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 3e-04
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 3e-04
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 3e-11
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 1e-08
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 3e-11
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 1e-10
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 3e-11
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 1e-08
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 4e-11
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 4e-11
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 4e-11
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 8e-09
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 4e-11
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 8e-11
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 4e-11
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 6e-10
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 4e-05
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 4e-05
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 4e-11
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 8e-11
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 5e-11
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 4e-10
3pvu_A695 Beta-adrenergic receptor kinase 1; transferase, se 5e-11
3pvu_A 695 Beta-adrenergic receptor kinase 1; transferase, se 4e-09
3pvu_A695 Beta-adrenergic receptor kinase 1; transferase, se 9e-04
3pvu_A695 Beta-adrenergic receptor kinase 1; transferase, se 9e-04
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 5e-11
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 4e-10
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 5e-11
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 1e-09
3pls_A298 Macrophage-stimulating protein receptor; protein k 5e-11
3pls_A298 Macrophage-stimulating protein receptor; protein k 4e-10
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 7e-11
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 4e-09
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 7e-11
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 1e-10
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 7e-11
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 3e-09
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 7e-11
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 1e-10
3niz_A311 Rhodanese family protein; structural genomics, str 8e-11
3niz_A311 Rhodanese family protein; structural genomics, str 4e-10
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 8e-11
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 2e-07
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 9e-11
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 9e-10
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 1e-10
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 1e-10
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 1e-10
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 3e-08
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 1e-10
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 3e-10
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 1e-10
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 2e-10
3lzb_A327 Epidermal growth factor receptor; epidermal growth 1e-10
3lzb_A327 Epidermal growth factor receptor; epidermal growth 1e-10
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 2e-10
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 2e-10
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 2e-10
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 2e-08
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 2e-10
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 5e-10
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 2e-10
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 2e-08
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 2e-10
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 2e-10
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 3e-10
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 4e-10
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 3e-10
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 1e-08
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 3e-10
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 4e-08
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 3e-10
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 2e-09
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 3e-10
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 3e-10
3o0g_A292 Cell division protein kinase 5; kinase activator c 3e-10
3o0g_A292 Cell division protein kinase 5; kinase activator c 2e-09
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 4e-10
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 4e-10
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 7e-10
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 4e-09
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 7e-10
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 3e-07
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 8e-10
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 8e-09
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 1e-09
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 5e-09
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 1e-09
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 7e-07
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 1e-09
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 2e-07
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 1e-09
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 2e-09
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 1e-09
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 9e-07
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 1e-09
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 4e-09
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 1e-09
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 1e-09
3poz_A327 Epidermal growth factor receptor; kinase domain, a 2e-09
3poz_A327 Epidermal growth factor receptor; kinase domain, a 2e-09
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 2e-09
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 5e-07
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 2e-09
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 3e-06
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 3e-09
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 2e-06
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 3e-09
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 3e-09
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 3e-09
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 3e-06
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 4e-09
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 4e-06
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 4e-09
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 5e-09
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 6e-09
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 4e-06
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 6e-09
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 7e-08
2xir_A316 Vascular endothelial growth factor receptor 2; ang 6e-09
2xir_A316 Vascular endothelial growth factor receptor 2; ang 6e-07
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 7e-09
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 6e-06
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 8e-09
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 7e-06
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 1e-08
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 3e-06
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 1e-08
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 5e-06
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 1e-08
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 9e-08
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 1e-08
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 4e-07
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 1e-08
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 3e-08
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 2e-08
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 3e-08
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 2e-08
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 6e-07
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 2e-08
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 4e-06
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 2e-08
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 2e-06
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 2e-08
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 3e-07
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 2e-08
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 4e-05
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 2e-08
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 2e-08
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 3e-08
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 1e-07
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 3e-08
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 1e-05
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 4e-08
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 3e-06
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 4e-08
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 2e-06
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 5e-08
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 1e-05
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 6e-08
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 1e-06
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 6e-08
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 2e-06
2dyl_A318 Dual specificity mitogen-activated protein kinase 6e-08
2dyl_A318 Dual specificity mitogen-activated protein kinase 4e-06
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 6e-08
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 2e-05
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 7e-08
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 1e-06
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 8e-08
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 2e-06
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 9e-08
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 4e-06
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 1e-07
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 4e-06
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 1e-07
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 1e-05
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 1e-07
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 1e-05
3eqc_A360 Dual specificity mitogen-activated protein kinase; 1e-07
3eqc_A360 Dual specificity mitogen-activated protein kinase; 6e-05
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 1e-07
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 1e-06
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 1e-07
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 3e-06
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 1e-07
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 7e-06
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 2e-07
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 2e-05
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 2e-07
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 2e-07
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 2e-07
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 3e-06
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 2e-07
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 8e-07
3zzw_A289 Tyrosine-protein kinase transmembrane receptor RO; 2e-07
3zzw_A289 Tyrosine-protein kinase transmembrane receptor RO; 1e-06
4aoj_A329 High affinity nerve growth factor receptor; transf 2e-07
4aoj_A329 High affinity nerve growth factor receptor; transf 3e-07
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 2e-07
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 9e-06
3aln_A327 Dual specificity mitogen-activated protein kinase; 2e-07
3aln_A327 Dual specificity mitogen-activated protein kinase; 3e-06
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 3e-07
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 1e-05
3uqc_A286 Probable conserved transmembrane protein; structur 3e-07
3uqc_A286 Probable conserved transmembrane protein; structur 8e-06
3uqc_A286 Probable conserved transmembrane protein; structur 8e-06
3uqc_A286 Probable conserved transmembrane protein; structur 2e-04
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 3e-07
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 2e-06
3an0_A340 Dual specificity mitogen-activated protein kinase; 3e-07
3an0_A340 Dual specificity mitogen-activated protein kinase; 6e-07
3v5q_A297 NT-3 growth factor receptor; kinase domain, kinase 3e-07
3v5q_A297 NT-3 growth factor receptor; kinase domain, kinase 3e-07
3fme_A290 Dual specificity mitogen-activated protein kinase; 4e-07
3fme_A290 Dual specificity mitogen-activated protein kinase; 2e-06
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 5e-07
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 1e-06
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 5e-07
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 1e-05
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 7e-07
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 1e-06
3rp9_A458 Mitogen-activated protein kinase; structural genom 9e-07
3rp9_A458 Mitogen-activated protein kinase; structural genom 1e-04
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 1e-06
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 1e-05
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 1e-06
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 1e-06
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 1e-06
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 1e-05
2eue_A275 Carbon catabolite derepressing protein kinase; kin 2e-06
2eue_A275 Carbon catabolite derepressing protein kinase; kin 2e-05
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 2e-06
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 2e-05
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 2e-06
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 3e-05
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 2e-06
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 2e-05
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 3e-06
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 3e-06
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 3e-06
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 1e-05
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 3e-06
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 4e-05
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 3e-06
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 4e-06
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 3e-05
2fst_X367 Mitogen-activated protein kinase 14; active mutant 7e-06
2fst_X367 Mitogen-activated protein kinase 14; active mutant 1e-05
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 9e-06
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 2e-04
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 1e-05
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 3e-05
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 1e-05
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 1e-05
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 1e-05
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 7e-05
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 2e-05
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 3e-04
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 2e-05
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 2e-04
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 5e-05
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 1e-04
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 7e-04
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 7e-04
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
 Score =  115 bits (289), Expect = 1e-27
 Identities = 49/354 (13%), Positives = 102/354 (28%), Gaps = 76/354 (21%)

Query: 1318 DIQIGKFIAKGTNAVVYEATFR--GVEYALKMMFNYSAASNSHAILKAMSKELLPLRKPL 1375
             +++ + +  G  +VV+         ++ALK+      A NS + L+ + +      + L
Sbjct: 63   KLKLVEPLRVGDRSVVFLVRDVERLEDFALKVF--TMGAENSRSELERLHEATFAAARLL 120

Query: 1376 RLNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPSALPARLNPTGGYGRNMS 1435
                              +           +PS  D+  +      A+L+P        +
Sbjct: 121  ----------------GESPEEARDRRRLLLPS--DAVAVQSQPPFAQLSPGQDDYAVAN 162

Query: 1436 LFILMKKYNTDLRNYLR------ERCAQLSMHERILLFTQLLEGVTHLNMHRTAHRDLKS 1489
              +LM   + DL                  +    +L  QL+    +L      H     
Sbjct: 163  YLLLMPAASVDLELLFSTLDFVYVFRGDEGILALHILTAQLIRLAANLQSKGLVHGHFTP 222

Query: 1490 DNILLDCSEDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGL 1549
            DN+ +    D    +L++ D  + +   +                V     E   A+   
Sbjct: 223  DNLFIM--PDG---RLMLGDVSALWKVGTRGP--------ASSVPVTYAPREFLNASTAT 269

Query: 1550 FSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYWHRKWLWQHLVYSHSSTTPSTVA 1609
            F+       +AW  G   Y ++    PF           ++                  +
Sbjct: 270  FTH----ALNAWQLGLSIYRVWCLFLPFGLVTPGIKGSWKR-----------------PS 308

Query: 1610 YEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAE 1663
              + G D+  + S                 +P+ ++ L+ + L  D   R    
Sbjct: 309  LRVPGTDSLAFGSCT--------------PLPDFVKTLIGRFLNFDRRRRLLPL 348


>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Length = 355 Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Length = 355 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Length = 336 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Length = 345 Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Length = 345 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1751
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 100.0
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 100.0
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 100.0
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 100.0
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 100.0
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 100.0
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 100.0
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 100.0
4aoj_A329 High affinity nerve growth factor receptor; transf 100.0
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 100.0
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 100.0
4ase_A353 Vascular endothelial growth factor receptor 2; tra 100.0
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 100.0
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 100.0
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 100.0
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 100.0
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 100.0
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 100.0
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 100.0
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 100.0
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
3niz_A311 Rhodanese family protein; structural genomics, str 100.0
3o0g_A292 Cell division protein kinase 5; kinase activator c 100.0
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 100.0
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 100.0
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 100.0
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 100.0
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 100.0
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 100.0
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 100.0
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 100.0
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 100.0
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 100.0
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 100.0
4aoj_A329 High affinity nerve growth factor receptor; transf 100.0
3rp9_A458 Mitogen-activated protein kinase; structural genom 100.0
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 100.0
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 100.0
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 100.0
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 100.0
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 100.0
4ase_A353 Vascular endothelial growth factor receptor 2; tra 100.0
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 100.0
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 100.0
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 100.0
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 100.0
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 100.0
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 100.0
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 100.0
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 100.0
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 100.0
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 100.0
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 100.0
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 100.0
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 100.0
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 100.0
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 100.0
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 100.0
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 100.0
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 100.0
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 100.0
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 100.0
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 100.0
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 100.0
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 100.0
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 100.0
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 100.0
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 100.0
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 100.0
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 100.0
2y0a_A326 Death-associated protein kinase 1; transferase, ca 100.0
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 100.0
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 100.0
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 100.0
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 100.0
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 100.0
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 100.0
3soc_A322 Activin receptor type-2A; structural genomics cons 100.0
3q4u_A301 Activin receptor type-1; structural genomics conso 100.0
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 100.0
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 100.0
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 100.0
2eue_A275 Carbon catabolite derepressing protein kinase; kin 100.0
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 100.0
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 100.0
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 100.0
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 100.0
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 100.0
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 100.0
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 100.0
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 100.0
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 100.0
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 100.0
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 100.0
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 100.0
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 100.0
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 100.0
3fme_A290 Dual specificity mitogen-activated protein kinase; 100.0
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 100.0
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 100.0
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 100.0
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 100.0
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 100.0
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 100.0
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 100.0
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 100.0
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 100.0
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 100.0
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 100.0
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 100.0
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 100.0
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 100.0
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 100.0
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 100.0
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 100.0
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 100.0
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 100.0
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 100.0
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 100.0
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 100.0
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 100.0
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 100.0
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 100.0
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 100.0
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 100.0
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 100.0
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 100.0
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 100.0
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 100.0
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 100.0
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 100.0
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 100.0
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 100.0
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 100.0
2fst_X367 Mitogen-activated protein kinase 14; active mutant 100.0
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 100.0
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 100.0
3dls_A335 PAS domain-containing serine/threonine-protein KI; 100.0
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 100.0
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 100.0
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 100.0
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 100.0
3ork_A311 Serine/threonine protein kinase; structural genomi 100.0
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 100.0
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 100.0
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 100.0
3poz_A327 Epidermal growth factor receptor; kinase domain, a 100.0
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 100.0
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 100.0
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 100.0
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 100.0
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 100.0
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 100.0
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 100.0
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 100.0
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 100.0
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 100.0
3an0_A340 Dual specificity mitogen-activated protein kinase; 100.0
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 100.0
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 100.0
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 100.0
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 100.0
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 100.0
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 100.0
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 100.0
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 100.0
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 100.0
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 100.0
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 100.0
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 100.0
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 100.0
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 100.0
3lzb_A327 Epidermal growth factor receptor; epidermal growth 100.0
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 100.0
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 100.0
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 100.0
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 100.0
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 100.0
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 100.0
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 100.0
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 100.0
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 100.0
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 100.0
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 100.0
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 100.0
3bhy_A283 Death-associated protein kinase 3; death associate 100.0
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 100.0
2xir_A316 Vascular endothelial growth factor receptor 2; ang 100.0
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 100.0
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 100.0
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 100.0
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 100.0
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 100.0
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 100.0
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 100.0
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 100.0
3pls_A298 Macrophage-stimulating protein receptor; protein k 100.0
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 100.0
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 100.0
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 100.0
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 100.0
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 100.0
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 100.0
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 100.0
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 100.0
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 100.0
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 100.0
3eqc_A360 Dual specificity mitogen-activated protein kinase; 100.0
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 100.0
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 100.0
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 100.0
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 100.0
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 100.0
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 100.0
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 100.0
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 100.0
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 100.0
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 100.0
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 100.0
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 100.0
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 100.0
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 100.0
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 100.0
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 100.0
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 100.0
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 100.0
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 100.0
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 100.0
3aln_A327 Dual specificity mitogen-activated protein kinase; 100.0
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 100.0
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 100.0
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 100.0
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 100.0
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 100.0
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 100.0
2dyl_A318 Dual specificity mitogen-activated protein kinase 100.0
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 100.0
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 100.0
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 100.0
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 100.0
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 100.0
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 100.0
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 100.0
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 100.0
2a19_B284 Interferon-induced, double-stranded RNA-activated 100.0
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 100.0
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 100.0
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 100.0
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 100.0
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 100.0
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 100.0
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 100.0
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 100.0
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 100.0
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 100.0
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 100.0
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 100.0
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 100.0
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 100.0
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 100.0
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 100.0
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 100.0
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 100.0
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 100.0
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.98
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 99.98
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.97
3o0g_A292 Cell division protein kinase 5; kinase activator c 99.97
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 99.97
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.97
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.97
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 99.97
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 99.97
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 99.97
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 99.97
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 99.97
3niz_A311 Rhodanese family protein; structural genomics, str 99.97
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 99.97
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.97
3rp9_A458 Mitogen-activated protein kinase; structural genom 99.97
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 99.97
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.97
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 99.97
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 99.97
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.97
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.97
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 99.97
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.97
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 99.97
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.97
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 99.97
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.97
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.97
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.97
2eue_A275 Carbon catabolite derepressing protein kinase; kin 99.97
2y0a_A326 Death-associated protein kinase 1; transferase, ca 99.97
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.97
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 99.97
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 99.97
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.97
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 99.97
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.97
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 99.97
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.97
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.97
3uqc_A286 Probable conserved transmembrane protein; structur 99.97
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 99.97
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.97
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 99.97
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.97
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 99.97
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.97
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 99.97
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.97
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.97
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 99.97
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 99.96
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 99.96
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 99.96
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.96
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.96
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.96
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.96
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 99.96
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.96
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 99.96
3q4u_A301 Activin receptor type-1; structural genomics conso 99.96
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 99.96
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 99.96
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 99.96
3fme_A290 Dual specificity mitogen-activated protein kinase; 99.96
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 99.96
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 99.96
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.96
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 99.96
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 99.96
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 99.96
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.96
3poz_A327 Epidermal growth factor receptor; kinase domain, a 99.96
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 99.96
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 99.96
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.96
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.96
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 99.96
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 99.96
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 99.96
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 99.96
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.96
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.96
3dls_A335 PAS domain-containing serine/threonine-protein KI; 99.96
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 99.96
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 99.96
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.96
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 99.96
3soc_A322 Activin receptor type-2A; structural genomics cons 99.96
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.96
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 99.96
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 99.96
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.96
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.96
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 99.96
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 99.96
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.96
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 99.96
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.96
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 99.96
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.96
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.96
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 99.96
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 99.96
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 99.96
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.96
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.96
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.96
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 99.96
2fst_X367 Mitogen-activated protein kinase 14; active mutant 99.96
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 99.96
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 99.96
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.96
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.96
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 99.96
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 99.96
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 99.96
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 99.96
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 99.96
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 99.96
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.96
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 99.96
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 99.96
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 99.96
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 99.96
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.96
3lzb_A327 Epidermal growth factor receptor; epidermal growth 99.96
3an0_A340 Dual specificity mitogen-activated protein kinase; 99.96
3ork_A311 Serine/threonine protein kinase; structural genomi 99.96
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.96
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.96
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 99.96
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.96
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 99.96
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 99.96
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 99.96
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.96
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 99.96
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 99.96
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 99.96
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 99.96
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.96
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 99.96
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.96
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.96
3eqc_A360 Dual specificity mitogen-activated protein kinase; 99.96
2xir_A316 Vascular endothelial growth factor receptor 2; ang 99.96
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.96
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 99.96
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.96
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.96
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 99.96
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 99.96
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.96
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.96
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 99.96
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.96
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 99.96
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.96
3pls_A298 Macrophage-stimulating protein receptor; protein k 99.96
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 99.95
3bhy_A283 Death-associated protein kinase 3; death associate 99.95
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.95
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 99.95
2dyl_A318 Dual specificity mitogen-activated protein kinase 99.95
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 99.95
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 99.95
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 99.95
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 99.95
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.95
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 99.95
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.95
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.95
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.95
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 99.95
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.95
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.95
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.95
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.95
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 99.95
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.95
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.95
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.95
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 99.95
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.95
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.95
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 99.95
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.95
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.95
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.95
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 99.95
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.95
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.95
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 99.95
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.95
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.95
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.95
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 99.95
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 99.95
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.95
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 99.95
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 99.95
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 99.95
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.95
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.95
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 99.95
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.95
3aln_A327 Dual specificity mitogen-activated protein kinase; 99.95
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.95
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 99.95
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.95
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 99.95
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.95
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.95
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.95
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.95
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 99.94
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 99.93
3qa8_A676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.93
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 99.92
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.92
3uqc_A286 Probable conserved transmembrane protein; structur 99.91
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
Probab=100.00  E-value=2.7e-47  Score=441.93  Aligned_cols=259  Identities=23%  Similarity=0.316  Sum_probs=188.8

Q ss_pred             cCCCeEEeceEeecCceEEEEEEEC--CeeEEEEEEeccccccchHHHHHHHhhhccccccchhhhHHHHHhhhcCCCCC
Q psy3778        1315 KVDDIQIGKFIAKGTNAVVYEATFR--GVEYALKMMFNYSAASNSHAILKAMSKELLPLRKPLRLNEDMLMNSVENLPPH 1392 (1751)
Q Consensus      1315 ~ld~yeig~~IGkGsFG~VYka~~~--G~~VAVKii~~~~~~sn~~~ilk~~~rE~~~l~~~~~~~E~~im~~l~~L~~H 1392 (1751)
                      .+++|++++.||+|+||+||+|.++  |+.||||++.+......  .            ......+|+.+++.+    +|
T Consensus        11 ~ig~Y~i~~~lG~G~fg~V~~~~~~~~~~~vAiK~i~~~~~~~~--~------------~~~~~~~Ei~il~~l----~H   72 (275)
T 3hyh_A           11 HIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKS--D------------MQGRIEREISYLRLL----RH   72 (275)
T ss_dssp             ---CCEEEEEEEC---CCEEEEECTTTCCEEEEEEEECC--------------------CHHHHHHHHHHHHHC----CC
T ss_pred             EeeCeEEEEEEecCcCeEEEEEEECCCCCEEEEEEEeHHHcCCH--H------------HHHHHHHHHHHHHHC----CC
Confidence            4689999999999999999999986  88999999964221110  0            011234578888764    69


Q ss_pred             CceEEEceEeeecCCCCCCCccccCCCCcCccCCCCCCCCCceEEEEeeccCCCHHHHHHHhcCCCCHHHHHHHHHHHHH
Q psy3778        1393 PNVVVMHFAFTDFVPSIPDSSLIYPSALPARLNPTGGYGRNMSLFILMKKYNTDLRNYLRERCAQLSMHERILLFTQLLE 1472 (1751)
Q Consensus      1393 PNIV~L~~vf~D~~p~~~~~~~lY~~~lp~~l~~~gG~~~~~~LflVMe~~~~~L~~~L~~~~~~ls~~~~~~i~~QIa~ 1472 (1751)
                      ||||+++++|.+.                            ..+|+||||++++|.+++.++ ..+++.++..++.||+.
T Consensus        73 pnIv~~~~~~~~~----------------------------~~~~ivmEy~~g~L~~~l~~~-~~l~e~~~~~~~~qi~~  123 (275)
T 3hyh_A           73 PHIIKLYDVIKSK----------------------------DEIIMVIEYAGNELFDYIVQR-DKMSEQEARRFFQQIIS  123 (275)
T ss_dssp             TTBCCEEEEEECS----------------------------SEEEEEEECCCEEHHHHHHHS-CSCCHHHHHHHHHHHHH
T ss_pred             CCCCeEEEEEEEC----------------------------CEEEEEEeCCCCCHHHHHHHc-CCCCHHHHHHHHHHHHH
Confidence            9999999998762                            248999999999999999865 47999999999999999


Q ss_pred             HHHHHhhCCceeccCCCCceEeccCCCCCCCcEEEeeccccccCCCCCcccccccccccccccccccchhhccCCCcccc
Q psy3778        1473 GVTHLNMHRTAHRDLKSDNILLDCSEDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSF 1552 (1751)
Q Consensus      1473 GL~YLHs~gIVHRDLKPeNILLd~~~~~~~~~lKIsDFGlA~~~~~~~~~~~~s~~~~~~GT~~YmAPEvl~~~~~~~~~ 1552 (1751)
                      ||+|||++|||||||||+|||++.+     ..+||+|||+|+......      ...+.+||+.|||||++.+.+.    
T Consensus       124 al~ylH~~~IiHRDiKP~NILl~~~-----~~vkl~DFGla~~~~~~~------~~~~~~GT~~Y~APE~~~~~~y----  188 (275)
T 3hyh_A          124 AVEYCHRHKIVHRDLKPENLLLDEH-----LNVKIADFGLSNIMTDGN------FLKTSCGSPNYAAPEVISGKLY----  188 (275)
T ss_dssp             HHHHHHHTTCCCCCCCTTTEEECTT-----CCEEECCSSCC---------------------CTTSCHHHHSSSSC----
T ss_pred             HHHHHHHCCcccccCChHHeEECCC-----CCEEEeecCCCeecCCCC------ccCCeeECcccCChhhhcCCCC----
Confidence            9999999999999999999999755     369999999997543211      1124689999999999976531    


Q ss_pred             CCCCcccHHHHHHHHHHHHcCCCCCCCCCCCchhhhhhhhhhhhhcccCCCCCccchhhhcCCCCccccccccccccccc
Q psy3778        1553 VNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYWHRKWLWQHLVYSHSSTTPSTVAYEIFGHDNPFYQSARNTDYEVNA 1632 (1751)
Q Consensus      1553 ~~y~ksDVWS~GVILYELLtG~~PF~~~~~~~~~~~~~~l~~~l~~~~~~~tP~~~~~~I~g~~~p~~~~l~~~~~~~~~ 1632 (1751)
                       ...++||||+||++|||++|+.||.+.....       +.+                .           +...      
T Consensus       189 -~~~~~DiwSlGvily~lltg~~PF~~~~~~~-------~~~----------------~-----------i~~~------  227 (275)
T 3hyh_A          189 -AGPEVDVWSCGVILYVMLCRRLPFDDESIPV-------LFK----------------N-----------ISNG------  227 (275)
T ss_dssp             -CCTHHHHHHHHHHHHHHHHSSCSSCCSSHHH-------HHH----------------H-----------HHHT------
T ss_pred             -CCChhhhHHHHHHHHHHHHCCCCCCCCCHHH-------HHH----------------H-----------HHcC------
Confidence             1247999999999999999999997542110       000                1           1111      


Q ss_pred             cCCCCCCccHHHHHHHHHhchhCCCCCCCHHHHHHHHHhhhhcCCCcccCCCC
Q psy3778        1633 LPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYLWAPKHWLYGATP 1685 (1751)
Q Consensus      1633 lP~l~~~vs~e~kdLI~k~L~~DP~kRPTAeeAl~vl~l~l~~~~~Wl~~~~p 1685 (1751)
                      .+.+|..+|+++++||++||+.||++|||++|+++         |+|++...|
T Consensus       228 ~~~~p~~~s~~~~~li~~~L~~dP~~R~s~~eil~---------hpw~k~~~p  271 (275)
T 3hyh_A          228 VYTLPKFLSPGAAGLIKRMLIVNPLNRISIHEIMQ---------DDWFKVDLP  271 (275)
T ss_dssp             CCCCCTTSCHHHHHHHHHHSCSSGGGSCCHHHHHH---------CHHHHTTCC
T ss_pred             CCCCCCCCCHHHHHHHHHHccCChhHCcCHHHHHc---------CcccccCCC
Confidence            12345679999999999999999999999999876         888875544



>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1751
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 2e-28
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 1e-25
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 2e-12
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 2e-12
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 3e-26
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 3e-14
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 7e-06
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 7e-06
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 7e-26
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 1e-22
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 2e-12
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 2e-12
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 6e-25
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 2e-22
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 3e-11
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 3e-11
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 1e-24
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 6e-18
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 1e-06
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 1e-06
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 0.003
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 0.003
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 3e-24
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 8e-23
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 8e-11
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 8e-11
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 3e-23
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 2e-19
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 9e-14
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 9e-14
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 4e-23
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 1e-22
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 3e-12
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 3e-12
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 1e-22
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 1e-21
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 2e-09
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 2e-09
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 4e-22
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 1e-20
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 2e-10
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 2e-10
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 7e-22
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 6e-12
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 7e-04
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 7e-04
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 7e-22
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 1e-20
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 9e-09
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 9e-09
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 2e-21
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 1e-19
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 2e-11
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 2e-11
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 4e-21
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 9e-12
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 5e-21
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 2e-19
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 2e-07
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 2e-07
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 5e-21
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 1e-19
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 2e-08
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 2e-08
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 9e-21
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 6e-20
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 1e-09
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 1e-09
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 2e-20
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 2e-18
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 6e-10
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 6e-10
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 2e-20
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 2e-13
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 3e-06
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 3e-06
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 2e-20
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 2e-12
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 0.003
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 0.003
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 3e-20
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 3e-19
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 1e-08
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 1e-08
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 3e-20
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 2e-18
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 3e-09
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 3e-09
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 3e-20
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 7e-20
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 8e-09
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 8e-09
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 3e-20
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 6e-19
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 9e-11
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 9e-11
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 5e-20
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 8e-19
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 2e-09
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 2e-09
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 6e-20
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 8e-19
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 6e-05
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 6e-05
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 2e-19
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 3e-18
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 2e-07
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 2e-07
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 3e-19
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 4e-18
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 2e-06
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 2e-06
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 3e-19
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 2e-16
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 3e-09
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 3e-09
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 3e-19
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 4e-18
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 1e-08
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 1e-08
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 4e-19
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 5e-16
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 1e-11
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 1e-11
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 5e-19
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 1e-12
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 8e-05
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 8e-05
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 6e-19
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 1e-17
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 5e-09
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 5e-09
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 6e-19
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 8e-17
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 3e-09
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 3e-09
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 7e-19
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 9e-19
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 3e-09
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 3e-09
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 8e-19
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 2e-16
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 5e-08
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 5e-08
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 1e-18
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 3e-11
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 2e-04
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 2e-04
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 1e-18
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 7e-17
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 1e-08
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 1e-08
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 2e-18
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 1e-17
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 2e-08
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 2e-08
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 2e-18
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 3e-12
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 2e-05
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 2e-05
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 3e-18
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 6e-16
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 3e-09
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 3e-09
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 5e-18
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 8e-17
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 1e-08
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 1e-08
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 6e-18
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 1e-15
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 8e-08
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 8e-08
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 9e-18
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 3e-16
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 2e-07
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 2e-07
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 1e-17
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 4e-17
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 5e-07
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 5e-07
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 1e-17
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 3e-17
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 4e-08
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 4e-08
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 1e-17
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 1e-09
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 0.002
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 0.002
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 3e-17
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 5e-15
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 0.002
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 0.002
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 0.002
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 0.002
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 4e-17
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 1e-15
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 7e-08
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 7e-08
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 4e-17
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 2e-11
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 4e-05
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 4e-05
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 5e-17
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 1e-11
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 5e-17
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 2e-15
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 4e-09
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 4e-09
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 2e-16
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 2e-16
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 3e-08
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 3e-08
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 3e-16
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 2e-06
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 3e-16
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 4e-14
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 6e-05
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 6e-05
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 4e-16
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 4e-13
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 5e-09
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 5e-09
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 6e-16
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 4e-15
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 5e-10
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 5e-10
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 1e-15
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 9e-14
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 6e-06
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 6e-06
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 9e-15
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 4e-08
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 3e-14
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 9e-13
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 3e-06
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 3e-06
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 8e-14
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 6e-13
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 3e-06
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 3e-06
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 4e-13
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 5e-06
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 5e-08
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 8e-05
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: B-Raf kinase
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  114 bits (287), Expect = 2e-28
 Identities = 68/350 (19%), Positives = 118/350 (33%), Gaps = 99/350 (28%)

Query: 1317 DDIQIGKFIAKGTNAVVYEATFRGVEYALKMMFNYSAASNSHAILKAMSKELLPLRKPLR 1376
              I +G+ I  G+   VY+  + G + A+KM+       N  A      +          
Sbjct: 8    GQITVGQRIGSGSFGTVYKGKWHG-DVAVKML-------NVTAPTPQQLQAF-------- 51

Query: 1377 LNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPSALPARLNPTGGYGRNMSL 1436
             NE  ++        H N+++                               GY     L
Sbjct: 52   KNEVGVLRKTR----HVNILLFM-----------------------------GYSTAPQL 78

Query: 1437 FILMKKY--NTDLRNYLRERCAQLSMHERILLFTQLLEGVTHLNMHRTAHRDLKSDNILL 1494
             I+  ++   + L ++L     +  M + I +  Q  +G+ +L+     HRDLKS+NI L
Sbjct: 79   AIVT-QWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFL 137

Query: 1495 DCSEDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALAT-PGLFSFV 1553
                      + I DFG +                 L G++  MAPEV        +SF 
Sbjct: 138  HED-----LTVKIGDFGLATVKSRWSGSHQFEQ---LSGSILWMAPEVIRMQDKNPYSF- 188

Query: 1554 NYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYWHRKWLWQHLVYSHSSTTPSTVAYEIF 1613
               +SD +  G V YE+     P+       +  +R  +   +                 
Sbjct: 189  ---QSDVYAFGIVLYELMTGQLPYS------NINNRDQIIFMV----------------- 222

Query: 1614 GHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAE 1663
                          Y    L ++ +N P+ M+RL+A+ L+    +RP   
Sbjct: 223  -----------GRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFP 261


>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1751
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 100.0
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 100.0
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 100.0
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 100.0
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 100.0
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 100.0
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 100.0
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 100.0
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 100.0
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 100.0
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 100.0
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 100.0
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 100.0
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 100.0
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 100.0
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 100.0
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 100.0
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 100.0
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 100.0
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 100.0
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 100.0
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 100.0
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 100.0
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 100.0
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 100.0
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 100.0
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 100.0
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 100.0
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 100.0
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 100.0
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 100.0
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 100.0
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 100.0
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 100.0
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 100.0
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 100.0
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 100.0
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 100.0
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 100.0
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 100.0
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 100.0
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 100.0
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 100.0
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 100.0
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 100.0
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 100.0
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 100.0
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 100.0
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 100.0
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 100.0
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.98
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.98
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.98
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.97
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 99.97
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.97
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.97
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.97
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 99.97
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.97
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.97
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.97
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.71
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.14
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 94.31
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 87.68
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Aurora-related kinase 1 (aurora-2)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=2.8e-45  Score=419.52  Aligned_cols=254  Identities=24%  Similarity=0.375  Sum_probs=196.9

Q ss_pred             ccCCCeEEeceEeecCceEEEEEEEC--CeeEEEEEEeccccccchHHHHHHHhhhccccccchhhhHHHHHhhhcCCCC
Q psy3778        1314 VKVDDIQIGKFIAKGTNAVVYEATFR--GVEYALKMMFNYSAASNSHAILKAMSKELLPLRKPLRLNEDMLMNSVENLPP 1391 (1751)
Q Consensus      1314 ~~ld~yeig~~IGkGsFG~VYka~~~--G~~VAVKii~~~~~~sn~~~ilk~~~rE~~~l~~~~~~~E~~im~~l~~L~~ 1391 (1751)
                      ..+++|++++.||+|+||+||+|+++  |+.||||++.+...           .++   .......+|+.+++.+    +
T Consensus         3 ~~l~dy~i~~~iG~G~fg~Vy~~~~~~~~~~vAiK~i~~~~~-----------~~~---~~~~~~~~E~~il~~l----~   64 (263)
T d2j4za1           3 WALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQL-----------EKA---GVEHQLRREVEIQSHL----R   64 (263)
T ss_dssp             CCGGGEEEEEEEEECSSEEEEEEEETTTCCEEEEEEEEHHHH-----------HHT---TCHHHHHHHHHHHHTC----C
T ss_pred             cchhHeEEEEEEecCCCcEEEEEEECCCCcEEEEEEEchHHc-----------cCh---HHHHHHHHHHHHHHhc----C
Confidence            35789999999999999999999986  78999999853211           000   0111234577777654    7


Q ss_pred             CCceEEEceEeeecCCCCCCCccccCCCCcCccCCCCCCCCCceEEEEeeccC-CCHHHHHHHhcCCCCHHHHHHHHHHH
Q psy3778        1392 HPNVVVMHFAFTDFVPSIPDSSLIYPSALPARLNPTGGYGRNMSLFILMKKYN-TDLRNYLRERCAQLSMHERILLFTQL 1470 (1751)
Q Consensus      1392 HPNIV~L~~vf~D~~p~~~~~~~lY~~~lp~~l~~~gG~~~~~~LflVMe~~~-~~L~~~L~~~~~~ls~~~~~~i~~QI 1470 (1751)
                      |||||+++++|.+.                            ..+|++|||+. ++|.+++... ..+++.++..++.||
T Consensus        65 hpnIv~~~~~~~~~----------------------------~~~~ivmEy~~~g~L~~~l~~~-~~l~e~~~~~i~~qi  115 (263)
T d2j4za1          65 HPNILRLYGYFHDA----------------------------TRVYLILEYAPLGTVYRELQKL-SKFDEQRTATYITEL  115 (263)
T ss_dssp             CTTBCCEEEEEECS----------------------------SEEEEEEECCTTCBHHHHHHHH-SSCCHHHHHHHHHHH
T ss_pred             CCCCCeEEEEEEEC----------------------------CEEEEEEeecCCCcHHHHHhhc-CCCCHHHHHHHHHHH
Confidence            99999999998762                            24799999995 6999999865 479999999999999


Q ss_pred             HHHHHHHhhCCceeccCCCCceEeccCCCCCCCcEEEeeccccccCCCCCcccccccccccccccccccchhhccCCCcc
Q psy3778        1471 LEGVTHLNMHRTAHRDLKSDNILLDCSEDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLF 1550 (1751)
Q Consensus      1471 a~GL~YLHs~gIVHRDLKPeNILLd~~~~~~~~~lKIsDFGlA~~~~~~~~~~~~s~~~~~~GT~~YmAPEvl~~~~~~~ 1550 (1751)
                      ++||+|||++|||||||||+|||++.++     .+||+|||+|+......       ....+||+.|||||++.+.+   
T Consensus       116 ~~al~~lH~~~ivHrDiKp~Nill~~~~-----~~kl~DFG~a~~~~~~~-------~~~~~Gt~~Y~APE~~~~~~---  180 (263)
T d2j4za1         116 ANALSYCHSKRVIHRDIKPENLLLGSAG-----ELKIADFGWSVHAPSSR-------RTTLCGTLDYLPPEMIEGRM---  180 (263)
T ss_dssp             HHHHHHHHHTTCCCCCCCGGGEEECTTS-----CEEECCCCSCSCCCCCC-------CEETTEEGGGCCHHHHTTCC---
T ss_pred             HHHHHHHHHCCeeeeeeccccceecCCC-----CEeecccceeeecCCCc-------ccccCCCCcccCHHHHcCCC---
Confidence            9999999999999999999999997653     69999999997543221       12467999999999997643   


Q ss_pred             ccCCCCcccHHHHHHHHHHHHcCCCCCCCCCCCchhhhhhhhhhhhhcccCCCCCccchhhhcCCCCccccccccccccc
Q psy3778        1551 SFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYWHRKWLWQHLVYSHSSTTPSTVAYEIFGHDNPFYQSARNTDYEV 1630 (1751)
Q Consensus      1551 ~~~~y~ksDVWS~GVILYELLtG~~PF~~~~~~~~~~~~~~l~~~l~~~~~~~tP~~~~~~I~g~~~p~~~~l~~~~~~~ 1630 (1751)
                         ...++||||+||++|||++|+.||.+.....       +                ...+           ....   
T Consensus       181 ---~~~~~DiwSlGvilyell~G~~Pf~~~~~~~-------~----------------~~~i-----------~~~~---  220 (263)
T d2j4za1         181 ---HDEKVDLWSLGVLCYEFLVGKPPFEANTYQE-------T----------------YKRI-----------SRVE---  220 (263)
T ss_dssp             ---CCTTHHHHHHHHHHHHHHHSSCTTCCSSHHH-------H----------------HHHH-----------HTTC---
T ss_pred             ---CCchhhhhhHhHHHHHHhcCCCCCCCCCHHH-------H----------------HHHH-----------HcCC---
Confidence               1247899999999999999999996532111       0                0011           1111   


Q ss_pred             cccCCCCCCccHHHHHHHHHhchhCCCCCCCHHHHHHHHHhhhhcCCCccc
Q psy3778        1631 NALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYLWAPKHWLY 1681 (1751)
Q Consensus      1631 ~~lP~l~~~vs~e~kdLI~k~L~~DP~kRPTAeeAl~vl~l~l~~~~~Wl~ 1681 (1751)
                         +.+|+.+|+++++||.+||+.||++|||++|+++         |+|+.
T Consensus       221 ---~~~p~~~s~~~~~li~~~L~~dp~~R~t~~eil~---------hp~~~  259 (263)
T d2j4za1         221 ---FTFPDFVTEGARDLISRLLKHNPSQRPMLREVLE---------HPWIT  259 (263)
T ss_dssp             ---CCCCTTSCHHHHHHHHHHTCSSGGGSCCHHHHHT---------CHHHH
T ss_pred             ---CCCCccCCHHHHHHHHHHccCCHhHCcCHHHHHc---------CcCcC
Confidence               2345678999999999999999999999999765         77864



>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure