Psyllid ID: psy3963


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MLSRLLEQCALSFDPKSSHYKIERSKESTARITIWREYGVVRSYTMESTYCGFDQGSFKIGTKESMKIVRGLIEFCTRVLKKTPYFYCDFHGHSLKKNIFLYGCSSQESWLSSDKCRVENQVEFRIPR
cHHHHHHHccccccccccccccccccccHHHHHHHHHHcccEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHcccccccccccccccccccccccccc
ccHHHHHHccccccccccEEEEEEcccccHEEEEEHHcccccEEEEEEEcccccccccEccHHHHHHHHHHHHHHHHHHHHcccEEEEEccccccccEEEEEcccccccccccccccccccccccccc
MLSRLLEQCalsfdpksshykierskesTARITIWREYGVVRSYTMestycgfdqgsfkigtkESMKIVRGLIEFCTRVlkktpyfycdfhghslkknIFLYgcssqeswlssdkcrvenqvefripr
mlsrlleqcalsfdpksshykierskestaritiWREYGVVRSYTMESTYcgfdqgsfkigtKESMKIVRGLIEFCTRVLKKTPYFYCDFHGHSLKKNIFLYGCSSQeswlssdkcrvenqvefripr
MLSRLLEQCALSFDPKSSHYKIERSKESTARITIWREYGVVRSYTMESTYCGFDQGSFKIGTKESMKIVRGLIEFCTRVLKKTPYFYCDFHGHSLKKNIFLYGCSSQESWLSSDKCRVENQVEFRIPR
****************************TARITIWREYGVVRSYTMESTYCGFDQGSFKIGTKESMKIVRGLIEFCTRVLKKTPYFYCDFHGHSLKKNIFLYGCSSQESWLSS**C************
MLSRLL*QCALSFDPKSSHYKIERSKESTARITIWREYGVVRSYTMESTYCGFDQGSFKIGTKESMKIVRGLIEFCTRVLKKTPYFYCDFHGHSLKKNIFLYGC*****************VEFRIP*
MLSRLLEQCALSFDPKSSHYKIERSKESTARITIWREYGVVRSYTMESTYCGFDQGSFKIGTKESMKIVRGLIEFCTRVLKKTPYFYCDFHGHSLKKNIFLYGCSSQESWLSSDKCRVENQVEFRIPR
MLSRLLEQCALSFDPKSSHYKIERSKESTARITIWREYGVVRSYTMESTYCGFDQGSFKIGTKESMKIVRGLIEFCTRVLKKTPYFYCDFHGHSLKKNIFLYGCSSQESWLSSDKCRVENQVEF****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSRLLEQCALSFDPKSSHYKIERSKESTARITIWREYGVVRSYTMESTYCGFDQGSFKIGTKESMKIVRGLIEFCTRVLKKTPYFYCDFHGHSLKKNIFLYGCSSQESWLSSDKCRVENQVEFRIPR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query128 2.2.26 [Sep-21-2011]
Q4U2V31153 Cytosolic carboxypeptidas yes N/A 0.601 0.066 0.493 1e-14
A9JRL31226 Cytosolic carboxypeptidas no N/A 0.492 0.051 0.575 4e-14
E1C3P41224 Cytosolic carboxypeptidas yes N/A 0.5 0.052 0.567 1e-13
Q6DD211225 Cytosolic carboxypeptidas N/A N/A 0.492 0.051 0.560 1e-13
Q9UPW51226 Cytosolic carboxypeptidas yes N/A 0.492 0.051 0.545 1e-12
Q641K11218 Cytosolic carboxypeptidas yes N/A 0.492 0.051 0.545 2e-12
Q96MI91066 Cytosolic carboxypeptidas no N/A 0.679 0.081 0.385 2e-12
Q09M05972 Cytosolic carboxypeptidas no N/A 0.453 0.059 0.474 8e-12
O763731015 Cytosolic carboxypeptidas yes N/A 0.562 0.070 0.394 9e-10
E1B9D8 1003 Cytosolic carboxypeptidas no N/A 0.742 0.094 0.320 3e-05
>sp|Q4U2V3|CBPC1_DANRE Cytosolic carboxypeptidase 1 OS=Danio rerio GN=agtpbp1 PE=2 SV=1 Back     alignment and function desciption
 Score = 78.6 bits (192), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 41/83 (49%), Positives = 54/83 (65%), Gaps = 6/83 (7%)

Query: 2    LSRLLEQCALSFDPKSSHYKIERSKESTARITIWREYGVVRSYTMESTYCGFDQGSFK-- 59
            L +LL Q A +F   S  + +ERSKE+TAR+ +WRE GV RSYTMEST CG DQG +K  
Sbjct: 982  LPKLLSQMAPAFSLSSCSFVVERSKEATARVVVWREIGVQRSYTMESTLCGCDQGKYKGL 1041

Query: 60   -IGTKESMKIVRGLIEFCTRVLK 81
             IGT E  ++     +FC  +L+
Sbjct: 1042 QIGTSELEEMGS---QFCLALLR 1061




Metallocarboxypeptidase that mediates deglutamylation of target proteins. Catalyzes the deglutamylation of polyglutamate side chains generated by post-translational polyglutamylation in proteins such as tubulins. Also removes gene-encoded polyglutamates from the carboxy-terminus of target proteins. Acts as a long-chain deglutamylase and specifically shortens long polyglutamate chains, while it is not able to remove the branching point glutamate.
Danio rerio (taxid: 7955)
EC: 3EC: .EC: 4EC: .EC: 1EC: 7EC: .EC: -
>sp|A9JRL3|CBPC1_XENTR Cytosolic carboxypeptidase 1 OS=Xenopus tropicalis GN=agtpbp1 PE=2 SV=1 Back     alignment and function description
>sp|E1C3P4|CBPC1_CHICK Cytosolic carboxypeptidase 1 OS=Gallus gallus GN=AGTPBP1 PE=3 SV=1 Back     alignment and function description
>sp|Q6DD21|CBPC1_XENLA Cytosolic carboxypeptidase 1 OS=Xenopus laevis GN=agtpbp1 PE=2 SV=1 Back     alignment and function description
>sp|Q9UPW5|CBPC1_HUMAN Cytosolic carboxypeptidase 1 OS=Homo sapiens GN=AGTPBP1 PE=1 SV=3 Back     alignment and function description
>sp|Q641K1|CBPC1_MOUSE Cytosolic carboxypeptidase 1 OS=Mus musculus GN=Agtpbp1 PE=1 SV=2 Back     alignment and function description
>sp|Q96MI9|CBPC4_HUMAN Cytosolic carboxypeptidase 4 OS=Homo sapiens GN=AGBL1 PE=2 SV=2 Back     alignment and function description
>sp|Q09M05|CBPC4_MOUSE Cytosolic carboxypeptidase 4 OS=Mus musculus GN=Agbl1 PE=1 SV=2 Back     alignment and function description
>sp|O76373|CBPC1_CAEEL Cytosolic carboxypeptidase 1 OS=Caenorhabditis elegans GN=ccpp-1 PE=2 SV=2 Back     alignment and function description
>sp|E1B9D8|CBPC3_BOVIN Cytosolic carboxypeptidase 3 OS=Bos taurus GN=AGBL3 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query128
242015814 1079 conserved hypothetical protein [Pediculu 0.429 0.050 0.581 6e-14
432873776 1227 PREDICTED: cytosolic carboxypeptidase 1- 0.75 0.078 0.442 3e-13
66773052 1153 cytosolic carboxypeptidase 1 [Danio reri 0.601 0.066 0.493 8e-13
348517278 1234 PREDICTED: cytosolic carboxypeptidase 1- 0.601 0.062 0.481 1e-12
410922808 1218 PREDICTED: cytosolic carboxypeptidase 1- 0.601 0.063 0.481 2e-12
301607534 1053 PREDICTED: cytosolic carboxypeptidase 4- 0.453 0.055 0.525 3e-12
166158244 1226 cytosolic carboxypeptidase 1 [Xenopus (S 0.492 0.051 0.575 3e-12
443695617 1273 hypothetical protein CAPTEDRAFT_228599 [ 0.609 0.061 0.469 4e-12
198427078 1401 PREDICTED: similar to Cytosolic carboxyp 0.492 0.044 0.545 4e-12
328720769 1030 PREDICTED: hypothetical protein LOC10016 0.453 0.056 0.517 6e-12
>gi|242015814|ref|XP_002428542.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212513176|gb|EEB15804.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score = 82.0 bits (201), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 45/55 (81%)

Query: 70  RGLIEFCTRVLKKTPYFYCDFHGHSLKKNIFLYGCSSQESWLSSDKCRVENQVEF 124
           +GL+E+C R+LKK P+ +CDFHGHS KKN+FLYGC++ ESW  SDK ++ + VE+
Sbjct: 898 KGLLEYCCRILKKPPFVFCDFHGHSRKKNVFLYGCANNESWSESDKQQIVSPVEY 952




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|432873776|ref|XP_004072384.1| PREDICTED: cytosolic carboxypeptidase 1-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|66773052|ref|NP_001019616.1| cytosolic carboxypeptidase 1 [Danio rerio] gi|82225635|sp|Q4U2V3.1|CBPC1_DANRE RecName: Full=Cytosolic carboxypeptidase 1; AltName: Full=ATP/GTP-binding protein 1 gi|65335311|gb|AAY42353.1| ATP/GTP binding protein 1 [Danio rerio] Back     alignment and taxonomy information
>gi|348517278|ref|XP_003446161.1| PREDICTED: cytosolic carboxypeptidase 1-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|410922808|ref|XP_003974874.1| PREDICTED: cytosolic carboxypeptidase 1-like [Takifugu rubripes] Back     alignment and taxonomy information
>gi|301607534|ref|XP_002933362.1| PREDICTED: cytosolic carboxypeptidase 4-like, partial [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|166158244|ref|NP_001107308.1| cytosolic carboxypeptidase 1 [Xenopus (Silurana) tropicalis] gi|317374801|sp|A9JRL3.1|CBPC1_XENTR RecName: Full=Cytosolic carboxypeptidase 1; AltName: Full=ATP/GTP-binding protein 1 gi|161611926|gb|AAI55704.1| LOC100135097 protein [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|443695617|gb|ELT96483.1| hypothetical protein CAPTEDRAFT_228599 [Capitella teleta] Back     alignment and taxonomy information
>gi|198427078|ref|XP_002124627.1| PREDICTED: similar to Cytosolic carboxypeptidase 1 (ATP/GTP-binding protein 1) (Nervous system nuclear protein induced by axotomy) [Ciona intestinalis] Back     alignment and taxonomy information
>gi|328720769|ref|XP_001946321.2| PREDICTED: hypothetical protein LOC100169101 [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query128
ZFIN|ZDB-GENE-081104-2671153 agtpbp1 "ATP/GTP binding prote 0.703 0.078 0.453 8.9e-14
UNIPROTKB|A9JRL31226 agtpbp1 "Cytosolic carboxypept 0.601 0.062 0.506 9.6e-14
UNIPROTKB|E1C3P41224 AGTPBP1 "Cytosolic carboxypept 0.609 0.063 0.5 2e-13
UNIPROTKB|Q6DD211225 agtpbp1 "Cytosolic carboxypept 0.601 0.062 0.493 2e-13
UNIPROTKB|F1PL041132 AGTPBP1 "Uncharacterized prote 0.601 0.068 0.481 1e-12
UNIPROTKB|F1MKS61222 F1MKS6 "Uncharacterized protei 0.601 0.063 0.481 1.1e-12
UNIPROTKB|Q9UPW51226 AGTPBP1 "Cytosolic carboxypept 0.601 0.062 0.481 1.1e-12
UNIPROTKB|J9NSE21226 AGTPBP1 "Uncharacterized prote 0.601 0.062 0.481 1.1e-12
UNIPROTKB|F1LR541175 Agtpbp1 "Protein Agtpbp1" [Rat 0.601 0.065 0.481 1.4e-12
MGI|MGI:21594371218 Agtpbp1 "ATP/GTP binding prote 0.601 0.063 0.481 1.4e-12
ZFIN|ZDB-GENE-081104-267 agtpbp1 "ATP/GTP binding protein 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 192 (72.6 bits), Expect = 8.9e-14, P = 8.9e-14
 Identities = 44/97 (45%), Positives = 60/97 (61%)

Query:     2 LSRLLEQCALSFDPKSSHYKIERSKESTARITIWREYGVVRSYTMESTYCGFDQGSFK-- 59
             L +LL Q A +F   S  + +ERSKE+TAR+ +WRE GV RSYTMEST CG DQG +K  
Sbjct:   982 LPKLLSQMAPAFSLSSCSFVVERSKEATARVVVWREIGVQRSYTMESTLCGCDQGKYKGL 1041

Query:    60 -IGTKESMKIVRGLIEFCTRVLKKTPYFY-CDFHGHS 94
              IGT E  ++  G  +FC  +L+   +    + H H+
Sbjct:  1042 QIGTSELEEM--GS-QFCLALLRLRRFTSPLELHNHN 1075


GO:0004181 "metallocarboxypeptidase activity" evidence=IEA;ISS
GO:0006508 "proteolysis" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISS
GO:0007005 "mitochondrion organization" evidence=ISS
GO:0015631 "tubulin binding" evidence=ISS
GO:0035609 "C-terminal protein deglutamylation" evidence=ISS
GO:0021702 "cerebellar Purkinje cell differentiation" evidence=ISS
GO:0021772 "olfactory bulb development" evidence=ISS
GO:0050905 "neuromuscular process" evidence=ISS
GO:0001754 "eye photoreceptor cell differentiation" evidence=ISS
GO:0005829 "cytosol" evidence=ISS
GO:0035610 "protein side chain deglutamylation" evidence=ISS
GO:0016787 "hydrolase activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0008237 "metallopeptidase activity" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0004180 "carboxypeptidase activity" evidence=IEA
GO:0008233 "peptidase activity" evidence=IEA
UNIPROTKB|A9JRL3 agtpbp1 "Cytosolic carboxypeptidase 1" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|E1C3P4 AGTPBP1 "Cytosolic carboxypeptidase 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q6DD21 agtpbp1 "Cytosolic carboxypeptidase 1" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|F1PL04 AGTPBP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MKS6 F1MKS6 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UPW5 AGTPBP1 "Cytosolic carboxypeptidase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9NSE2 AGTPBP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1LR54 Agtpbp1 "Protein Agtpbp1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2159437 Agtpbp1 "ATP/GTP binding protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q641K1CBPC1_MOUSE3, ., 4, ., 1, 7, ., -0.54540.49210.0517yesN/A
E1C3P4CBPC1_CHICK3, ., 4, ., 1, 7, ., -0.56710.50.0522yesN/A
Q9UPW5CBPC1_HUMAN3, ., 4, ., 1, 7, ., -0.54540.49210.0513yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query128
cd06906278 cd06906, M14_Nna1, Peptidase M14-like domain of AT 8e-23
cd06235258 cd06235, M14_Nna1_like_2, Peptidase M14-like domai 7e-13
cd06235258 cd06235, M14_Nna1_like_2, Peptidase M14-like domai 2e-11
cd06907261 cd06907, M14_AGBL2-3_like, Peptidase M14-like doma 2e-11
cd06906278 cd06906, M14_Nna1, Peptidase M14-like domain of AT 8e-11
cd06907261 cd06907, M14_AGBL2-3_like, Peptidase M14-like doma 2e-07
cd03856258 cd03856, M14_Nna1_like, Peptidase M14-like domain 3e-06
cd03856258 cd03856, M14_Nna1_like, Peptidase M14-like domain 6e-06
cd06236308 cd06236, M14_AGBL5_like, Peptidase M14-like domain 0.001
>gnl|CDD|133116 cd06906, M14_Nna1, Peptidase M14-like domain of ATP/GTP binding proteins and cytosolic carboxypeptidases Back     alignment and domain information
 Score = 89.5 bits (222), Expect = 8e-23
 Identities = 37/66 (56%), Positives = 46/66 (69%), Gaps = 3/66 (4%)

Query: 2   LSRLLEQCALSFDPKSSHYKIERSKESTARITIWREYGVVRSYTMESTYCGFDQGSFK-- 59
           L ++L   A +F   S  + +E+SKESTAR+ +WRE GV RSYTMEST CG DQG +K  
Sbjct: 199 LPKILSHIAPAFSMSSCSFVVEKSKESTARVVVWREIGVQRSYTMESTLCGCDQGKYKGL 258

Query: 60  -IGTKE 64
            IGTKE
Sbjct: 259 QIGTKE 264


Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins. The Peptidase M14 family of metallocarboxypeptidases are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. This eukaryotic subgroup includes the mouse Nna1/CCP-1, and -4 proteins, and the human Nna1/AGTPBP-1 protein. Nna1-like proteins are active metallopeptidases that are thought to act on cytosolic proteins such as alpha-tubulin, to remove a C-terminal tyrosine. Nna1 is widely expressed in the developing and adult nervous systems, including cerebellar Purkinje and granule neurons, miral cells of the olfactory bulb and retinal photoreceptors. Nna1 is also induced in axotomized motor neurons. Mutations in Nna1 cause Purkinje cell degeneration (pcd). The Nna1 CP domain is required to prevent the retinal photoreceptor loss and cerebellar ataxia phenotypes of pcd mice, and a functional zinc-binding domain is needed for Nna-1 to support neuron survival in these mice. Nna1-like proteins from the different phyla are highly diverse, but they all contain a unique N-terminal conserved domain right before the CP domain. It has been suggested that this N-terminal domain might act as a folding domain. Length = 278

>gnl|CDD|199859 cd06235, M14_Nna1_like_2, Peptidase M14-like domain of human Nna1/AGTPBP-1, AGBL2 -5, and related proteins Back     alignment and domain information
>gnl|CDD|199859 cd06235, M14_Nna1_like_2, Peptidase M14-like domain of human Nna1/AGTPBP-1, AGBL2 -5, and related proteins Back     alignment and domain information
>gnl|CDD|133117 cd06907, M14_AGBL2-3_like, Peptidase M14-like domain of ATP/GTP binding protein AGBL-2 and AGBL-3, and related proteins Back     alignment and domain information
>gnl|CDD|133116 cd06906, M14_Nna1, Peptidase M14-like domain of ATP/GTP binding proteins and cytosolic carboxypeptidases Back     alignment and domain information
>gnl|CDD|133117 cd06907, M14_AGBL2-3_like, Peptidase M14-like domain of ATP/GTP binding protein AGBL-2 and AGBL-3, and related proteins Back     alignment and domain information
>gnl|CDD|199841 cd03856, M14_Nna1_like, Peptidase M14-like domain of ATP/GTP binding proteins, cytosolic carboxypeptidases and related proteins Back     alignment and domain information
>gnl|CDD|199841 cd03856, M14_Nna1_like, Peptidase M14-like domain of ATP/GTP binding proteins, cytosolic carboxypeptidases and related proteins Back     alignment and domain information
>gnl|CDD|199860 cd06236, M14_AGBL5_like, Peptidase M14-like domain of ATP/GTP binding protein (AGBL)-5 and related proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 128
cd06906278 M14_Nna1 Peptidase M14-like domain of Nna-1 (Nervo 99.92
cd06907261 M14_AGBL2-3_like Peptidase M14-like domain of ATP/ 99.89
cd06236304 M14_AGBL5_like Peptidase M14-like domain of ATP/GT 99.82
cd06235258 M14_Nna1_like_2 Subgroup of the Peptidase M14-like 99.78
cd06908261 M14_AGBL4_like Peptidase M14-like domain of ATP/GT 99.76
KOG3641|consensus650 99.55
KOG3641|consensus650 99.54
cd06906278 M14_Nna1 Peptidase M14-like domain of Nna-1 (Nervo 99.53
cd06907261 M14_AGBL2-3_like Peptidase M14-like domain of ATP/ 99.5
cd06236304 M14_AGBL5_like Peptidase M14-like domain of ATP/GT 99.45
cd03856269 M14_Nna1_like Peptidase M14-like domain of Nna-1 ( 99.37
cd06235258 M14_Nna1_like_2 Subgroup of the Peptidase M14-like 99.33
cd06908261 M14_AGBL4_like Peptidase M14-like domain of ATP/GT 99.28
cd03856269 M14_Nna1_like Peptidase M14-like domain of Nna-1 ( 99.04
cd06234263 M14_Nna1_like_1 A bacterial subgroup of the Peptid 98.27
cd06239231 Peptidase_M14-like_1_2 Peptidase M14-like domain o 94.4
cd00596196 Peptidase_M14_like The M14 family of metallocarbox 92.79
cd06234263 M14_Nna1_like_1 A bacterial subgroup of the Peptid 92.47
PF00246279 Peptidase_M14: Zinc carboxypeptidase This is famil 89.5
cd06237244 M14_Nna1_like_3 A bacterial subgroup of the Peptid 89.18
cd06248304 M14_CPA_CPB_like Peptidase M14 Carboxypeptidase A/ 88.85
smart00631277 Zn_pept Zn_pept. 88.23
cd03860294 M14_CP_A-B_like The Peptidase M14 Carboxypeptidase 83.87
cd06247298 M14_CPO Peptidase M14 carboxypeptidase (CP) O (CPO 82.58
cd03858 374 M14_CP_N-E_like Carboxypeptidase (CP) N/E-like sub 81.81
cd06244268 Peptidase_M14-like_1_7 Peptidase M14-like domain o 81.17
cd06231236 Peptidase_M14-like_4 A functionally uncharacterize 80.43
>cd06906 M14_Nna1 Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins Back     alignment and domain information
Probab=99.92  E-value=5e-26  Score=185.23  Aligned_cols=77  Identities=47%  Similarity=0.717  Sum_probs=73.6

Q ss_pred             ChhhHHhHcCCCccCCCCeecccccccccceEEEeeeecceeeeeeeccccccccCCc---cccchhHHHHHHHHHHHHH
Q psy3963           1 MLSRLLEQCALSFDPKSSHYKIERSKESTARITIWREYGVVRSYTMESTYCGFDQGSF---KIGTKESMKIVRGLIEFCT   77 (128)
Q Consensus         1 ~~P~lls~~~p~Fs~~~C~F~v~k~Ke~TaRV~~~~~~gi~~syTlE~Sf~G~dlg~~---kf~~kdL~pigk~L~e~l~   77 (128)
                      +||+||++++|.|+|++|+|.++|+||+||||++|+++||++|||||+||+|+++|.+   +|+++||++||+.+|+.|.
T Consensus       198 ~fP~ll~~~~~~Fs~~~C~F~~~k~K~gTaRv~~~~~~~i~~syTlE~Sf~G~~~g~~~g~~f~~~~~~~~G~~~c~~l~  277 (278)
T cd06906         198 TLPKILSHIAPAFSMSSCSFVVEKSKESTARVVVWREIGVQRSYTMESTLCGCDQGKYKGLQIGTKELEEMGAKFCVGLL  277 (278)
T ss_pred             HHHHHHHhcCCccchhhCCccCCCCCCCCeeEehhhhcCCceEEEEEEEeccccccCcCceecCHHHHHHHHHHHHHHHh
Confidence            5899999999999999999999999999999999999999999999999999999875   4999999999999999874



The Peptidase M14 family of metallocarboxypeptidases are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. This eukaryotic subgroup includes the mouse Nna1/CCP-1, and -4 proteins, and the human Nna1/AGTPBP-1 protein. Nna1-like proteins are active metallopeptidases that are thought to act on cytosolic proteins such as alpha-tubulin, to remove a C-terminal tyrosine. Nna1 is widely expressed in the developing and adult nervous systems, including cerebellar Purkinje and granule neurons, miral cells of the olfactory bulb and retinal photoreceptors. Nna1 is also induced in axotomized motor neurons. Mutations in Nna

>cd06907 M14_AGBL2-3_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-2, and related proteins Back     alignment and domain information
>cd06236 M14_AGBL5_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-5, and related proteins Back     alignment and domain information
>cd06235 M14_Nna1_like_2 Subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins Back     alignment and domain information
>cd06908 M14_AGBL4_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-4, and related proteins Back     alignment and domain information
>KOG3641|consensus Back     alignment and domain information
>KOG3641|consensus Back     alignment and domain information
>cd06906 M14_Nna1 Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins Back     alignment and domain information
>cd06907 M14_AGBL2-3_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-2, and related proteins Back     alignment and domain information
>cd06236 M14_AGBL5_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-5, and related proteins Back     alignment and domain information
>cd03856 M14_Nna1_like Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins Back     alignment and domain information
>cd06235 M14_Nna1_like_2 Subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins Back     alignment and domain information
>cd06908 M14_AGBL4_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-4, and related proteins Back     alignment and domain information
>cd03856 M14_Nna1_like Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins Back     alignment and domain information
>cd06234 M14_Nna1_like_1 A bacterial subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP)-like proteins Back     alignment and domain information
>cd06239 Peptidase_M14-like_1_2 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd00596 Peptidase_M14_like The M14 family of metallocarboxypeptidases (MCPs) are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity Back     alignment and domain information
>cd06234 M14_Nna1_like_1 A bacterial subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP)-like proteins Back     alignment and domain information
>PF00246 Peptidase_M14: Zinc carboxypeptidase This is family M14 in the peptidase classification Back     alignment and domain information
>cd06237 M14_Nna1_like_3 A bacterial subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP),-like proteins Back     alignment and domain information
>cd06248 M14_CPA_CPB_like Peptidase M14 Carboxypeptidase A/B-like subfamily: This is one of two main M14 carboxypeptidase subfamilies, defined by sequence and structural homology, the other being N/E Back     alignment and domain information
>smart00631 Zn_pept Zn_pept Back     alignment and domain information
>cd03860 M14_CP_A-B_like The Peptidase M14 Carboxypeptidase (CP) A/B subfamily is one of two main M14 CP subfamilies defined by sequence and structural homology, the other being the N/E subfamily Back     alignment and domain information
>cd06247 M14_CPO Peptidase M14 carboxypeptidase (CP) O (CPO, also known as metallocarboxypeptidase C; EC 3 Back     alignment and domain information
>cd03858 M14_CP_N-E_like Carboxypeptidase (CP) N/E-like subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06244 Peptidase_M14-like_1_7 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06231 Peptidase_M14-like_4 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query128
3l2n_A395 Peptidase M14, carboxypeptidase A; putative carbox 97.69
4a37_A388 Metallo-carboxypeptidase; metallo-protease, hydrol 97.55
3k2k_A403 Putative carboxypeptidase; structural genomics, jo 97.55
3l2n_A395 Peptidase M14, carboxypeptidase A; putative carbox 96.69
3k2k_A403 Putative carboxypeptidase; structural genomics, jo 95.22
2qvp_A275 Uncharacterized protein; putative metallopeptidase 93.88
4a37_A388 Metallo-carboxypeptidase; metallo-protease, hydrol 93.1
1dtd_A303 Carboxypeptidase A2; carboxypeptidase A2, leech ca 92.46
1h8l_A 380 Carboxypeptidase GP180 residues 503-882; hydrolase 91.26
3prt_A323 Carboxypeptidase T; hydrolase; 1.66A {Thermoactino 90.51
1z5r_A306 Procarboxypeptidase B; exopeptidase, hydrolase; 1. 90.32
2c1c_A312 Carboxypeptidase B; insect, metalloprotease, insen 89.03
1aye_A401 PCPA2, procarboxypeptidase A2; serine protease, zy 88.73
3d4u_A309 Tafia, carboxypeptidase B2; protease-inhibitor com 88.45
1jqg_A433 Carboxypeptidase A; Pro-protein, hydrolase; 2.50A 88.11
3mn8_A 435 LP15968P; catalytic domain of alpha/beta-hydrolase 87.36
1kwm_A402 Procarboxypeptidase B; hydrolase; HET: CIT; 1.60A 86.89
1m4l_A307 Carboxypeptidase A; metalloproteinase, metalloexop 86.67
2bo9_A308 Carboxypeptidase A4; metallocarboxypeptidase, X-RA 86.35
3b2y_A275 Metallopeptidase containing CO-catalytic metalloa 85.5
2boa_A404 Carboxypeptidase A4; metalloprocarboxypeptidase, X 85.4
1uwy_A 426 Carboxypeptidase M; metallopeptidase, GPI-anchor, 84.99
2nsm_A 439 Carboxypeptidase N catalytic chain; caroxypeptidas 83.1
>3l2n_A Peptidase M14, carboxypeptidase A; putative carboxypeptidase A, structural genomics, joint CENT structural genomics, JCSG; 2.39A {Shewanella denitrificans} Back     alignment and structure
Probab=97.69  E-value=1.4e-05  Score=66.80  Aligned_cols=75  Identities=17%  Similarity=0.270  Sum_probs=57.4

Q ss_pred             EEEeeeecceeeeeeeccccccccCC-ccccchhHHHHHHHHHHHHHHHhcCCCeEEEecCCCCCccceeEeccCCCCCc
Q psy3963          32 ITIWREYGVVRSYTMESTYCGFDQGS-FKIGTKESMKIVRGLIEFCTRVLKKTPYFYCDFHGHSLKKNIFLYGCSSQESW  110 (128)
Q Consensus        32 V~~~~~~gi~~syTlE~Sf~G~dlg~-~kf~~kdL~pigk~L~e~l~~ll~~~~~~y~D~HGHSrk~N~F~yGc~~~~~~  110 (128)
                      |.+.+..|+..+. -.++..|.|+|+ |.-+....+|.++++.+++.+.   .+.+|+|+|++|+..+.|+|||.....|
T Consensus       222 vP~~NPDG~~~~~-~R~n~~GvDLNRnf~g~~~~sepEt~a~~~~l~~~---~~~~~iDlHs~~~~p~~f~~g~~~~p~~  297 (395)
T 3l2n_A          222 VPNMNPDGSVRGH-LRTNAVGANLNREWQTPSLERSPEVYYVVNKMHET---GVDLFYDVHGDEGLPYVFLAGCEGIPNY  297 (395)
T ss_dssp             ESCSCHHHHHTTC-SSCCTTSCCGGGCSSSCCTTTCHHHHHHHHHHHHH---CCSEEEEEEEESSCSSBEEECCTTSTTC
T ss_pred             EeccCCchhhhcc-cccccCCCCcccccCCCCcCCCHHHHHHHHHHHhC---CCcEEEEeccCCCCCceEeccccCCCCc
Confidence            5666777776543 367889999996 3333445678899988887653   7999999999999999999999765444



>4a37_A Metallo-carboxypeptidase; metallo-protease, hydrolase; 1.60A {Pseudomonas aeruginosa} PDB: 4a38_A 4a39_A* Back     alignment and structure
>3k2k_A Putative carboxypeptidase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; 2.49A {Burkholderia mallei atcc 23344} Back     alignment and structure
>3l2n_A Peptidase M14, carboxypeptidase A; putative carboxypeptidase A, structural genomics, joint CENT structural genomics, JCSG; 2.39A {Shewanella denitrificans} Back     alignment and structure
>3k2k_A Putative carboxypeptidase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; 2.49A {Burkholderia mallei atcc 23344} Back     alignment and structure
>2qvp_A Uncharacterized protein; putative metallopeptidase, structural genomics, joint center structural genomics, JCSG; HET: MSE; 2.00A {Shewanella amazonensis} Back     alignment and structure
>4a37_A Metallo-carboxypeptidase; metallo-protease, hydrolase; 1.60A {Pseudomonas aeruginosa} PDB: 4a38_A 4a39_A* Back     alignment and structure
>1dtd_A Carboxypeptidase A2; carboxypeptidase A2, leech carboxypeptidase inhibitor, hydrolase/hydrolase inhibitor complex; HET: GLU; 1.65A {Homo sapiens} SCOP: c.56.5.1 Back     alignment and structure
>1h8l_A Carboxypeptidase GP180 residues 503-882; hydrolase, zinc-dependent protease; HET: NAG BMA NDG GEM; 2.6A {Lophonetta specularioides} SCOP: b.3.2.1 c.56.5.1 PDB: 1qmu_A* Back     alignment and structure
>3prt_A Carboxypeptidase T; hydrolase; 1.66A {Thermoactinomyces vulgaris} PDB: 1obr_A 3qnv_A Back     alignment and structure
>1z5r_A Procarboxypeptidase B; exopeptidase, hydrolase; 1.40A {Sus scrofa} SCOP: c.56.5.1 PDB: 1zg7_A* 1zg8_A* 1zg9_A* 2jew_A* 2piy_A* 2piz_A* 2pj0_A* 2pj1_A* 2pj2_A* 2pj3_A* 2pj4_A* 2pj5_A* 2pj6_A* 2pj7_A* 2pj8_A* 2pj9_A* 2pja_A* 2pjb_A* 2pjc_A* 1zli_A ... Back     alignment and structure
>2c1c_A Carboxypeptidase B; insect, metalloprotease, insensitive, plant inhibitors, hydrolase; 2.3A {Helicoverpa zea} SCOP: c.56.5.1 Back     alignment and structure
>1aye_A PCPA2, procarboxypeptidase A2; serine protease, zymogen, hydrolase; 1.80A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 PDB: 1o6x_A Back     alignment and structure
>3d4u_A Tafia, carboxypeptidase B2; protease-inhibitor complex, glycoprotein, hydrolase, metal-binding, metalloprotease, protease, secret zymogen; 1.70A {Bos taurus} PDB: 3lms_A Back     alignment and structure
>1jqg_A Carboxypeptidase A; Pro-protein, hydrolase; 2.50A {Helicoverpa armigera} SCOP: c.56.5.1 d.58.3.1 Back     alignment and structure
>3mn8_A LP15968P; catalytic domain of alpha/beta-hydrolase fold, C-terminal, A transthyretin-like domain, hydrolase; HET: NAG GEM; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1kwm_A Procarboxypeptidase B; hydrolase; HET: CIT; 1.60A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 PDB: 3glj_A 1nsa_A 1pba_A Back     alignment and structure
>1m4l_A Carboxypeptidase A; metalloproteinase, metalloexoproteinase, hydrolase; 1.25A {Bos taurus} SCOP: c.56.5.1 PDB: 1cpx_A 1arl_A 1f57_A 2rfh_A* 3i1u_A* 1arm_A 1ell_P 1elm_P 1ee3_P 1zlh_A 2abz_A 3hlp_A 3huv_A 1yme_A* 3fvl_A* 3fx6_A* 2ctc_A* 1hdq_A 2ctb_A* 3kgq_A* ... Back     alignment and structure
>2bo9_A Carboxypeptidase A4; metallocarboxypeptidase, X-RAY endogenous protein inhibitor, metalloprotease carboxypeptidase, hydrolase; HET: NAG; 1.6A {Homo sapiens} SCOP: c.56.5.1 PDB: 4a94_A 2pcu_A* Back     alignment and structure
>3b2y_A Metallopeptidase containing CO-catalytic metalloa site; metallopeptidase containing CO-catalytic metalloactive site; 1.74A {Shewanella denitrificans OS217} PDB: 3ieh_A* Back     alignment and structure
>2boa_A Carboxypeptidase A4; metalloprocarboxypeptidase, X-RAY zymogen, metalloprotease, exopropeptidase, hydrolase; HET: NAG; 2.20A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 Back     alignment and structure
>1uwy_A Carboxypeptidase M; metallopeptidase, GPI-anchor, metalloprotease, zinc, lipoprotein, hydrolase, structural proteomics in europe, spine; HET: NAG; 3.0A {Homo sapiens} SCOP: b.3.2.1 c.56.5.1 Back     alignment and structure
>2nsm_A Carboxypeptidase N catalytic chain; caroxypeptidase, zinc peptidase, transthyretin-like domain, processing, peptide modification, hydrolase; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query128
d2c1ca1312 Carboxypeptidase B {Corn earworm (Helicoverpa zea) 83.2
>d2c1ca1 c.56.5.1 (A:7-309) Carboxypeptidase B {Corn earworm (Helicoverpa zea) [TaxId: 7113]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Phosphorylase/hydrolase-like
superfamily: Zn-dependent exopeptidases
family: Pancreatic carboxypeptidases
domain: Carboxypeptidase B
species: Corn earworm (Helicoverpa zea) [TaxId: 7113]
Probab=83.20  E-value=0.38  Score=36.41  Aligned_cols=34  Identities=18%  Similarity=0.221  Sum_probs=25.9

Q ss_pred             HHHHHHHHHHHHHHHhcCCCeEEEecCCCCCccceeEe
Q psy3963          65 SMKIVRGLIEFCTRVLKKTPYFYCDFHGHSLKKNIFLY  102 (128)
Q Consensus        65 L~pigk~L~e~l~~ll~~~~~~y~D~HGHSrk~N~F~y  102 (128)
                      .+|.++++.+++.+. ...+.+|+|+|+++   +.++|
T Consensus       168 SepEt~av~~~~~~~-~~~i~~~l~~Hs~g---~~i~~  201 (312)
T d2c1ca1         168 SEVETRVVRDILHEH-LARMALYLTMHSFG---SMILY  201 (312)
T ss_dssp             CSHHHHHHHHHHHHH-GGGEEEEEEEEESS---SEEEE
T ss_pred             cChHHHHHHHHHHhc-ccceeEEEEecCCC---ceEEe
Confidence            457899999988764 33588999999987   45664