Psyllid ID: psy3963
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 128 | ||||||
| 242015814 | 1079 | conserved hypothetical protein [Pediculu | 0.429 | 0.050 | 0.581 | 6e-14 | |
| 432873776 | 1227 | PREDICTED: cytosolic carboxypeptidase 1- | 0.75 | 0.078 | 0.442 | 3e-13 | |
| 66773052 | 1153 | cytosolic carboxypeptidase 1 [Danio reri | 0.601 | 0.066 | 0.493 | 8e-13 | |
| 348517278 | 1234 | PREDICTED: cytosolic carboxypeptidase 1- | 0.601 | 0.062 | 0.481 | 1e-12 | |
| 410922808 | 1218 | PREDICTED: cytosolic carboxypeptidase 1- | 0.601 | 0.063 | 0.481 | 2e-12 | |
| 301607534 | 1053 | PREDICTED: cytosolic carboxypeptidase 4- | 0.453 | 0.055 | 0.525 | 3e-12 | |
| 166158244 | 1226 | cytosolic carboxypeptidase 1 [Xenopus (S | 0.492 | 0.051 | 0.575 | 3e-12 | |
| 443695617 | 1273 | hypothetical protein CAPTEDRAFT_228599 [ | 0.609 | 0.061 | 0.469 | 4e-12 | |
| 198427078 | 1401 | PREDICTED: similar to Cytosolic carboxyp | 0.492 | 0.044 | 0.545 | 4e-12 | |
| 328720769 | 1030 | PREDICTED: hypothetical protein LOC10016 | 0.453 | 0.056 | 0.517 | 6e-12 |
| >gi|242015814|ref|XP_002428542.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212513176|gb|EEB15804.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 82.0 bits (201), Expect = 6e-14, Method: Compositional matrix adjust.
Identities = 32/55 (58%), Positives = 45/55 (81%)
Query: 70 RGLIEFCTRVLKKTPYFYCDFHGHSLKKNIFLYGCSSQESWLSSDKCRVENQVEF 124
+GL+E+C R+LKK P+ +CDFHGHS KKN+FLYGC++ ESW SDK ++ + VE+
Sbjct: 898 KGLLEYCCRILKKPPFVFCDFHGHSRKKNVFLYGCANNESWSESDKQQIVSPVEY 952
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|432873776|ref|XP_004072384.1| PREDICTED: cytosolic carboxypeptidase 1-like [Oryzias latipes] | Back alignment and taxonomy information |
|---|
| >gi|66773052|ref|NP_001019616.1| cytosolic carboxypeptidase 1 [Danio rerio] gi|82225635|sp|Q4U2V3.1|CBPC1_DANRE RecName: Full=Cytosolic carboxypeptidase 1; AltName: Full=ATP/GTP-binding protein 1 gi|65335311|gb|AAY42353.1| ATP/GTP binding protein 1 [Danio rerio] | Back alignment and taxonomy information |
|---|
| >gi|348517278|ref|XP_003446161.1| PREDICTED: cytosolic carboxypeptidase 1-like [Oreochromis niloticus] | Back alignment and taxonomy information |
|---|
| >gi|410922808|ref|XP_003974874.1| PREDICTED: cytosolic carboxypeptidase 1-like [Takifugu rubripes] | Back alignment and taxonomy information |
|---|
| >gi|301607534|ref|XP_002933362.1| PREDICTED: cytosolic carboxypeptidase 4-like, partial [Xenopus (Silurana) tropicalis] | Back alignment and taxonomy information |
|---|
| >gi|166158244|ref|NP_001107308.1| cytosolic carboxypeptidase 1 [Xenopus (Silurana) tropicalis] gi|317374801|sp|A9JRL3.1|CBPC1_XENTR RecName: Full=Cytosolic carboxypeptidase 1; AltName: Full=ATP/GTP-binding protein 1 gi|161611926|gb|AAI55704.1| LOC100135097 protein [Xenopus (Silurana) tropicalis] | Back alignment and taxonomy information |
|---|
| >gi|443695617|gb|ELT96483.1| hypothetical protein CAPTEDRAFT_228599 [Capitella teleta] | Back alignment and taxonomy information |
|---|
| >gi|198427078|ref|XP_002124627.1| PREDICTED: similar to Cytosolic carboxypeptidase 1 (ATP/GTP-binding protein 1) (Nervous system nuclear protein induced by axotomy) [Ciona intestinalis] | Back alignment and taxonomy information |
|---|
| >gi|328720769|ref|XP_001946321.2| PREDICTED: hypothetical protein LOC100169101 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 128 | ||||||
| ZFIN|ZDB-GENE-081104-267 | 1153 | agtpbp1 "ATP/GTP binding prote | 0.703 | 0.078 | 0.453 | 8.9e-14 | |
| UNIPROTKB|A9JRL3 | 1226 | agtpbp1 "Cytosolic carboxypept | 0.601 | 0.062 | 0.506 | 9.6e-14 | |
| UNIPROTKB|E1C3P4 | 1224 | AGTPBP1 "Cytosolic carboxypept | 0.609 | 0.063 | 0.5 | 2e-13 | |
| UNIPROTKB|Q6DD21 | 1225 | agtpbp1 "Cytosolic carboxypept | 0.601 | 0.062 | 0.493 | 2e-13 | |
| UNIPROTKB|F1PL04 | 1132 | AGTPBP1 "Uncharacterized prote | 0.601 | 0.068 | 0.481 | 1e-12 | |
| UNIPROTKB|F1MKS6 | 1222 | F1MKS6 "Uncharacterized protei | 0.601 | 0.063 | 0.481 | 1.1e-12 | |
| UNIPROTKB|Q9UPW5 | 1226 | AGTPBP1 "Cytosolic carboxypept | 0.601 | 0.062 | 0.481 | 1.1e-12 | |
| UNIPROTKB|J9NSE2 | 1226 | AGTPBP1 "Uncharacterized prote | 0.601 | 0.062 | 0.481 | 1.1e-12 | |
| UNIPROTKB|F1LR54 | 1175 | Agtpbp1 "Protein Agtpbp1" [Rat | 0.601 | 0.065 | 0.481 | 1.4e-12 | |
| MGI|MGI:2159437 | 1218 | Agtpbp1 "ATP/GTP binding prote | 0.601 | 0.063 | 0.481 | 1.4e-12 |
| ZFIN|ZDB-GENE-081104-267 agtpbp1 "ATP/GTP binding protein 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 192 (72.6 bits), Expect = 8.9e-14, P = 8.9e-14
Identities = 44/97 (45%), Positives = 60/97 (61%)
Query: 2 LSRLLEQCALSFDPKSSHYKIERSKESTARITIWREYGVVRSYTMESTYCGFDQGSFK-- 59
L +LL Q A +F S + +ERSKE+TAR+ +WRE GV RSYTMEST CG DQG +K
Sbjct: 982 LPKLLSQMAPAFSLSSCSFVVERSKEATARVVVWREIGVQRSYTMESTLCGCDQGKYKGL 1041
Query: 60 -IGTKESMKIVRGLIEFCTRVLKKTPYFY-CDFHGHS 94
IGT E ++ G +FC +L+ + + H H+
Sbjct: 1042 QIGTSELEEM--GS-QFCLALLRLRRFTSPLELHNHN 1075
|
|
| UNIPROTKB|A9JRL3 agtpbp1 "Cytosolic carboxypeptidase 1" [Xenopus (Silurana) tropicalis (taxid:8364)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C3P4 AGTPBP1 "Cytosolic carboxypeptidase 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6DD21 agtpbp1 "Cytosolic carboxypeptidase 1" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PL04 AGTPBP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MKS6 F1MKS6 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UPW5 AGTPBP1 "Cytosolic carboxypeptidase 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NSE2 AGTPBP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LR54 Agtpbp1 "Protein Agtpbp1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2159437 Agtpbp1 "ATP/GTP binding protein 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 128 | |||
| cd06906 | 278 | cd06906, M14_Nna1, Peptidase M14-like domain of AT | 8e-23 | |
| cd06235 | 258 | cd06235, M14_Nna1_like_2, Peptidase M14-like domai | 7e-13 | |
| cd06235 | 258 | cd06235, M14_Nna1_like_2, Peptidase M14-like domai | 2e-11 | |
| cd06907 | 261 | cd06907, M14_AGBL2-3_like, Peptidase M14-like doma | 2e-11 | |
| cd06906 | 278 | cd06906, M14_Nna1, Peptidase M14-like domain of AT | 8e-11 | |
| cd06907 | 261 | cd06907, M14_AGBL2-3_like, Peptidase M14-like doma | 2e-07 | |
| cd03856 | 258 | cd03856, M14_Nna1_like, Peptidase M14-like domain | 3e-06 | |
| cd03856 | 258 | cd03856, M14_Nna1_like, Peptidase M14-like domain | 6e-06 | |
| cd06236 | 308 | cd06236, M14_AGBL5_like, Peptidase M14-like domain | 0.001 |
| >gnl|CDD|133116 cd06906, M14_Nna1, Peptidase M14-like domain of ATP/GTP binding proteins and cytosolic carboxypeptidases | Back alignment and domain information |
|---|
Score = 89.5 bits (222), Expect = 8e-23
Identities = 37/66 (56%), Positives = 46/66 (69%), Gaps = 3/66 (4%)
Query: 2 LSRLLEQCALSFDPKSSHYKIERSKESTARITIWREYGVVRSYTMESTYCGFDQGSFK-- 59
L ++L A +F S + +E+SKESTAR+ +WRE GV RSYTMEST CG DQG +K
Sbjct: 199 LPKILSHIAPAFSMSSCSFVVEKSKESTARVVVWREIGVQRSYTMESTLCGCDQGKYKGL 258
Query: 60 -IGTKE 64
IGTKE
Sbjct: 259 QIGTKE 264
|
Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins. The Peptidase M14 family of metallocarboxypeptidases are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. This eukaryotic subgroup includes the mouse Nna1/CCP-1, and -4 proteins, and the human Nna1/AGTPBP-1 protein. Nna1-like proteins are active metallopeptidases that are thought to act on cytosolic proteins such as alpha-tubulin, to remove a C-terminal tyrosine. Nna1 is widely expressed in the developing and adult nervous systems, including cerebellar Purkinje and granule neurons, miral cells of the olfactory bulb and retinal photoreceptors. Nna1 is also induced in axotomized motor neurons. Mutations in Nna1 cause Purkinje cell degeneration (pcd). The Nna1 CP domain is required to prevent the retinal photoreceptor loss and cerebellar ataxia phenotypes of pcd mice, and a functional zinc-binding domain is needed for Nna-1 to support neuron survival in these mice. Nna1-like proteins from the different phyla are highly diverse, but they all contain a unique N-terminal conserved domain right before the CP domain. It has been suggested that this N-terminal domain might act as a folding domain. Length = 278 |
| >gnl|CDD|199859 cd06235, M14_Nna1_like_2, Peptidase M14-like domain of human Nna1/AGTPBP-1, AGBL2 -5, and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|199859 cd06235, M14_Nna1_like_2, Peptidase M14-like domain of human Nna1/AGTPBP-1, AGBL2 -5, and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|133117 cd06907, M14_AGBL2-3_like, Peptidase M14-like domain of ATP/GTP binding protein AGBL-2 and AGBL-3, and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|133116 cd06906, M14_Nna1, Peptidase M14-like domain of ATP/GTP binding proteins and cytosolic carboxypeptidases | Back alignment and domain information |
|---|
| >gnl|CDD|133117 cd06907, M14_AGBL2-3_like, Peptidase M14-like domain of ATP/GTP binding protein AGBL-2 and AGBL-3, and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|199841 cd03856, M14_Nna1_like, Peptidase M14-like domain of ATP/GTP binding proteins, cytosolic carboxypeptidases and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|199841 cd03856, M14_Nna1_like, Peptidase M14-like domain of ATP/GTP binding proteins, cytosolic carboxypeptidases and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|199860 cd06236, M14_AGBL5_like, Peptidase M14-like domain of ATP/GTP binding protein (AGBL)-5 and related proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 128 | |||
| cd06906 | 278 | M14_Nna1 Peptidase M14-like domain of Nna-1 (Nervo | 99.92 | |
| cd06907 | 261 | M14_AGBL2-3_like Peptidase M14-like domain of ATP/ | 99.89 | |
| cd06236 | 304 | M14_AGBL5_like Peptidase M14-like domain of ATP/GT | 99.82 | |
| cd06235 | 258 | M14_Nna1_like_2 Subgroup of the Peptidase M14-like | 99.78 | |
| cd06908 | 261 | M14_AGBL4_like Peptidase M14-like domain of ATP/GT | 99.76 | |
| KOG3641|consensus | 650 | 99.55 | ||
| KOG3641|consensus | 650 | 99.54 | ||
| cd06906 | 278 | M14_Nna1 Peptidase M14-like domain of Nna-1 (Nervo | 99.53 | |
| cd06907 | 261 | M14_AGBL2-3_like Peptidase M14-like domain of ATP/ | 99.5 | |
| cd06236 | 304 | M14_AGBL5_like Peptidase M14-like domain of ATP/GT | 99.45 | |
| cd03856 | 269 | M14_Nna1_like Peptidase M14-like domain of Nna-1 ( | 99.37 | |
| cd06235 | 258 | M14_Nna1_like_2 Subgroup of the Peptidase M14-like | 99.33 | |
| cd06908 | 261 | M14_AGBL4_like Peptidase M14-like domain of ATP/GT | 99.28 | |
| cd03856 | 269 | M14_Nna1_like Peptidase M14-like domain of Nna-1 ( | 99.04 | |
| cd06234 | 263 | M14_Nna1_like_1 A bacterial subgroup of the Peptid | 98.27 | |
| cd06239 | 231 | Peptidase_M14-like_1_2 Peptidase M14-like domain o | 94.4 | |
| cd00596 | 196 | Peptidase_M14_like The M14 family of metallocarbox | 92.79 | |
| cd06234 | 263 | M14_Nna1_like_1 A bacterial subgroup of the Peptid | 92.47 | |
| PF00246 | 279 | Peptidase_M14: Zinc carboxypeptidase This is famil | 89.5 | |
| cd06237 | 244 | M14_Nna1_like_3 A bacterial subgroup of the Peptid | 89.18 | |
| cd06248 | 304 | M14_CPA_CPB_like Peptidase M14 Carboxypeptidase A/ | 88.85 | |
| smart00631 | 277 | Zn_pept Zn_pept. | 88.23 | |
| cd03860 | 294 | M14_CP_A-B_like The Peptidase M14 Carboxypeptidase | 83.87 | |
| cd06247 | 298 | M14_CPO Peptidase M14 carboxypeptidase (CP) O (CPO | 82.58 | |
| cd03858 | 374 | M14_CP_N-E_like Carboxypeptidase (CP) N/E-like sub | 81.81 | |
| cd06244 | 268 | Peptidase_M14-like_1_7 Peptidase M14-like domain o | 81.17 | |
| cd06231 | 236 | Peptidase_M14-like_4 A functionally uncharacterize | 80.43 |
| >cd06906 M14_Nna1 Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins | Back alignment and domain information |
|---|
Probab=99.92 E-value=5e-26 Score=185.23 Aligned_cols=77 Identities=47% Similarity=0.717 Sum_probs=73.6
Q ss_pred ChhhHHhHcCCCccCCCCeecccccccccceEEEeeeecceeeeeeeccccccccCCc---cccchhHHHHHHHHHHHHH
Q psy3963 1 MLSRLLEQCALSFDPKSSHYKIERSKESTARITIWREYGVVRSYTMESTYCGFDQGSF---KIGTKESMKIVRGLIEFCT 77 (128)
Q Consensus 1 ~~P~lls~~~p~Fs~~~C~F~v~k~Ke~TaRV~~~~~~gi~~syTlE~Sf~G~dlg~~---kf~~kdL~pigk~L~e~l~ 77 (128)
+||+||++++|.|+|++|+|.++|+||+||||++|+++||++|||||+||+|+++|.+ +|+++||++||+.+|+.|.
T Consensus 198 ~fP~ll~~~~~~Fs~~~C~F~~~k~K~gTaRv~~~~~~~i~~syTlE~Sf~G~~~g~~~g~~f~~~~~~~~G~~~c~~l~ 277 (278)
T cd06906 198 TLPKILSHIAPAFSMSSCSFVVEKSKESTARVVVWREIGVQRSYTMESTLCGCDQGKYKGLQIGTKELEEMGAKFCVGLL 277 (278)
T ss_pred HHHHHHHhcCCccchhhCCccCCCCCCCCeeEehhhhcCCceEEEEEEEeccccccCcCceecCHHHHHHHHHHHHHHHh
Confidence 5899999999999999999999999999999999999999999999999999999875 4999999999999999874
|
The Peptidase M14 family of metallocarboxypeptidases are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. This eukaryotic subgroup includes the mouse Nna1/CCP-1, and -4 proteins, and the human Nna1/AGTPBP-1 protein. Nna1-like proteins are active metallopeptidases that are thought to act on cytosolic proteins such as alpha-tubulin, to remove a C-terminal tyrosine. Nna1 is widely expressed in the developing and adult nervous systems, including cerebellar Purkinje and granule neurons, miral cells of the olfactory bulb and retinal photoreceptors. Nna1 is also induced in axotomized motor neurons. Mutations in Nna |
| >cd06907 M14_AGBL2-3_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-2, and related proteins | Back alignment and domain information |
|---|
| >cd06236 M14_AGBL5_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-5, and related proteins | Back alignment and domain information |
|---|
| >cd06235 M14_Nna1_like_2 Subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins | Back alignment and domain information |
|---|
| >cd06908 M14_AGBL4_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-4, and related proteins | Back alignment and domain information |
|---|
| >KOG3641|consensus | Back alignment and domain information |
|---|
| >KOG3641|consensus | Back alignment and domain information |
|---|
| >cd06906 M14_Nna1 Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins | Back alignment and domain information |
|---|
| >cd06907 M14_AGBL2-3_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-2, and related proteins | Back alignment and domain information |
|---|
| >cd06236 M14_AGBL5_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-5, and related proteins | Back alignment and domain information |
|---|
| >cd03856 M14_Nna1_like Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins | Back alignment and domain information |
|---|
| >cd06235 M14_Nna1_like_2 Subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins | Back alignment and domain information |
|---|
| >cd06908 M14_AGBL4_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-4, and related proteins | Back alignment and domain information |
|---|
| >cd03856 M14_Nna1_like Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins | Back alignment and domain information |
|---|
| >cd06234 M14_Nna1_like_1 A bacterial subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP)-like proteins | Back alignment and domain information |
|---|
| >cd06239 Peptidase_M14-like_1_2 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd00596 Peptidase_M14_like The M14 family of metallocarboxypeptidases (MCPs) are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity | Back alignment and domain information |
|---|
| >cd06234 M14_Nna1_like_1 A bacterial subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP)-like proteins | Back alignment and domain information |
|---|
| >PF00246 Peptidase_M14: Zinc carboxypeptidase This is family M14 in the peptidase classification | Back alignment and domain information |
|---|
| >cd06237 M14_Nna1_like_3 A bacterial subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP),-like proteins | Back alignment and domain information |
|---|
| >cd06248 M14_CPA_CPB_like Peptidase M14 Carboxypeptidase A/B-like subfamily: This is one of two main M14 carboxypeptidase subfamilies, defined by sequence and structural homology, the other being N/E | Back alignment and domain information |
|---|
| >smart00631 Zn_pept Zn_pept | Back alignment and domain information |
|---|
| >cd03860 M14_CP_A-B_like The Peptidase M14 Carboxypeptidase (CP) A/B subfamily is one of two main M14 CP subfamilies defined by sequence and structural homology, the other being the N/E subfamily | Back alignment and domain information |
|---|
| >cd06247 M14_CPO Peptidase M14 carboxypeptidase (CP) O (CPO, also known as metallocarboxypeptidase C; EC 3 | Back alignment and domain information |
|---|
| >cd03858 M14_CP_N-E_like Carboxypeptidase (CP) N/E-like subfamily of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06244 Peptidase_M14-like_1_7 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06231 Peptidase_M14-like_4 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 128 | |||
| 3l2n_A | 395 | Peptidase M14, carboxypeptidase A; putative carbox | 97.69 | |
| 4a37_A | 388 | Metallo-carboxypeptidase; metallo-protease, hydrol | 97.55 | |
| 3k2k_A | 403 | Putative carboxypeptidase; structural genomics, jo | 97.55 | |
| 3l2n_A | 395 | Peptidase M14, carboxypeptidase A; putative carbox | 96.69 | |
| 3k2k_A | 403 | Putative carboxypeptidase; structural genomics, jo | 95.22 | |
| 2qvp_A | 275 | Uncharacterized protein; putative metallopeptidase | 93.88 | |
| 4a37_A | 388 | Metallo-carboxypeptidase; metallo-protease, hydrol | 93.1 | |
| 1dtd_A | 303 | Carboxypeptidase A2; carboxypeptidase A2, leech ca | 92.46 | |
| 1h8l_A | 380 | Carboxypeptidase GP180 residues 503-882; hydrolase | 91.26 | |
| 3prt_A | 323 | Carboxypeptidase T; hydrolase; 1.66A {Thermoactino | 90.51 | |
| 1z5r_A | 306 | Procarboxypeptidase B; exopeptidase, hydrolase; 1. | 90.32 | |
| 2c1c_A | 312 | Carboxypeptidase B; insect, metalloprotease, insen | 89.03 | |
| 1aye_A | 401 | PCPA2, procarboxypeptidase A2; serine protease, zy | 88.73 | |
| 3d4u_A | 309 | Tafia, carboxypeptidase B2; protease-inhibitor com | 88.45 | |
| 1jqg_A | 433 | Carboxypeptidase A; Pro-protein, hydrolase; 2.50A | 88.11 | |
| 3mn8_A | 435 | LP15968P; catalytic domain of alpha/beta-hydrolase | 87.36 | |
| 1kwm_A | 402 | Procarboxypeptidase B; hydrolase; HET: CIT; 1.60A | 86.89 | |
| 1m4l_A | 307 | Carboxypeptidase A; metalloproteinase, metalloexop | 86.67 | |
| 2bo9_A | 308 | Carboxypeptidase A4; metallocarboxypeptidase, X-RA | 86.35 | |
| 3b2y_A | 275 | Metallopeptidase containing CO-catalytic metalloa | 85.5 | |
| 2boa_A | 404 | Carboxypeptidase A4; metalloprocarboxypeptidase, X | 85.4 | |
| 1uwy_A | 426 | Carboxypeptidase M; metallopeptidase, GPI-anchor, | 84.99 | |
| 2nsm_A | 439 | Carboxypeptidase N catalytic chain; caroxypeptidas | 83.1 |
| >3l2n_A Peptidase M14, carboxypeptidase A; putative carboxypeptidase A, structural genomics, joint CENT structural genomics, JCSG; 2.39A {Shewanella denitrificans} | Back alignment and structure |
|---|
Probab=97.69 E-value=1.4e-05 Score=66.80 Aligned_cols=75 Identities=17% Similarity=0.270 Sum_probs=57.4
Q ss_pred EEEeeeecceeeeeeeccccccccCC-ccccchhHHHHHHHHHHHHHHHhcCCCeEEEecCCCCCccceeEeccCCCCCc
Q psy3963 32 ITIWREYGVVRSYTMESTYCGFDQGS-FKIGTKESMKIVRGLIEFCTRVLKKTPYFYCDFHGHSLKKNIFLYGCSSQESW 110 (128)
Q Consensus 32 V~~~~~~gi~~syTlE~Sf~G~dlg~-~kf~~kdL~pigk~L~e~l~~ll~~~~~~y~D~HGHSrk~N~F~yGc~~~~~~ 110 (128)
|.+.+..|+..+. -.++..|.|+|+ |.-+....+|.++++.+++.+. .+.+|+|+|++|+..+.|+|||.....|
T Consensus 222 vP~~NPDG~~~~~-~R~n~~GvDLNRnf~g~~~~sepEt~a~~~~l~~~---~~~~~iDlHs~~~~p~~f~~g~~~~p~~ 297 (395)
T 3l2n_A 222 VPNMNPDGSVRGH-LRTNAVGANLNREWQTPSLERSPEVYYVVNKMHET---GVDLFYDVHGDEGLPYVFLAGCEGIPNY 297 (395)
T ss_dssp ESCSCHHHHHTTC-SSCCTTSCCGGGCSSSCCTTTCHHHHHHHHHHHHH---CCSEEEEEEEESSCSSBEEECCTTSTTC
T ss_pred EeccCCchhhhcc-cccccCCCCcccccCCCCcCCCHHHHHHHHHHHhC---CCcEEEEeccCCCCCceEeccccCCCCc
Confidence 5666777776543 367889999996 3333445678899988887653 7999999999999999999999765444
|
| >4a37_A Metallo-carboxypeptidase; metallo-protease, hydrolase; 1.60A {Pseudomonas aeruginosa} PDB: 4a38_A 4a39_A* | Back alignment and structure |
|---|
| >3k2k_A Putative carboxypeptidase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; 2.49A {Burkholderia mallei atcc 23344} | Back alignment and structure |
|---|
| >3l2n_A Peptidase M14, carboxypeptidase A; putative carboxypeptidase A, structural genomics, joint CENT structural genomics, JCSG; 2.39A {Shewanella denitrificans} | Back alignment and structure |
|---|
| >3k2k_A Putative carboxypeptidase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; 2.49A {Burkholderia mallei atcc 23344} | Back alignment and structure |
|---|
| >2qvp_A Uncharacterized protein; putative metallopeptidase, structural genomics, joint center structural genomics, JCSG; HET: MSE; 2.00A {Shewanella amazonensis} | Back alignment and structure |
|---|
| >4a37_A Metallo-carboxypeptidase; metallo-protease, hydrolase; 1.60A {Pseudomonas aeruginosa} PDB: 4a38_A 4a39_A* | Back alignment and structure |
|---|
| >1dtd_A Carboxypeptidase A2; carboxypeptidase A2, leech carboxypeptidase inhibitor, hydrolase/hydrolase inhibitor complex; HET: GLU; 1.65A {Homo sapiens} SCOP: c.56.5.1 | Back alignment and structure |
|---|
| >1h8l_A Carboxypeptidase GP180 residues 503-882; hydrolase, zinc-dependent protease; HET: NAG BMA NDG GEM; 2.6A {Lophonetta specularioides} SCOP: b.3.2.1 c.56.5.1 PDB: 1qmu_A* | Back alignment and structure |
|---|
| >3prt_A Carboxypeptidase T; hydrolase; 1.66A {Thermoactinomyces vulgaris} PDB: 1obr_A 3qnv_A | Back alignment and structure |
|---|
| >1z5r_A Procarboxypeptidase B; exopeptidase, hydrolase; 1.40A {Sus scrofa} SCOP: c.56.5.1 PDB: 1zg7_A* 1zg8_A* 1zg9_A* 2jew_A* 2piy_A* 2piz_A* 2pj0_A* 2pj1_A* 2pj2_A* 2pj3_A* 2pj4_A* 2pj5_A* 2pj6_A* 2pj7_A* 2pj8_A* 2pj9_A* 2pja_A* 2pjb_A* 2pjc_A* 1zli_A ... | Back alignment and structure |
|---|
| >2c1c_A Carboxypeptidase B; insect, metalloprotease, insensitive, plant inhibitors, hydrolase; 2.3A {Helicoverpa zea} SCOP: c.56.5.1 | Back alignment and structure |
|---|
| >1aye_A PCPA2, procarboxypeptidase A2; serine protease, zymogen, hydrolase; 1.80A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 PDB: 1o6x_A | Back alignment and structure |
|---|
| >3d4u_A Tafia, carboxypeptidase B2; protease-inhibitor complex, glycoprotein, hydrolase, metal-binding, metalloprotease, protease, secret zymogen; 1.70A {Bos taurus} PDB: 3lms_A | Back alignment and structure |
|---|
| >1jqg_A Carboxypeptidase A; Pro-protein, hydrolase; 2.50A {Helicoverpa armigera} SCOP: c.56.5.1 d.58.3.1 | Back alignment and structure |
|---|
| >3mn8_A LP15968P; catalytic domain of alpha/beta-hydrolase fold, C-terminal, A transthyretin-like domain, hydrolase; HET: NAG GEM; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1kwm_A Procarboxypeptidase B; hydrolase; HET: CIT; 1.60A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 PDB: 3glj_A 1nsa_A 1pba_A | Back alignment and structure |
|---|
| >1m4l_A Carboxypeptidase A; metalloproteinase, metalloexoproteinase, hydrolase; 1.25A {Bos taurus} SCOP: c.56.5.1 PDB: 1cpx_A 1arl_A 1f57_A 2rfh_A* 3i1u_A* 1arm_A 1ell_P 1elm_P 1ee3_P 1zlh_A 2abz_A 3hlp_A 3huv_A 1yme_A* 3fvl_A* 3fx6_A* 2ctc_A* 1hdq_A 2ctb_A* 3kgq_A* ... | Back alignment and structure |
|---|
| >2bo9_A Carboxypeptidase A4; metallocarboxypeptidase, X-RAY endogenous protein inhibitor, metalloprotease carboxypeptidase, hydrolase; HET: NAG; 1.6A {Homo sapiens} SCOP: c.56.5.1 PDB: 4a94_A 2pcu_A* | Back alignment and structure |
|---|
| >3b2y_A Metallopeptidase containing CO-catalytic metalloa site; metallopeptidase containing CO-catalytic metalloactive site; 1.74A {Shewanella denitrificans OS217} PDB: 3ieh_A* | Back alignment and structure |
|---|
| >2boa_A Carboxypeptidase A4; metalloprocarboxypeptidase, X-RAY zymogen, metalloprotease, exopropeptidase, hydrolase; HET: NAG; 2.20A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 | Back alignment and structure |
|---|
| >1uwy_A Carboxypeptidase M; metallopeptidase, GPI-anchor, metalloprotease, zinc, lipoprotein, hydrolase, structural proteomics in europe, spine; HET: NAG; 3.0A {Homo sapiens} SCOP: b.3.2.1 c.56.5.1 | Back alignment and structure |
|---|
| >2nsm_A Carboxypeptidase N catalytic chain; caroxypeptidase, zinc peptidase, transthyretin-like domain, processing, peptide modification, hydrolase; HET: NAG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 128 | |||
| d2c1ca1 | 312 | Carboxypeptidase B {Corn earworm (Helicoverpa zea) | 83.2 |
| >d2c1ca1 c.56.5.1 (A:7-309) Carboxypeptidase B {Corn earworm (Helicoverpa zea) [TaxId: 7113]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Phosphorylase/hydrolase-like superfamily: Zn-dependent exopeptidases family: Pancreatic carboxypeptidases domain: Carboxypeptidase B species: Corn earworm (Helicoverpa zea) [TaxId: 7113]
Probab=83.20 E-value=0.38 Score=36.41 Aligned_cols=34 Identities=18% Similarity=0.221 Sum_probs=25.9
Q ss_pred HHHHHHHHHHHHHHHhcCCCeEEEecCCCCCccceeEe
Q psy3963 65 SMKIVRGLIEFCTRVLKKTPYFYCDFHGHSLKKNIFLY 102 (128)
Q Consensus 65 L~pigk~L~e~l~~ll~~~~~~y~D~HGHSrk~N~F~y 102 (128)
.+|.++++.+++.+. ...+.+|+|+|+++ +.++|
T Consensus 168 SepEt~av~~~~~~~-~~~i~~~l~~Hs~g---~~i~~ 201 (312)
T d2c1ca1 168 SEVETRVVRDILHEH-LARMALYLTMHSFG---SMILY 201 (312)
T ss_dssp CSHHHHHHHHHHHHH-GGGEEEEEEEEESS---SEEEE
T ss_pred cChHHHHHHHHHHhc-ccceeEEEEecCCC---ceEEe
Confidence 457899999988764 33588999999987 45664
|