Psyllid ID: psy4395
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 283 | ||||||
| 91083367 | 401 | PREDICTED: similar to phosphatidylcholin | 0.618 | 0.436 | 0.532 | 1e-58 | |
| 307194576 | 408 | 1-O-acylceramide synthase [Harpegnathos | 0.618 | 0.428 | 0.554 | 2e-58 | |
| 307188073 | 408 | 1-O-acylceramide synthase [Camponotus fl | 0.618 | 0.428 | 0.554 | 2e-57 | |
| 156538577 | 408 | PREDICTED: group XV phospholipase A2-lik | 0.646 | 0.448 | 0.547 | 1e-56 | |
| 383865126 | 407 | PREDICTED: group XV phospholipase A2-lik | 0.717 | 0.498 | 0.502 | 1e-56 | |
| 332020092 | 408 | Group XV phospholipase A2 [Acromyrmex ec | 0.618 | 0.428 | 0.549 | 3e-56 | |
| 328791555 | 407 | PREDICTED: group XV phospholipase A2-lik | 0.717 | 0.498 | 0.493 | 1e-55 | |
| 193643698 | 399 | PREDICTED: group XV phospholipase A2-lik | 0.639 | 0.453 | 0.512 | 2e-55 | |
| 380028758 | 379 | PREDICTED: group XV phospholipase A2-lik | 0.717 | 0.535 | 0.489 | 4e-55 | |
| 321478536 | 423 | hypothetical protein DAPPUDRAFT_303258 [ | 0.710 | 0.475 | 0.451 | 9e-55 |
| >gi|91083367|ref|XP_966553.1| PREDICTED: similar to phosphatidylcholine-sterol acyltransferase (lecithin-cholesterol acyltransferase) [Tribolium castaneum] gi|270007779|gb|EFA04227.1| hypothetical protein TcasGA2_TC014478 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 232 bits (591), Expect = 1e-58, Method: Compositional matrix adjust.
Identities = 107/201 (53%), Positives = 147/201 (73%), Gaps = 26/201 (12%)
Query: 18 MPGDGGSQVEARLNKTETVHYICDKTTSNWFTLWLNLELLVPEVIDCFIDNLRLVYNNVT 77
+PGDGGSQVEA+LNK+ +VHYIC+KTTS++F +WLN+ELLVP VIDC+IDN++L+Y+N T
Sbjct: 29 IPGDGGSQVEAKLNKSASVHYICEKTTSDFFNIWLNMELLVPLVIDCWIDNIKLIYDNAT 88
Query: 78 HPF-------VRV-------------------GSYFSYIAAALVGLGYQRDLSMRGAPYD 111
+R+ G+YF+ IA LV LG++R+ +M+GAPYD
Sbjct: 89 RTTRNNDGVEIRIPGFGGTETVEWLDPSHASAGAYFNSIAKTLVSLGHERNKTMKGAPYD 148
Query: 112 FRKAPNENQEYFANFKALIEETYDLNGGTPVVLVAHSMGSLMCLYFLQRQSSAWKSKFVR 171
FRKAPNENQ++F + KALIE+TY N PV+++AHSMG M L+FL +Q+ WK K++R
Sbjct: 149 FRKAPNENQQFFTDLKALIEQTYTENNNQPVIIIAHSMGGPMSLFFLNQQTQDWKDKYIR 208
Query: 172 SLVSLAAPWGGSVKAVKVFAV 192
SLV+L+ WGGS+KAVKV+A+
Sbjct: 209 SLVTLSGAWGGSMKAVKVYAI 229
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|307194576|gb|EFN76868.1| 1-O-acylceramide synthase [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|307188073|gb|EFN72905.1| 1-O-acylceramide synthase [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|156538577|ref|XP_001607467.1| PREDICTED: group XV phospholipase A2-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|383865126|ref|XP_003708026.1| PREDICTED: group XV phospholipase A2-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|332020092|gb|EGI60538.1| Group XV phospholipase A2 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|328791555|ref|XP_624472.3| PREDICTED: group XV phospholipase A2-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|193643698|ref|XP_001951433.1| PREDICTED: group XV phospholipase A2-like isoform 1 [Acyrthosiphon pisum] gi|328708587|ref|XP_003243738.1| PREDICTED: group XV phospholipase A2-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|380028758|ref|XP_003698055.1| PREDICTED: group XV phospholipase A2-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|321478536|gb|EFX89493.1| hypothetical protein DAPPUDRAFT_303258 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 283 | ||||||
| UNIPROTKB|Q8NCC3 | 412 | PLA2G15 "Group XV phospholipas | 0.381 | 0.262 | 0.596 | 7.7e-52 | |
| RGD|1302982 | 413 | Pla2g15 "phospholipase A2, gro | 0.381 | 0.261 | 0.577 | 2e-51 | |
| UNIPROTKB|Q6XPZ3 | 408 | PLA2G15 "Group XV phospholipas | 0.477 | 0.330 | 0.474 | 6.8e-51 | |
| MGI|MGI:2178076 | 412 | Pla2g15 "phospholipase A2, gro | 0.381 | 0.262 | 0.568 | 6.8e-51 | |
| UNIPROTKB|H3BMU8 | 298 | PLA2G15 "Group XV phospholipas | 0.261 | 0.248 | 0.586 | 2.4e-50 | |
| UNIPROTKB|Q8WMP9 | 407 | PLA2G15 "Group XV phospholipas | 0.477 | 0.331 | 0.445 | 3.7e-50 | |
| UNIPROTKB|E1C0B0 | 415 | PLA2G15 "Uncharacterized prote | 0.381 | 0.260 | 0.532 | 9.8e-50 | |
| ZFIN|ZDB-GENE-030131-6948 | 469 | pla2g15 "phospholipase A2, gro | 0.406 | 0.245 | 0.491 | 6.5e-47 | |
| FB|FBgn0051683 | 421 | CG31683 [Drosophila melanogast | 0.385 | 0.258 | 0.559 | 8.6e-47 | |
| FB|FBgn0042175 | 421 | CG18858 [Drosophila melanogast | 0.385 | 0.258 | 0.559 | 1.4e-46 |
| UNIPROTKB|Q8NCC3 PLA2G15 "Group XV phospholipase A2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 340 (124.7 bits), Expect = 7.7e-52, Sum P(2) = 7.7e-52
Identities = 65/109 (59%), Positives = 79/109 (72%)
Query: 83 VGSYFSYIAAALVGLGYQRDLSMRGAPYDFRKAPNENQEYFANFKALIEETYDLNGGTPV 142
VGSYF + +LVG GY R +RGAPYD+R+APNEN YF + +IEE Y L GG PV
Sbjct: 134 VGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGG-PV 192
Query: 143 VLVAHSMGSLMCLYFLQRQSSAWKSKFVRSLVSLAAPWGGSVKAVKVFA 191
VLVAHSMG++ LYFLQRQ AWK K++R+ VSL APWGG K ++V A
Sbjct: 193 VLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLA 241
|
|
| RGD|1302982 Pla2g15 "phospholipase A2, group XV" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6XPZ3 PLA2G15 "Group XV phospholipase A2" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2178076 Pla2g15 "phospholipase A2, group XV" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H3BMU8 PLA2G15 "Group XV phospholipase A2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8WMP9 PLA2G15 "Group XV phospholipase A2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C0B0 PLA2G15 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-6948 pla2g15 "phospholipase A2, group XV" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0051683 CG31683 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0042175 CG18858 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 283 | |||
| pfam02450 | 377 | pfam02450, LACT, Lecithin:cholesterol acyltransfer | 1e-38 | |
| PLN02733 | 440 | PLN02733, PLN02733, phosphatidylcholine-sterol O-a | 4e-10 | |
| cd05581 | 280 | cd05581, STKc_PDK1, Catalytic domain of the Protei | 6e-09 | |
| PTZ00263 | 329 | PTZ00263, PTZ00263, protein kinase A catalytic sub | 2e-08 | |
| COG2267 | 298 | COG2267, PldB, Lysophospholipase [Lipid metabolism | 2e-06 | |
| smart00220 | 254 | smart00220, S_TKc, Serine/Threonine protein kinase | 3e-06 | |
| PLN02517 | 642 | PLN02517, PLN02517, phosphatidylcholine-sterol O-a | 3e-06 | |
| cd05610 | 669 | cd05610, STKc_MASTL, Catalytic domain of the Prote | 5e-06 | |
| COG1075 | 336 | COG1075, LipA, Predicted acetyltransferases and hy | 8e-06 | |
| cd06623 | 264 | cd06623, PKc_MAPKK_plant_like, Catalytic domain of | 2e-05 | |
| cd05580 | 290 | cd05580, STKc_PKA, Catalytic domain of the Protein | 2e-05 | |
| cd05573 | 350 | cd05573, STKc_ROCK_NDR_like, Catalytic domain of R | 7e-05 | |
| pfam00069 | 260 | pfam00069, Pkinase, Protein kinase domain | 1e-04 | |
| cd05612 | 291 | cd05612, STKc_PRKX_like, Catalytic domain of PRKX- | 2e-04 | |
| pfam12697 | 187 | pfam12697, Abhydrolase_6, Alpha/beta hydrolase fam | 2e-04 | |
| cd05596 | 370 | cd05596, STKc_ROCK, Catalytic domain of the Protei | 2e-04 | |
| pfam00561 | 226 | pfam00561, Abhydrolase_1, alpha/beta hydrolase fol | 3e-04 | |
| cd05579 | 265 | cd05579, STKc_MAST_like, Catalytic domain of Micro | 0.001 | |
| cd05574 | 316 | cd05574, STKc_phototropin_like, Catalytic domain o | 0.002 | |
| cd05122 | 253 | cd05122, PKc_STE, Catalytic domain of STE family P | 0.002 | |
| cd05123 | 250 | cd05123, STKc_AGC, Catalytic domain of AGC family | 0.003 | |
| cd05622 | 371 | cd05622, STKc_ROCK1, Catalytic domain of the Prote | 0.003 | |
| cd07838 | 287 | cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc | 0.003 |
| >gnl|CDD|217043 pfam02450, LACT, Lecithin:cholesterol acyltransferase | Back alignment and domain information |
|---|
Score = 138 bits (350), Expect = 1e-38
Identities = 62/171 (36%), Positives = 91/171 (53%), Gaps = 28/171 (16%)
Query: 48 FTLWLNLELLVPEVIDCFIDNLRLVYNNVT-----HPFVRV-----GSYFSY-------- 89
F +WL+L + +P ++DC+IDN R+V N P V++ G+ S
Sbjct: 2 FEIWLDLNVFLPRLVDCWIDNTRMVLNKSCWHVMNDPGVKIRPPGFGATQSVEYLDLSKI 61
Query: 90 --------IAAALVGLGYQRDLSMRGAPYDFRKAPNENQEYFANFKALIEETYDLNGGTP 141
+ LV +GY+R+ ++ APYD+R +P E +YF K LIEE L+G
Sbjct: 62 AGYWIWHKVVKNLVNIGYERNKTVSAAPYDWRLSPAERDDYFKKLKQLIEEALKLSGQ-K 120
Query: 142 VVLVAHSMGSLMCLYFLQRQS-SAWKSKFVRSLVSLAAPWGGSVKAVKVFA 191
VVL+ HSMG+L+ LYFL WK + + + +SL AP GS KAV+ A
Sbjct: 121 VVLIGHSMGNLLVLYFLLWVEAEGWKDQHIDAFISLGAPLLGSPKAVRALA 171
|
Lecithin:cholesterol acyltransferase (LACT) is involved in extracellular metabolism of plasma lipoproteins, including cholesterol. Length = 377 |
| >gnl|CDD|215390 PLN02733, PLN02733, phosphatidylcholine-sterol O-acyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225176 COG2267, PldB, Lysophospholipase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|178132 PLN02517, PLN02517, phosphatidylcholine-sterol O-acyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase | Back alignment and domain information |
|---|
| >gnl|CDD|224001 COG1075, LipA, Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain | Back alignment and domain information |
|---|
| >gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|221720 pfam12697, Abhydrolase_6, Alpha/beta hydrolase family | Back alignment and domain information |
|---|
| >gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >gnl|CDD|201306 pfam00561, Abhydrolase_1, alpha/beta hydrolase fold | Back alignment and domain information |
|---|
| >gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 283 | |||
| KOG2369|consensus | 473 | 99.97 | ||
| PLN02517 | 642 | phosphatidylcholine-sterol O-acyltransferase | 99.97 | |
| PLN02733 | 440 | phosphatidylcholine-sterol O-acyltransferase | 99.96 | |
| PF02450 | 389 | LCAT: Lecithin:cholesterol acyltransferase; InterP | 99.94 | |
| COG2267 | 298 | PldB Lysophospholipase [Lipid metabolism] | 99.62 | |
| PRK10749 | 330 | lysophospholipase L2; Provisional | 99.6 | |
| PLN02385 | 349 | hydrolase; alpha/beta fold family protein | 99.59 | |
| PHA02857 | 276 | monoglyceride lipase; Provisional | 99.58 | |
| PLN02965 | 255 | Probable pheophorbidase | 99.58 | |
| KOG4409|consensus | 365 | 99.57 | ||
| PLN02298 | 330 | hydrolase, alpha/beta fold family protein | 99.57 | |
| TIGR02240 | 276 | PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer | 99.56 | |
| PLN02824 | 294 | hydrolase, alpha/beta fold family protein | 99.56 | |
| PLN02211 | 273 | methyl indole-3-acetate methyltransferase | 99.56 | |
| PRK00870 | 302 | haloalkane dehalogenase; Provisional | 99.54 | |
| PRK03592 | 295 | haloalkane dehalogenase; Provisional | 99.54 | |
| PF07819 | 225 | PGAP1: PGAP1-like protein; InterPro: IPR012908 The | 99.52 | |
| TIGR03101 | 266 | hydr2_PEP hydrolase, ortholog 2, exosortase system | 99.52 | |
| PRK11126 | 242 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl | 99.52 | |
| PRK10673 | 255 | acyl-CoA esterase; Provisional | 99.5 | |
| PF12697 | 228 | Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 | 99.48 | |
| PRK10349 | 256 | carboxylesterase BioH; Provisional | 99.48 | |
| TIGR03695 | 251 | menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene | 99.47 | |
| PLN02511 | 388 | hydrolase | 99.45 | |
| PLN02652 | 395 | hydrolase; alpha/beta fold family protein | 99.45 | |
| PLN02679 | 360 | hydrolase, alpha/beta fold family protein | 99.45 | |
| KOG1455|consensus | 313 | 99.43 | ||
| TIGR03343 | 282 | biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die | 99.43 | |
| PLN02578 | 354 | hydrolase | 99.43 | |
| TIGR01250 | 288 | pro_imino_pep_2 proline-specific peptidases, Bacil | 99.42 | |
| PRK10985 | 324 | putative hydrolase; Provisional | 99.42 | |
| PLN03087 | 481 | BODYGUARD 1 domain containing hydrolase; Provision | 99.41 | |
| KOG1454|consensus | 326 | 99.4 | ||
| PLN03084 | 383 | alpha/beta hydrolase fold protein; Provisional | 99.4 | |
| TIGR03056 | 278 | bchO_mg_che_rel putative magnesium chelatase acces | 99.4 | |
| PRK03204 | 286 | haloalkane dehalogenase; Provisional | 99.39 | |
| TIGR03611 | 257 | RutD pyrimidine utilization protein D. This protei | 99.39 | |
| TIGR01607 | 332 | PST-A Plasmodium subtelomeric family (PST-A). Thes | 99.37 | |
| TIGR01738 | 245 | bioH putative pimeloyl-BioC--CoA transferase BioH. | 99.37 | |
| COG1647 | 243 | Esterase/lipase [General function prediction only] | 99.37 | |
| PLN02894 | 402 | hydrolase, alpha/beta fold family protein | 99.36 | |
| TIGR02427 | 251 | protocat_pcaD 3-oxoadipate enol-lactonase. Members | 99.36 | |
| TIGR01836 | 350 | PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth | 99.35 | |
| PRK06489 | 360 | hypothetical protein; Provisional | 99.35 | |
| PF01674 | 219 | Lipase_2: Lipase (class 2); InterPro: IPR002918 Li | 99.32 | |
| TIGR03100 | 274 | hydr1_PEP hydrolase, ortholog 1, exosortase system | 99.32 | |
| PRK08775 | 343 | homoserine O-acetyltransferase; Provisional | 99.32 | |
| PLN02872 | 395 | triacylglycerol lipase | 99.28 | |
| TIGR01392 | 351 | homoserO_Ac_trn homoserine O-acetyltransferase. Th | 99.28 | |
| TIGR01249 | 306 | pro_imino_pep_1 proline iminopeptidase, Neisseria- | 99.27 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 99.22 | |
| PRK07581 | 339 | hypothetical protein; Validated | 99.17 | |
| PF05057 | 217 | DUF676: Putative serine esterase (DUF676); InterPr | 99.17 | |
| KOG2382|consensus | 315 | 99.16 | ||
| PRK13604 | 307 | luxD acyl transferase; Provisional | 99.16 | |
| KOG2564|consensus | 343 | 99.12 | ||
| PF12695 | 145 | Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 | 99.11 | |
| PRK11071 | 190 | esterase YqiA; Provisional | 99.11 | |
| TIGR01838 | 532 | PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, | 99.11 | |
| KOG0598|consensus | 357 | 99.1 | ||
| PRK00175 | 379 | metX homoserine O-acetyltransferase; Provisional | 99.1 | |
| KOG4178|consensus | 322 | 99.08 | ||
| PLN02980 | 1655 | 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi | 99.08 | |
| TIGR03230 | 442 | lipo_lipase lipoprotein lipase. Members of this pr | 99.08 | |
| PRK05855 | 582 | short chain dehydrogenase; Validated | 99.07 | |
| cd00707 | 275 | Pancreat_lipase_like Pancreatic lipase-like enzyme | 99.07 | |
| PRK10566 | 249 | esterase; Provisional | 99.06 | |
| PF06028 | 255 | DUF915: Alpha/beta hydrolase of unknown function ( | 99.06 | |
| KOG0616|consensus | 355 | 99.04 | ||
| KOG1838|consensus | 409 | 99.03 | ||
| PRK05077 | 414 | frsA fermentation/respiration switch protein; Revi | 99.03 | |
| PF00561 | 230 | Abhydrolase_1: alpha/beta hydrolase fold A web pag | 99.01 | |
| KOG0605|consensus | 550 | 99.01 | ||
| TIGR03502 | 792 | lipase_Pla1_cef extracellular lipase, Pla-1/cef fa | 99.0 | |
| KOG0580|consensus | 281 | 98.99 | ||
| PLN00021 | 313 | chlorophyllase | 98.9 | |
| COG0429 | 345 | Predicted hydrolase of the alpha/beta-hydrolase fo | 98.89 | |
| KOG3724|consensus | 973 | 98.86 | ||
| COG1075 | 336 | LipA Predicted acetyltransferases and hydrolases w | 98.86 | |
| PRK07868 | 994 | acyl-CoA synthetase; Validated | 98.85 | |
| TIGR01840 | 212 | esterase_phb esterase, PHB depolymerase family. Th | 98.84 | |
| KOG0694|consensus | 694 | 98.83 | ||
| TIGR01839 | 560 | PHA_synth_II poly(R)-hydroxyalkanoic acid synthase | 98.82 | |
| KOG0595|consensus | 429 | 98.78 | ||
| KOG0592|consensus | 604 | 98.77 | ||
| KOG0575|consensus | 592 | 98.76 | ||
| KOG0615|consensus | 475 | 98.76 | ||
| PF00975 | 229 | Thioesterase: Thioesterase domain; InterPro: IPR00 | 98.75 | |
| COG0596 | 282 | MhpC Predicted hydrolases or acyltransferases (alp | 98.73 | |
| KOG0585|consensus | 576 | 98.72 | ||
| PLN02442 | 283 | S-formylglutathione hydrolase | 98.69 | |
| KOG2624|consensus | 403 | 98.66 | ||
| PRK11460 | 232 | putative hydrolase; Provisional | 98.65 | |
| PF06821 | 171 | Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 | 98.65 | |
| TIGR02821 | 275 | fghA_ester_D S-formylglutathione hydrolase. This m | 98.63 | |
| PF10230 | 266 | DUF2305: Uncharacterised conserved protein (DUF230 | 98.6 | |
| TIGR00976 | 550 | /NonD putative hydrolase, CocE/NonD family. This m | 98.59 | |
| COG3545 | 181 | Predicted esterase of the alpha/beta hydrolase fol | 98.56 | |
| KOG0610|consensus | 459 | 98.52 | ||
| KOG0690|consensus | 516 | 98.51 | ||
| PF06342 | 297 | DUF1057: Alpha/beta hydrolase of unknown function | 98.5 | |
| KOG0695|consensus | 593 | 98.49 | ||
| PF08538 | 303 | DUF1749: Protein of unknown function (DUF1749); In | 98.46 | |
| PRK06765 | 389 | homoserine O-acetyltransferase; Provisional | 98.45 | |
| COG4814 | 288 | Uncharacterized protein with an alpha/beta hydrola | 98.45 | |
| KOG4667|consensus | 269 | 98.44 | ||
| KOG0611|consensus | 668 | 98.39 | ||
| PLN02606 | 306 | palmitoyl-protein thioesterase | 98.38 | |
| PF00326 | 213 | Peptidase_S9: Prolyl oligopeptidase family This fa | 98.37 | |
| KOG0597|consensus | 808 | 98.37 | ||
| PF05990 | 233 | DUF900: Alpha/beta hydrolase of unknown function ( | 98.35 | |
| PTZ00263 | 329 | protein kinase A catalytic subunit; Provisional | 98.34 | |
| KOG0600|consensus | 560 | 98.3 | ||
| KOG1035|consensus | 1351 | 98.28 | ||
| cd05626 | 381 | STKc_LATS2 Catalytic domain of the Protein Serine/ | 98.27 | |
| KOG0581|consensus | 364 | 98.27 | ||
| KOG0659|consensus | 318 | 98.26 | ||
| KOG0032|consensus | 382 | 98.25 | ||
| COG3319 | 257 | Thioesterase domains of type I polyketide synthase | 98.24 | |
| cd05599 | 364 | STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel | 98.24 | |
| KOG2029|consensus | 697 | 98.24 | ||
| cd05629 | 377 | STKc_NDR_like_fungal Catalytic domain of Fungal Nu | 98.22 | |
| PHA03212 | 391 | serine/threonine kinase US3; Provisional | 98.22 | |
| cd05628 | 363 | STKc_NDR1 Catalytic domain of the Protein Serine/T | 98.2 | |
| COG2945 | 210 | Predicted hydrolase of the alpha/beta superfamily | 98.2 | |
| cd05598 | 376 | STKc_LATS Catalytic domain of the Protein Serine/T | 98.2 | |
| PF12146 | 79 | Hydrolase_4: Putative lysophospholipase; InterPro: | 98.19 | |
| KOG2541|consensus | 296 | 98.19 | ||
| PF06057 | 192 | VirJ: Bacterial virulence protein (VirJ); InterPro | 98.18 | |
| cd05625 | 382 | STKc_LATS1 Catalytic domain of the Protein Serine/ | 98.18 | |
| PF02089 | 279 | Palm_thioest: Palmitoyl protein thioesterase; Inte | 98.18 | |
| KOG0593|consensus | 396 | 98.18 | ||
| COG4757 | 281 | Predicted alpha/beta hydrolase [General function p | 98.15 | |
| KOG0591|consensus | 375 | 98.15 | ||
| KOG0586|consensus | 596 | 98.15 | ||
| KOG4236|consensus | 888 | 98.14 | ||
| cd05597 | 331 | STKc_DMPK_like Catalytic domain of Myotonic Dystro | 98.13 | |
| PF05728 | 187 | UPF0227: Uncharacterised protein family (UPF0227); | 98.12 | |
| COG3208 | 244 | GrsT Predicted thioesterase involved in non-riboso | 98.11 | |
| KOG0661|consensus | 538 | 98.1 | ||
| cd05596 | 370 | STKc_ROCK Catalytic domain of the Protein Serine/T | 98.1 | |
| cd07871 | 288 | STKc_PCTAIRE3 Catalytic domain of the Serine/Threo | 98.1 | |
| KOG1152|consensus | 772 | 98.09 | ||
| COG3571 | 213 | Predicted hydrolase of the alpha/beta-hydrolase fo | 98.09 | |
| KOG0663|consensus | 419 | 98.08 | ||
| KOG0986|consensus | 591 | 98.07 | ||
| cd05627 | 360 | STKc_NDR2 Catalytic domain of the Protein Serine/T | 98.07 | |
| cd05600 | 333 | STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- | 98.06 | |
| cd05621 | 370 | STKc_ROCK2 Catalytic domain of the Protein Serine/ | 98.06 | |
| cd07869 | 303 | STKc_PFTAIRE1 Catalytic domain of the Serine/Threo | 98.06 | |
| KOG0658|consensus | 364 | 98.05 | ||
| cd05624 | 331 | STKc_MRCK_beta Catalytic domain of the Protein Ser | 98.05 | |
| cd05622 | 371 | STKc_ROCK1 Catalytic domain of the Protein Serine/ | 98.04 | |
| PLN02633 | 314 | palmitoyl protein thioesterase family protein | 98.04 | |
| PTZ00426 | 340 | cAMP-dependent protein kinase catalytic subunit; P | 98.03 | |
| KOG0582|consensus | 516 | 98.03 | ||
| cd05612 | 291 | STKc_PRKX_like Catalytic domain of PRKX-like Prote | 98.0 | |
| PF12740 | 259 | Chlorophyllase2: Chlorophyllase enzyme; InterPro: | 97.99 | |
| KOG0583|consensus | 370 | 97.99 | ||
| KOG1552|consensus | 258 | 97.97 | ||
| PRK10252 | 1296 | entF enterobactin synthase subunit F; Provisional | 97.97 | |
| cd00741 | 153 | Lipase Lipase. Lipases are esterases that can hydr | 97.96 | |
| KOG0612|consensus | 1317 | 97.96 | ||
| cd05573 | 350 | STKc_ROCK_NDR_like Catalytic domain of ROCK- and N | 97.96 | |
| COG3243 | 445 | PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me | 97.96 | |
| cd05623 | 332 | STKc_MRCK_alpha Catalytic domain of the Protein Se | 97.93 | |
| KOG0608|consensus | 1034 | 97.92 | ||
| KOG4717|consensus | 864 | 97.92 | ||
| KOG0594|consensus | 323 | 97.92 | ||
| KOG0662|consensus | 292 | 97.91 | ||
| cd07872 | 309 | STKc_PCTAIRE2 Catalytic domain of the Serine/Threo | 97.89 | |
| cd07873 | 301 | STKc_PCTAIRE1 Catalytic domain of the Serine/Threo | 97.89 | |
| COG2021 | 368 | MET2 Homoserine acetyltransferase [Amino acid tran | 97.89 | |
| cd05601 | 330 | STKc_CRIK Catalytic domain of the Protein Serine/T | 97.87 | |
| cd06649 | 331 | PKc_MEK2 Catalytic domain of the dual-specificity | 97.87 | |
| KOG0588|consensus | 786 | 97.84 | ||
| cd06617 | 283 | PKc_MKK3_6 Catalytic domain of the dual-specificit | 97.84 | |
| PF06500 | 411 | DUF1100: Alpha/beta hydrolase of unknown function | 97.83 | |
| cd07876 | 359 | STKc_JNK2 Catalytic domain of the Serine/Threonine | 97.82 | |
| cd06650 | 333 | PKc_MEK1 Catalytic domain of the dual-specificity | 97.82 | |
| TIGR01849 | 406 | PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, | 97.81 | |
| cd07848 | 287 | STKc_CDKL5 Catalytic domain of the Serine/Threonin | 97.81 | |
| PLN00034 | 353 | mitogen-activated protein kinase kinase; Provision | 97.8 | |
| PHA03209 | 357 | serine/threonine kinase US3; Provisional | 97.8 | |
| KOG0696|consensus | 683 | 97.79 | ||
| PF01738 | 218 | DLH: Dienelactone hydrolase family; InterPro: IPR0 | 97.79 | |
| PTZ00036 | 440 | glycogen synthase kinase; Provisional | 97.77 | |
| KOG0589|consensus | 426 | 97.75 | ||
| cd07844 | 291 | STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like | 97.75 | |
| PRK10162 | 318 | acetyl esterase; Provisional | 97.74 | |
| COG0412 | 236 | Dienelactone hydrolase and related enzymes [Second | 97.73 | |
| cd06615 | 308 | PKc_MEK Catalytic domain of the dual-specificity P | 97.71 | |
| PF00151 | 331 | Lipase: Lipase; InterPro: IPR013818 Triglyceride l | 97.71 | |
| PF01764 | 140 | Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr | 97.7 | |
| cd07874 | 355 | STKc_JNK3 Catalytic domain of the Serine/Threonine | 97.69 | |
| cd06619 | 279 | PKc_MKK5 Catalytic domain of the dual-specificity | 97.68 | |
| PHA03211 | 461 | serine/threonine kinase US3; Provisional | 97.67 | |
| cd05610 | 669 | STKc_MASTL Catalytic domain of the Protein Serine/ | 97.66 | |
| PRK13184 | 932 | pknD serine/threonine-protein kinase; Reviewed | 97.65 | |
| cd05102 | 338 | PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi | 97.65 | |
| cd05580 | 290 | STKc_PKA Catalytic domain of the Protein Serine/Th | 97.64 | |
| cd07870 | 291 | STKc_PFTAIRE2 Catalytic domain of the Serine/Threo | 97.64 | |
| cd07845 | 309 | STKc_CDK10 Catalytic domain of the Serine/Threonin | 97.63 | |
| cd07878 | 343 | STKc_p38beta_MAPK11 Catalytic domain of the Serine | 97.63 | |
| cd08228 | 267 | STKc_Nek6 Catalytic domain of the Protein Serine/T | 97.63 | |
| PF03403 | 379 | PAF-AH_p_II: Platelet-activating factor acetylhydr | 97.61 | |
| cd07875 | 364 | STKc_JNK1 Catalytic domain of the Serine/Threonine | 97.58 | |
| cd06646 | 267 | STKc_MAP4K5 Catalytic domain of the Protein Serine | 97.58 | |
| cd00519 | 229 | Lipase_3 Lipase (class 3). Lipases are esterases t | 97.57 | |
| PTZ00266 | 1021 | NIMA-related protein kinase; Provisional | 97.57 | |
| KOG0198|consensus | 313 | 97.56 | ||
| cd05609 | 305 | STKc_MAST Catalytic domain of the Protein Serine/T | 97.56 | |
| cd05096 | 304 | PTKc_DDR1 Catalytic domain of the Protein Tyrosine | 97.55 | |
| cd06652 | 265 | STKc_MEKK2 Catalytic domain of the Protein Serine/ | 97.54 | |
| cd07877 | 345 | STKc_p38alpha_MAPK14 Catalytic domain of the Serin | 97.54 | |
| cd07850 | 353 | STKc_JNK Catalytic domain of the Serine/Threonine | 97.54 | |
| PLN00009 | 294 | cyclin-dependent kinase A; Provisional | 97.54 | |
| KOG2984|consensus | 277 | 97.53 | ||
| KOG4840|consensus | 299 | 97.53 | ||
| PF07224 | 307 | Chlorophyllase: Chlorophyllase; InterPro: IPR01082 | 97.53 | |
| cd07880 | 343 | STKc_p38gamma_MAPK12 Catalytic domain of the Serin | 97.52 | |
| KOG0577|consensus | 948 | 97.51 | ||
| cd06625 | 263 | STKc_MEKK3_like Catalytic domain of MAP/ERK kinase | 97.5 | |
| cd06656 | 297 | STKc_PAK3 Catalytic domain of the Protein Serine/T | 97.5 | |
| cd06641 | 277 | STKc_MST3 Catalytic domain of the Protein Serine/T | 97.49 | |
| cd07865 | 310 | STKc_CDK9 Catalytic domain of the Serine/Threonine | 97.49 | |
| cd05064 | 266 | PTKc_EphR_A10 Catalytic domain of the Protein Tyro | 97.48 | |
| cd07856 | 328 | STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre | 97.48 | |
| cd07862 | 290 | STKc_CDK6 Catalytic domain of the Serine/Threonine | 97.47 | |
| cd05107 | 401 | PTKc_PDGFR_beta Catalytic domain of the Protein Ty | 97.47 | |
| COG4782 | 377 | Uncharacterized protein conserved in bacteria [Fun | 97.47 | |
| cd05104 | 375 | PTKc_Kit Catalytic domain of the Protein Tyrosine | 97.45 | |
| KOG0667|consensus | 586 | 97.44 | ||
| PF05677 | 365 | DUF818: Chlamydia CHLPS protein (DUF818); InterPro | 97.44 | |
| cd07864 | 302 | STKc_CDK12 Catalytic domain of the Serine/Threonin | 97.44 | |
| cd06645 | 267 | STKc_MAP4K3 Catalytic domain of the Protein Serine | 97.43 | |
| cd06616 | 288 | PKc_MKK4 Catalytic domain of the dual-specificity | 97.42 | |
| cd06639 | 291 | STKc_myosinIIIB Catalytic domain of the Protein Se | 97.42 | |
| cd05103 | 343 | PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi | 97.41 | |
| cd05090 | 283 | PTKc_Ror1 Catalytic domain of the Protein Tyrosine | 97.41 | |
| cd05114 | 256 | PTKc_Tec_Rlk Catalytic domain of the Protein Tyros | 97.4 | |
| cd05108 | 316 | PTKc_EGFR Catalytic domain of the Protein Tyrosine | 97.39 | |
| cd07847 | 286 | STKc_CDKL1_4 Catalytic domain of the Serine/Threon | 97.39 | |
| KOG0033|consensus | 355 | 97.39 | ||
| smart00824 | 212 | PKS_TE Thioesterase. Peptide synthetases are invol | 97.39 | |
| cd08224 | 267 | STKc_Nek6_Nek7 Catalytic domain of the Protein Ser | 97.38 | |
| cd06653 | 264 | STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina | 97.38 | |
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 97.38 | |
| cd06621 | 287 | PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek | 97.38 | |
| cd05105 | 400 | PTKc_PDGFR_alpha Catalytic domain of the Protein T | 97.37 | |
| cd06622 | 286 | PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS | 97.37 | |
| cd08229 | 267 | STKc_Nek7 Catalytic domain of the Protein Serine/T | 97.37 | |
| cd05106 | 374 | PTKc_CSF-1R Catalytic domain of the Protein Tyrosi | 97.36 | |
| cd07868 | 317 | STKc_CDK8 Catalytic domain of the Serine/Threonine | 97.35 | |
| cd06640 | 277 | STKc_MST4 Catalytic domain of the Protein Serine/T | 97.35 | |
| cd06613 | 262 | STKc_MAP4K3_like Catalytic domain of Mitogen-activ | 97.33 | |
| cd05574 | 316 | STKc_phototropin_like Catalytic domain of Phototro | 97.33 | |
| PLN00413 | 479 | triacylglycerol lipase | 97.32 | |
| cd06620 | 284 | PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr | 97.32 | |
| cd07849 | 336 | STKc_ERK1_2_like Catalytic domain of Extracellular | 97.32 | |
| cd05581 | 280 | STKc_PDK1 Catalytic domain of the Protein Serine/T | 97.32 | |
| cd06651 | 266 | STKc_MEKK3 Catalytic domain of the Protein Serine/ | 97.32 | |
| cd06644 | 292 | STKc_STK10_LOK Catalytic domain of the Protein Ser | 97.3 | |
| cd06607 | 307 | STKc_TAO Catalytic domain of the Protein Serine/Th | 97.3 | |
| cd06611 | 280 | STKc_SLK_like Catalytic domain of Ste20-like kinas | 97.3 | |
| cd07879 | 342 | STKc_p38delta_MAPK13 Catalytic domain of the Serin | 97.3 | |
| cd06654 | 296 | STKc_PAK1 Catalytic domain of the Protein Serine/T | 97.29 | |
| KOG4250|consensus | 732 | 97.29 | ||
| cd05072 | 261 | PTKc_Lyn Catalytic domain of the Protein Tyrosine | 97.29 | |
| KOG0201|consensus | 467 | 97.28 | ||
| cd05052 | 263 | PTKc_Abl Catalytic domain of the Protein Tyrosine | 97.28 | |
| cd06638 | 286 | STKc_myosinIIIA Catalytic domain of the Protein Se | 97.28 | |
| PRK05371 | 767 | x-prolyl-dipeptidyl aminopeptidase; Provisional | 97.28 | |
| cd06618 | 296 | PKc_MKK7 Catalytic domain of the dual-specificity | 97.28 | |
| cd07866 | 311 | STKc_BUR1 Catalytic domain of the Serine/Threonine | 97.28 | |
| cd06610 | 267 | STKc_OSR1_SPAK Catalytic domain of the Protein Ser | 97.28 | |
| KOG1553|consensus | 517 | 97.27 | ||
| PLN02162 | 475 | triacylglycerol lipase | 97.27 | |
| cd06608 | 275 | STKc_myosinIII_like Catalytic domain of Class III | 97.26 | |
| PTZ00284 | 467 | protein kinase; Provisional | 97.26 | |
| cd07858 | 337 | STKc_TEY_MAPK_plant Catalytic domain of the Serine | 97.26 | |
| KOG0668|consensus | 338 | 97.26 | ||
| cd07846 | 286 | STKc_CDKL2_3 Catalytic domain of the Serine/Threon | 97.26 | |
| PHA03207 | 392 | serine/threonine kinase US3; Provisional | 97.25 | |
| KOG0660|consensus | 359 | 97.23 | ||
| cd06609 | 274 | STKc_MST3_like Catalytic domain of Mammalian Ste20 | 97.23 | |
| PF11187 | 224 | DUF2974: Protein of unknown function (DUF2974); In | 97.22 | |
| cd07833 | 288 | STKc_CDKL Catalytic domain of Cyclin-Dependent pro | 97.22 | |
| PTZ00267 | 478 | NIMA-related protein kinase; Provisional | 97.22 | |
| cd06629 | 272 | STKc_MAPKKK_Bck1_like Catalytic domain of fungal B | 97.2 | |
| cd07854 | 342 | STKc_MAPK4_6 Catalytic domain of the Serine/Threon | 97.2 | |
| cd05066 | 267 | PTKc_EphR_A Catalytic domain of the Protein Tyrosi | 97.2 | |
| PF06259 | 177 | Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR | 97.19 | |
| PF02230 | 216 | Abhydrolase_2: Phospholipase/Carboxylesterase; Int | 97.19 | |
| cd05091 | 283 | PTKc_Ror2 Catalytic domain of the Protein Tyrosine | 97.19 | |
| PLN02408 | 365 | phospholipase A1 | 97.18 | |
| cd05067 | 260 | PTKc_Lck_Blk Catalytic domain of the Protein Tyros | 97.18 | |
| KOG1006|consensus | 361 | 97.18 | ||
| cd06655 | 296 | STKc_PAK2 Catalytic domain of the Protein Serine/T | 97.17 | |
| cd05113 | 256 | PTKc_Btk_Bmx Catalytic domain of the Protein Tyros | 97.17 | |
| PF11288 | 207 | DUF3089: Protein of unknown function (DUF3089); In | 97.16 | |
| cd06623 | 264 | PKc_MAPKK_plant_like Catalytic domain of Plant dua | 97.15 | |
| PF02129 | 272 | Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam | 97.15 | |
| cd06647 | 293 | STKc_PAK_I Catalytic domain of the Protein Serine/ | 97.14 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 97.14 | |
| cd06612 | 256 | STKc_MST1_2 Catalytic domain of the Protein Serine | 97.14 | |
| cd07855 | 334 | STKc_ERK5 Catalytic domain of the Serine/Threonine | 97.14 | |
| KOG1026|consensus | 774 | 97.14 | ||
| cd05109 | 279 | PTKc_HER2 Catalytic domain of the Protein Tyrosine | 97.13 | |
| cd07867 | 317 | STKc_CDC2L6 Catalytic domain of Serine/Threonine K | 97.13 | |
| cd07843 | 293 | STKc_CDC2L1 Catalytic domain of the Serine/Threoni | 97.13 | |
| PHA03390 | 267 | pk1 serine/threonine-protein kinase 1; Provisional | 97.13 | |
| cd07837 | 295 | STKc_CdkB_plant Catalytic domain of the Serine/Thr | 97.12 | |
| cd05088 | 303 | PTKc_Tie2 Catalytic domain of the Protein Tyrosine | 97.12 | |
| cd05050 | 288 | PTKc_Musk Catalytic domain of the Protein Tyrosine | 97.12 | |
| cd05065 | 269 | PTKc_EphR_B Catalytic domain of the Protein Tyrosi | 97.11 | |
| KOG0194|consensus | 474 | 97.1 | ||
| PF01083 | 179 | Cutinase: Cutinase; InterPro: IPR000675 Aerial pla | 97.1 | |
| cd05032 | 277 | PTKc_InsR_like Catalytic domain of Insulin Recepto | 97.1 | |
| PTZ00024 | 335 | cyclin-dependent protein kinase; Provisional | 97.09 | |
| cd05081 | 284 | PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of | 97.09 | |
| KOG0607|consensus | 463 | 97.07 | ||
| cd05034 | 261 | PTKc_Src_like Catalytic domain of Src kinase-like | 97.06 | |
| PTZ00472 | 462 | serine carboxypeptidase (CBP1); Provisional | 97.06 | |
| KOG2345|consensus | 302 | 97.06 | ||
| PLN02454 | 414 | triacylglycerol lipase | 97.06 | |
| cd07852 | 337 | STKc_MAPK15 Catalytic domain of the Serine/Threoni | 97.06 | |
| PF10503 | 220 | Esterase_phd: Esterase PHB depolymerase | 97.05 | |
| PRK10115 | 686 | protease 2; Provisional | 97.05 | |
| cd05033 | 266 | PTKc_EphR Catalytic domain of Ephrin Receptor Prot | 97.05 | |
| cd05061 | 288 | PTKc_InsR Catalytic domain of the Protein Tyrosine | 97.04 | |
| cd06624 | 268 | STKc_ASK Catalytic domain of the Protein Serine/Th | 97.04 | |
| PLN02934 | 515 | triacylglycerol lipase | 97.04 | |
| cd05048 | 283 | PTKc_Ror Catalytic Domain of the Protein Tyrosine | 97.03 | |
| cd05110 | 303 | PTKc_HER4 Catalytic domain of the Protein Tyrosine | 97.03 | |
| cd05148 | 261 | PTKc_Srm_Brk Catalytic domain of the Protein Tyros | 97.03 | |
| COG2819 | 264 | Predicted hydrolase of the alpha/beta superfamily | 97.02 | |
| cd05111 | 279 | PTK_HER3 Pseudokinase domain of the Protein Tyrosi | 97.02 | |
| cd05059 | 256 | PTKc_Tec_like Catalytic domain of Tec-like Protein | 97.01 | |
| cd05054 | 337 | PTKc_VEGFR Catalytic domain of the Protein Tyrosin | 97.01 | |
| cd05051 | 296 | PTKc_DDR Catalytic domain of the Protein Tyrosine | 97.01 | |
| cd05068 | 261 | PTKc_Frk_like Catalytic domain of Fyn-related kina | 97.0 | |
| cd05071 | 262 | PTKc_Src Catalytic domain of the Protein Tyrosine | 97.0 | |
| KOG0983|consensus | 391 | 96.99 | ||
| PLN02310 | 405 | triacylglycerol lipase | 96.96 | |
| cd06635 | 317 | STKc_TAO1 Catalytic domain of the Protein Serine/T | 96.96 | |
| PF07859 | 211 | Abhydrolase_3: alpha/beta hydrolase fold A web pag | 96.96 | |
| cd05036 | 277 | PTKc_ALK_LTK Catalytic domain of the Protein Tyros | 96.96 | |
| cd06605 | 265 | PKc_MAPKK Catalytic domain of the dual-specificity | 96.95 | |
| cd06643 | 282 | STKc_SLK Catalytic domain of the Protein Serine/Th | 96.95 | |
| KOG0192|consensus | 362 | 96.95 | ||
| cd05039 | 256 | PTKc_Csk_like Catalytic domain of C-terminal Src k | 96.92 | |
| cd05063 | 268 | PTKc_EphR_A2 Catalytic domain of the Protein Tyros | 96.91 | |
| cd06642 | 277 | STKc_STK25-YSK1 Catalytic domain of the Protein Se | 96.9 | |
| cd06633 | 313 | STKc_TAO3 Catalytic domain of the Protein Serine/T | 96.9 | |
| PF07082 | 250 | DUF1350: Protein of unknown function (DUF1350); In | 96.89 | |
| PF05277 | 345 | DUF726: Protein of unknown function (DUF726); Inte | 96.89 | |
| cd05112 | 256 | PTKc_Itk Catalytic domain of the Protein Tyrosine | 96.88 | |
| cd06637 | 272 | STKc_TNIK Catalytic domain of the Protein Serine/T | 96.88 | |
| cd05062 | 277 | PTKc_IGF-1R Catalytic domain of the Protein Tyrosi | 96.87 | |
| KOG1187|consensus | 361 | 96.87 | ||
| PRK09188 | 365 | serine/threonine protein kinase; Provisional | 96.86 | |
| PF00756 | 251 | Esterase: Putative esterase; InterPro: IPR000801 T | 96.86 | |
| cd06636 | 282 | STKc_MAP4K4_6 Catalytic domain of the Protein Seri | 96.86 | |
| COG1506 | 620 | DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept | 96.85 | |
| cd05097 | 295 | PTKc_DDR_like Catalytic domain of Discoidin Domain | 96.84 | |
| cd05055 | 302 | PTKc_PDGFR Catalytic domain of the Protein Tyrosin | 96.83 | |
| cd05101 | 304 | PTKc_FGFR2 Catalytic domain of the Protein Tyrosin | 96.82 | |
| cd05095 | 296 | PTKc_DDR2 Catalytic domain of the Protein Tyrosine | 96.81 | |
| cd05098 | 307 | PTKc_FGFR1 Catalytic domain of the Protein Tyrosin | 96.8 | |
| cd05057 | 279 | PTKc_EGFR_like Catalytic domain of Epidermal Growt | 96.79 | |
| cd05073 | 260 | PTKc_Hck Catalytic domain of the Protein Tyrosine | 96.79 | |
| cd05038 | 284 | PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P | 96.79 | |
| cd05070 | 260 | PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros | 96.76 | |
| cd05080 | 283 | PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the | 96.76 | |
| cd05079 | 284 | PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the | 96.75 | |
| KOG0614|consensus | 732 | 96.74 | ||
| cd06659 | 297 | STKc_PAK6 Catalytic domain of the Protein Serine/T | 96.73 | |
| cd05083 | 254 | PTKc_Chk Catalytic domain of the Protein Tyrosine | 96.72 | |
| cd07851 | 343 | STKc_p38 Catalytic domain of the Serine/Threonine | 96.72 | |
| cd05089 | 297 | PTKc_Tie1 Catalytic domain of the Protein Tyrosine | 96.69 | |
| cd06614 | 286 | STKc_PAK Catalytic domain of the Protein Serine/Th | 96.69 | |
| PHA03210 | 501 | serine/threonine kinase US3; Provisional | 96.68 | |
| KOG1151|consensus | 775 | 96.68 | ||
| PF12048 | 310 | DUF3530: Protein of unknown function (DUF3530); In | 96.67 | |
| KOG0666|consensus | 438 | 96.67 | ||
| cd05053 | 293 | PTKc_FGFR Catalytic domain of the Protein Tyrosine | 96.66 | |
| KOG4391|consensus | 300 | 96.65 | ||
| cd05049 | 280 | PTKc_Trk Catalytic domain of the Protein Tyrosine | 96.62 | |
| cd06917 | 277 | STKc_NAK1_like Catalytic domain of Fungal Nak1-lik | 96.62 | |
| cd06648 | 285 | STKc_PAK_II Catalytic domain of the Protein Serine | 96.62 | |
| PHA02988 | 283 | hypothetical protein; Provisional | 96.61 | |
| cd05093 | 288 | PTKc_TrkB Catalytic domain of the Protein Tyrosine | 96.6 | |
| cd05046 | 275 | PTK_CCK4 Pseudokinase domain of the Protein Tyrosi | 96.59 | |
| cd05092 | 280 | PTKc_TrkA Catalytic domain of the Protein Tyrosine | 96.58 | |
| cd06657 | 292 | STKc_PAK4 Catalytic domain of the Protein Serine/T | 96.57 | |
| KOG0199|consensus | 1039 | 96.56 | ||
| cd05082 | 256 | PTKc_Csk Catalytic domain of the Protein Tyrosine | 96.54 | |
| cd05100 | 334 | PTKc_FGFR3 Catalytic domain of the Protein Tyrosin | 96.54 | |
| cd05069 | 260 | PTKc_Yes Catalytic domain of the Protein Tyrosine | 96.53 | |
| KOG0197|consensus | 468 | 96.51 | ||
| cd06634 | 308 | STKc_TAO2 Catalytic domain of the Protein Serine/T | 96.51 | |
| PLN03037 | 525 | lipase class 3 family protein; Provisional | 96.5 | |
| cd05043 | 280 | PTK_Ryk Pseudokinase domain of Ryk (Receptor relat | 96.47 | |
| PF12715 | 390 | Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 | 96.46 | |
| PLN02802 | 509 | triacylglycerol lipase | 96.46 | |
| PF03583 | 290 | LIP: Secretory lipase ; InterPro: IPR005152 This e | 96.46 | |
| cd05056 | 270 | PTKc_FAK Catalytic domain of the Protein Tyrosine | 96.44 | |
| cd06658 | 292 | STKc_PAK5 Catalytic domain of the Protein Serine/T | 96.44 | |
| KOG0574|consensus | 502 | 96.43 | ||
| KOG1094|consensus | 807 | 96.42 | ||
| KOG0578|consensus | 550 | 96.42 | ||
| cd05094 | 291 | PTKc_TrkC Catalytic domain of the Protein Tyrosine | 96.39 | |
| PLN02571 | 413 | triacylglycerol lipase | 96.33 | |
| KOG3847|consensus | 399 | 96.33 | ||
| KOG1290|consensus | 590 | 96.31 | ||
| KOG0587|consensus | 953 | 96.3 | ||
| PHA02882 | 294 | putative serine/threonine kinase; Provisional | 96.22 | |
| PLN02324 | 415 | triacylglycerol lipase | 96.21 | |
| PF05448 | 320 | AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 | 96.2 | |
| cd05099 | 314 | PTKc_FGFR4 Catalytic domain of the Protein Tyrosin | 96.18 | |
| PRK10439 | 411 | enterobactin/ferric enterobactin esterase; Provisi | 96.16 | |
| COG4188 | 365 | Predicted dienelactone hydrolase [General function | 96.15 | |
| KOG0193|consensus | 678 | 96.15 | ||
| KOG4257|consensus | 974 | 96.15 | ||
| KOG1095|consensus | 1025 | 96.14 | ||
| COG3946 | 456 | VirJ Type IV secretory pathway, VirJ component [In | 96.12 | |
| KOG0576|consensus | 829 | 96.1 | ||
| KOG2052|consensus | 513 | 96.09 | ||
| KOG0584|consensus | 632 | 96.08 | ||
| PF05577 | 434 | Peptidase_S28: Serine carboxypeptidase S28; InterP | 96.07 | |
| PLN02753 | 531 | triacylglycerol lipase | 96.01 | |
| COG3458 | 321 | Acetyl esterase (deacetylase) [Secondary metabolit | 95.97 | |
| KOG1989|consensus | 738 | 95.95 | ||
| PF11339 | 581 | DUF3141: Protein of unknown function (DUF3141); In | 95.91 | |
| KOG4279|consensus | 1226 | 95.83 | ||
| KOG2565|consensus | 469 | 95.83 | ||
| PLN02719 | 518 | triacylglycerol lipase | 95.77 | |
| KOG0984|consensus | 282 | 95.75 | ||
| COG0400 | 207 | Predicted esterase [General function prediction on | 95.75 | |
| KOG3653|consensus | 534 | 95.74 | ||
| PRK04940 | 180 | hypothetical protein; Provisional | 95.69 | |
| KOG3975|consensus | 301 | 95.67 | ||
| KOG4372|consensus | 405 | 95.64 | ||
| KOG1345|consensus | 378 | 95.63 | ||
| KOG3043|consensus | 242 | 95.61 | ||
| PLN02761 | 527 | lipase class 3 family protein | 95.61 | |
| KOG4627|consensus | 270 | 95.61 | ||
| KOG0196|consensus | 996 | 95.58 | ||
| PLN02847 | 633 | triacylglycerol lipase | 95.51 | |
| KOG0579|consensus | 1187 | 95.49 | ||
| KOG4569|consensus | 336 | 95.46 | ||
| PF08840 | 213 | BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term | 95.43 | |
| COG3150 | 191 | Predicted esterase [General function prediction on | 95.43 | |
| KOG2183|consensus | 492 | 95.37 | ||
| KOG4278|consensus | 1157 | 95.32 | ||
| KOG0603|consensus | 612 | 95.29 | ||
| KOG1025|consensus | 1177 | 95.23 | ||
| KOG1163|consensus | 341 | 95.22 | ||
| COG3509 | 312 | LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda | 95.16 | |
| KOG2281|consensus | 867 | 95.06 | ||
| KOG0604|consensus | 400 | 95.05 | ||
| COG0657 | 312 | Aes Esterase/lipase [Lipid metabolism] | 94.99 | |
| KOG0599|consensus | 411 | 94.79 | ||
| KOG4540|consensus | 425 | 94.73 | ||
| COG5153 | 425 | CVT17 Putative lipase essential for disintegration | 94.73 | |
| PLN03225 | 566 | Serine/threonine-protein kinase SNT7; Provisional | 94.38 | |
| PF02273 | 294 | Acyl_transf_2: Acyl transferase; InterPro: IPR0031 | 94.33 | |
| KOG4645|consensus | 1509 | 94.32 | ||
| PLN03224 | 507 | probable serine/threonine protein kinase; Provisio | 94.25 | |
| COG0627 | 316 | Predicted esterase [General function prediction on | 94.14 | |
| KOG3967|consensus | 297 | 93.75 | ||
| KOG2931|consensus | 326 | 93.67 | ||
| PF09752 | 348 | DUF2048: Uncharacterized conserved protein (DUF204 | 93.62 | |
| PRK10345 | 210 | hypothetical protein; Provisional | 93.59 | |
| PF03096 | 283 | Ndr: Ndr family; InterPro: IPR004142 This family c | 93.42 | |
| KOG4721|consensus | 904 | 93.13 | ||
| KOG1515|consensus | 336 | 92.86 | ||
| KOG2237|consensus | 712 | 92.57 | ||
| KOG3101|consensus | 283 | 92.39 | ||
| smart00090 | 237 | RIO RIO-like kinase. | 92.18 | |
| COG2936 | 563 | Predicted acyl esterases [General function predict | 91.94 | |
| KOG0669|consensus | 376 | 91.85 | ||
| COG2272 | 491 | PnbA Carboxylesterase type B [Lipid metabolism] | 91.64 | |
| PRK10359 | 232 | lipopolysaccharide core biosynthesis protein; Prov | 91.6 | |
| KOG1165|consensus | 449 | 90.62 | ||
| COG1770 | 682 | PtrB Protease II [Amino acid transport and metabol | 90.26 | |
| PF11144 | 403 | DUF2920: Protein of unknown function (DUF2920); In | 89.68 | |
| COG4099 | 387 | Predicted peptidase [General function prediction o | 89.42 | |
| PF04083 | 63 | Abhydro_lipase: Partial alpha/beta-hydrolase lipas | 88.76 | |
| KOG2385|consensus | 633 | 88.68 | ||
| KOG2182|consensus | 514 | 88.63 | ||
| PF10340 | 374 | DUF2424: Protein of unknown function (DUF2424); In | 88.42 | |
| PF08237 | 225 | PE-PPE: PE-PPE domain; InterPro: IPR013228 The hum | 88.01 | |
| KOG0670|consensus | 752 | 87.93 | ||
| KOG1167|consensus | 418 | 87.76 | ||
| KOG2112|consensus | 206 | 87.76 | ||
| cd05144 | 198 | RIO2_C RIO kinase family; RIO2, C-terminal catalyt | 87.1 | |
| COG2382 | 299 | Fes Enterochelin esterase and related enzymes [Ino | 87.08 | |
| PRK04750 | 537 | ubiB putative ubiquinone biosynthesis protein UbiB | 86.34 |
| >KOG2369|consensus | Back alignment and domain information |
|---|
Probab=99.97 E-value=9.6e-31 Score=226.80 Aligned_cols=181 Identities=43% Similarity=0.787 Sum_probs=167.3
Q ss_pred cEEEecCCccccceEEec-CCCcce-eeeccCCCCccc--ccccccccccccccccccceeeeeeCCCCCc---------
Q psy4395 14 VRKEMPGDGGSQVEARLN-KTETVH-YICDKTTSNWFT--LWLNLELLVPEVIDCFIDNLRLVYNNVTHPF--------- 80 (283)
Q Consensus 14 pvv~ipG~~gs~L~~~~~-~~~~~~-~~c~~~~~~~~~--~w~~~~~~~~~~~~~~~~~~~l~~~~~~~~~--------- 80 (283)
||++|||.+|+.|++.+. +|+..+ |.|.+.+..+|| +|.+..++++..++||.+...+.+|+.++.+
T Consensus 32 pv~lv~g~gg~~l~~v~~~~p~vv~~W~~~~~a~~~FrkrLW~~~~~l~~~~~~cw~~~~~lvld~~tGLd~pg~~lRvp 111 (473)
T KOG2369|consen 32 PVLLVPGDGGSQLHPVLDGKPGVVRLWVCIKCAEGYFRKRLWLDLNMLLPKTIDCWCDNEHLVLDPETGLDPPGVKLRVP 111 (473)
T ss_pred ceEEecCCccccccceecCCCCEEEEEEeecCchHHHhHHHhhhccccccccccccccceEEeecCccCCCCCcceeecC
Confidence 999999999999999999 899888 999999989997 9999999999999999999999999998776
Q ss_pred cc-------cc-chHHHHHHHHHhCCcccCCCcCcCCCCCCCCC---CcchHHHHHHHHHHHHHHHHcCCCCEEEEEeCc
Q psy4395 81 VR-------VG-SYFSYIAAALVGLGYQRDLSMRGAPYDFRKAP---NENQEYFANFKALIEETYDLNGGTPVVLVAHSM 149 (283)
Q Consensus 81 ~~-------~~-~~~~~l~~~L~~~g~~~~~d~~g~g~~~r~~~---~~~~~~~~~l~~~i~~~~~~~~~~~v~lvgHSm 149 (283)
+- .+ .||+.+++.|...||.-.-+++|++||||++. ...+.++.+|+..||...+.++++||+||+|||
T Consensus 112 gf~s~~~ld~~y~~w~~~i~~lv~~GYe~~~~l~ga~YDwRls~~~~e~rd~yl~kLK~~iE~~~~~~G~kkVvlisHSM 191 (473)
T KOG2369|consen 112 GFESLDYLDPGYWYWHELIENLVGIGYERGKTLFGAPYDWRLSYHNSEERDQYLSKLKKKIETMYKLNGGKKVVLISHSM 191 (473)
T ss_pred CceeeecccchhHHHHHHHHHHHhhCcccCceeeccccchhhccCChhHHHHHHHHHHHHHHHHHHHcCCCceEEEecCC
Confidence 00 11 37999999999999998889999999999954 468899999999999999999988999999999
Q ss_pred ccHHHHHHHHcCCh---hHHhhhhcceEEecCCCCcchhhHHHHhhhc
Q psy4395 150 GSLMCLYFLQRQSS---AWKSKFVRSLVSLAAPWGGSVKAVKVFAVEN 194 (283)
Q Consensus 150 Gg~va~~~~~~~~~---~~~~~~v~~~i~i~~p~~g~~~~~~~~~~g~ 194 (283)
||++.++|+.++++ .|++++|+++|.+++|+.|+++++..+.+|+
T Consensus 192 G~l~~lyFl~w~~~~~~~W~~k~I~sfvnig~p~lG~~k~v~~l~Sge 239 (473)
T KOG2369|consen 192 GGLYVLYFLKWVEAEGPAWCDKYIKSFVNIGAPWLGSPKAVKLLASGE 239 (473)
T ss_pred ccHHHHHHHhcccccchhHHHHHHHHHHccCchhcCChHHHhHhhccc
Confidence 99999999999998 8999999999999999999999999999993
|
|
| >PLN02517 phosphatidylcholine-sterol O-acyltransferase | Back alignment and domain information |
|---|
| >PLN02733 phosphatidylcholine-sterol O-acyltransferase | Back alignment and domain information |
|---|
| >PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 | Back alignment and domain information |
|---|
| >COG2267 PldB Lysophospholipase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK10749 lysophospholipase L2; Provisional | Back alignment and domain information |
|---|
| >PLN02385 hydrolase; alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PHA02857 monoglyceride lipase; Provisional | Back alignment and domain information |
|---|
| >PLN02965 Probable pheophorbidase | Back alignment and domain information |
|---|
| >KOG4409|consensus | Back alignment and domain information |
|---|
| >PLN02298 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase | Back alignment and domain information |
|---|
| >PLN02824 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PLN02211 methyl indole-3-acetate methyltransferase | Back alignment and domain information |
|---|
| >PRK00870 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >PRK03592 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) | Back alignment and domain information |
|---|
| >TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated | Back alignment and domain information |
|---|
| >PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK10673 acyl-CoA esterase; Provisional | Back alignment and domain information |
|---|
| >PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A | Back alignment and domain information |
|---|
| >PRK10349 carboxylesterase BioH; Provisional | Back alignment and domain information |
|---|
| >TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase | Back alignment and domain information |
|---|
| >PLN02511 hydrolase | Back alignment and domain information |
|---|
| >PLN02652 hydrolase; alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PLN02679 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >KOG1455|consensus | Back alignment and domain information |
|---|
| >TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase | Back alignment and domain information |
|---|
| >PLN02578 hydrolase | Back alignment and domain information |
|---|
| >TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily | Back alignment and domain information |
|---|
| >PRK10985 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional | Back alignment and domain information |
|---|
| >KOG1454|consensus | Back alignment and domain information |
|---|
| >PLN03084 alpha/beta hydrolase fold protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein | Back alignment and domain information |
|---|
| >PRK03204 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03611 RutD pyrimidine utilization protein D | Back alignment and domain information |
|---|
| >TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) | Back alignment and domain information |
|---|
| >TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH | Back alignment and domain information |
|---|
| >COG1647 Esterase/lipase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02894 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase | Back alignment and domain information |
|---|
| >TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit | Back alignment and domain information |
|---|
| >PRK06489 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] | Back alignment and domain information |
|---|
| >TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated | Back alignment and domain information |
|---|
| >PRK08775 homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02872 triacylglycerol lipase | Back alignment and domain information |
|---|
| >TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase | Back alignment and domain information |
|---|
| >TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07581 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases | Back alignment and domain information |
|---|
| >KOG2382|consensus | Back alignment and domain information |
|---|
| >PRK13604 luxD acyl transferase; Provisional | Back alignment and domain information |
|---|
| >KOG2564|consensus | Back alignment and domain information |
|---|
| >PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A | Back alignment and domain information |
|---|
| >PRK11071 esterase YqiA; Provisional | Back alignment and domain information |
|---|
| >TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I | Back alignment and domain information |
|---|
| >KOG0598|consensus | Back alignment and domain information |
|---|
| >PRK00175 metX homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG4178|consensus | Back alignment and domain information |
|---|
| >PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding | Back alignment and domain information |
|---|
| >TIGR03230 lipo_lipase lipoprotein lipase | Back alignment and domain information |
|---|
| >PRK05855 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes | Back alignment and domain information |
|---|
| >PRK10566 esterase; Provisional | Back alignment and domain information |
|---|
| >PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like | Back alignment and domain information |
|---|
| >KOG0616|consensus | Back alignment and domain information |
|---|
| >KOG1838|consensus | Back alignment and domain information |
|---|
| >PRK05077 frsA fermentation/respiration switch protein; Reviewed | Back alignment and domain information |
|---|
| >PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases | Back alignment and domain information |
|---|
| >KOG0605|consensus | Back alignment and domain information |
|---|
| >TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family | Back alignment and domain information |
|---|
| >KOG0580|consensus | Back alignment and domain information |
|---|
| >PLN00021 chlorophyllase | Back alignment and domain information |
|---|
| >COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3724|consensus | Back alignment and domain information |
|---|
| >COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07868 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >TIGR01840 esterase_phb esterase, PHB depolymerase family | Back alignment and domain information |
|---|
| >KOG0694|consensus | Back alignment and domain information |
|---|
| >TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II | Back alignment and domain information |
|---|
| >KOG0595|consensus | Back alignment and domain information |
|---|
| >KOG0592|consensus | Back alignment and domain information |
|---|
| >KOG0575|consensus | Back alignment and domain information |
|---|
| >KOG0615|consensus | Back alignment and domain information |
|---|
| >PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] | Back alignment and domain information |
|---|
| >COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0585|consensus | Back alignment and domain information |
|---|
| >PLN02442 S-formylglutathione hydrolase | Back alignment and domain information |
|---|
| >KOG2624|consensus | Back alignment and domain information |
|---|
| >PRK11460 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic | Back alignment and domain information |
|---|
| >TIGR02821 fghA_ester_D S-formylglutathione hydrolase | Back alignment and domain information |
|---|
| >PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function | Back alignment and domain information |
|---|
| >TIGR00976 /NonD putative hydrolase, CocE/NonD family | Back alignment and domain information |
|---|
| >COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0610|consensus | Back alignment and domain information |
|---|
| >KOG0690|consensus | Back alignment and domain information |
|---|
| >PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold | Back alignment and domain information |
|---|
| >KOG0695|consensus | Back alignment and domain information |
|---|
| >PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function | Back alignment and domain information |
|---|
| >PRK06765 homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4667|consensus | Back alignment and domain information |
|---|
| >KOG0611|consensus | Back alignment and domain information |
|---|
| >PLN02606 palmitoyl-protein thioesterase | Back alignment and domain information |
|---|
| >PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification | Back alignment and domain information |
|---|
| >KOG0597|consensus | Back alignment and domain information |
|---|
| >PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like | Back alignment and domain information |
|---|
| >PTZ00263 protein kinase A catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0600|consensus | Back alignment and domain information |
|---|
| >KOG1035|consensus | Back alignment and domain information |
|---|
| >cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 | Back alignment and domain information |
|---|
| >KOG0581|consensus | Back alignment and domain information |
|---|
| >KOG0659|consensus | Back alignment and domain information |
|---|
| >KOG0032|consensus | Back alignment and domain information |
|---|
| >COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG2029|consensus | Back alignment and domain information |
|---|
| >cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >PHA03212 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 | Back alignment and domain information |
|---|
| >COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor | Back alignment and domain information |
|---|
| >PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length | Back alignment and domain information |
|---|
| >KOG2541|consensus | Back alignment and domain information |
|---|
| >PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins | Back alignment and domain information |
|---|
| >cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 | Back alignment and domain information |
|---|
| >PF02089 Palm_thioest: Palmitoyl protein thioesterase; InterPro: IPR002472 Neuronal ceroid lipofuscinoses (NCL) represent a group of encephalopathies that occur in 1 in 12,500 children | Back alignment and domain information |
|---|
| >KOG0593|consensus | Back alignment and domain information |
|---|
| >COG4757 Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0591|consensus | Back alignment and domain information |
|---|
| >KOG0586|consensus | Back alignment and domain information |
|---|
| >KOG4236|consensus | Back alignment and domain information |
|---|
| >cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO | Back alignment and domain information |
|---|
| >COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >KOG0661|consensus | Back alignment and domain information |
|---|
| >cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase | Back alignment and domain information |
|---|
| >KOG1152|consensus | Back alignment and domain information |
|---|
| >COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0663|consensus | Back alignment and domain information |
|---|
| >KOG0986|consensus | Back alignment and domain information |
|---|
| >cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 | Back alignment and domain information |
|---|
| >cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 | Back alignment and domain information |
|---|
| >cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase | Back alignment and domain information |
|---|
| >KOG0658|consensus | Back alignment and domain information |
|---|
| >cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta | Back alignment and domain information |
|---|
| >cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 | Back alignment and domain information |
|---|
| >PLN02633 palmitoyl protein thioesterase family protein | Back alignment and domain information |
|---|
| >PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0582|consensus | Back alignment and domain information |
|---|
| >cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 | Back alignment and domain information |
|---|
| >KOG0583|consensus | Back alignment and domain information |
|---|
| >KOG1552|consensus | Back alignment and domain information |
|---|
| >PRK10252 entF enterobactin synthase subunit F; Provisional | Back alignment and domain information |
|---|
| >cd00741 Lipase Lipase | Back alignment and domain information |
|---|
| >KOG0612|consensus | Back alignment and domain information |
|---|
| >cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] | Back alignment and domain information |
|---|
| >cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha | Back alignment and domain information |
|---|
| >KOG0608|consensus | Back alignment and domain information |
|---|
| >KOG4717|consensus | Back alignment and domain information |
|---|
| >KOG0594|consensus | Back alignment and domain information |
|---|
| >KOG0662|consensus | Back alignment and domain information |
|---|
| >cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase | Back alignment and domain information |
|---|
| >cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase | Back alignment and domain information |
|---|
| >COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase | Back alignment and domain information |
|---|
| >cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 | Back alignment and domain information |
|---|
| >KOG0588|consensus | Back alignment and domain information |
|---|
| >cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 | Back alignment and domain information |
|---|
| >PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] | Back alignment and domain information |
|---|
| >cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 | Back alignment and domain information |
|---|
| >cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 | Back alignment and domain information |
|---|
| >TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular | Back alignment and domain information |
|---|
| >cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 | Back alignment and domain information |
|---|
| >PLN00034 mitogen-activated protein kinase kinase; Provisional | Back alignment and domain information |
|---|
| >PHA03209 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >KOG0696|consensus | Back alignment and domain information |
|---|
| >PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway | Back alignment and domain information |
|---|
| >PTZ00036 glycogen synthase kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0589|consensus | Back alignment and domain information |
|---|
| >cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >PRK10162 acetyl esterase; Provisional | Back alignment and domain information |
|---|
| >COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase | Back alignment and domain information |
|---|
| >PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 | Back alignment and domain information |
|---|
| >PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] | Back alignment and domain information |
|---|
| >cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 | Back alignment and domain information |
|---|
| >cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 | Back alignment and domain information |
|---|
| >PHA03211 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase | Back alignment and domain information |
|---|
| >PRK13184 pknD serine/threonine-protein kinase; Reviewed | Back alignment and domain information |
|---|
| >cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase | Back alignment and domain information |
|---|
| >cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase | Back alignment and domain information |
|---|
| >cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 | Back alignment and domain information |
|---|
| >cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 | Back alignment and domain information |
|---|
| >PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A | Back alignment and domain information |
|---|
| >cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 | Back alignment and domain information |
|---|
| >cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 | Back alignment and domain information |
|---|
| >cd00519 Lipase_3 Lipase (class 3) | Back alignment and domain information |
|---|
| >PTZ00266 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0198|consensus | Back alignment and domain information |
|---|
| >cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase | Back alignment and domain information |
|---|
| >cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 | Back alignment and domain information |
|---|
| >cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 | Back alignment and domain information |
|---|
| >cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase | Back alignment and domain information |
|---|
| >PLN00009 cyclin-dependent kinase A; Provisional | Back alignment and domain information |
|---|
| >KOG2984|consensus | Back alignment and domain information |
|---|
| >KOG4840|consensus | Back alignment and domain information |
|---|
| >PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 | Back alignment and domain information |
|---|
| >cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >KOG0577|consensus | Back alignment and domain information |
|---|
| >cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 | Back alignment and domain information |
|---|
| >cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 | Back alignment and domain information |
|---|
| >cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 | Back alignment and domain information |
|---|
| >cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 | Back alignment and domain information |
|---|
| >cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 | Back alignment and domain information |
|---|
| >cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 | Back alignment and domain information |
|---|
| >cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta | Back alignment and domain information |
|---|
| >COG4782 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit | Back alignment and domain information |
|---|
| >KOG0667|consensus | Back alignment and domain information |
|---|
| >PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins | Back alignment and domain information |
|---|
| >cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 | Back alignment and domain information |
|---|
| >cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 | Back alignment and domain information |
|---|
| >cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 | Back alignment and domain information |
|---|
| >cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin | Back alignment and domain information |
|---|
| >cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 | Back alignment and domain information |
|---|
| >cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase | Back alignment and domain information |
|---|
| >cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor | Back alignment and domain information |
|---|
| >cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 | Back alignment and domain information |
|---|
| >KOG0033|consensus | Back alignment and domain information |
|---|
| >smart00824 PKS_TE Thioesterase | Back alignment and domain information |
|---|
| >cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 | Back alignment and domain information |
|---|
| >cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha | Back alignment and domain information |
|---|
| >cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 | Back alignment and domain information |
|---|
| >cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor | Back alignment and domain information |
|---|
| >cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 | Back alignment and domain information |
|---|
| >cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 | Back alignment and domain information |
|---|
| >cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >PLN00413 triacylglycerol lipase | Back alignment and domain information |
|---|
| >cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 | Back alignment and domain information |
|---|
| >cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 | Back alignment and domain information |
|---|
| >cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase | Back alignment and domain information |
|---|
| >cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins | Back alignment and domain information |
|---|
| >cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 | Back alignment and domain information |
|---|
| >KOG4250|consensus | Back alignment and domain information |
|---|
| >cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn | Back alignment and domain information |
|---|
| >KOG0201|consensus | Back alignment and domain information |
|---|
| >cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase | Back alignment and domain information |
|---|
| >cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin | Back alignment and domain information |
|---|
| >PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional | Back alignment and domain information |
|---|
| >cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 | Back alignment and domain information |
|---|
| >cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins | Back alignment and domain information |
|---|
| >cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase | Back alignment and domain information |
|---|
| >KOG1553|consensus | Back alignment and domain information |
|---|
| >PLN02162 triacylglycerol lipase | Back alignment and domain information |
|---|
| >cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >PTZ00284 protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >KOG0668|consensus | Back alignment and domain information |
|---|
| >cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 | Back alignment and domain information |
|---|
| >PHA03207 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >KOG0660|consensus | Back alignment and domain information |
|---|
| >cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function | Back alignment and domain information |
|---|
| >cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >PTZ00267 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 | Back alignment and domain information |
|---|
| >cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors | Back alignment and domain information |
|---|
| >PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria | Back alignment and domain information |
|---|
| >PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases | Back alignment and domain information |
|---|
| >cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 | Back alignment and domain information |
|---|
| >PLN02408 phospholipase A1 | Back alignment and domain information |
|---|
| >cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk | Back alignment and domain information |
|---|
| >KOG1006|consensus | Back alignment and domain information |
|---|
| >cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 | Back alignment and domain information |
|---|
| >cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome | Back alignment and domain information |
|---|
| >PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function | Back alignment and domain information |
|---|
| >cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins | Back alignment and domain information |
|---|
| >PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] | Back alignment and domain information |
|---|
| >cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 | Back alignment and domain information |
|---|
| >cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 | Back alignment and domain information |
|---|
| >KOG1026|consensus | Back alignment and domain information |
|---|
| >cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 | Back alignment and domain information |
|---|
| >cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 | Back alignment and domain information |
|---|
| >cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 | Back alignment and domain information |
|---|
| >PHA03390 pk1 serine/threonine-protein kinase 1; Provisional | Back alignment and domain information |
|---|
| >cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase | Back alignment and domain information |
|---|
| >cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 | Back alignment and domain information |
|---|
| >cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase | Back alignment and domain information |
|---|
| >cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors | Back alignment and domain information |
|---|
| >KOG0194|consensus | Back alignment and domain information |
|---|
| >PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] | Back alignment and domain information |
|---|
| >cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >PTZ00024 cyclin-dependent protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 | Back alignment and domain information |
|---|
| >KOG0607|consensus | Back alignment and domain information |
|---|
| >cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >PTZ00472 serine carboxypeptidase (CBP1); Provisional | Back alignment and domain information |
|---|
| >KOG2345|consensus | Back alignment and domain information |
|---|
| >PLN02454 triacylglycerol lipase | Back alignment and domain information |
|---|
| >cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 | Back alignment and domain information |
|---|
| >PF10503 Esterase_phd: Esterase PHB depolymerase | Back alignment and domain information |
|---|
| >PRK10115 protease 2; Provisional | Back alignment and domain information |
|---|
| >cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor | Back alignment and domain information |
|---|
| >cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase | Back alignment and domain information |
|---|
| >PLN02934 triacylglycerol lipase | Back alignment and domain information |
|---|
| >cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors | Back alignment and domain information |
|---|
| >cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 | Back alignment and domain information |
|---|
| >cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk | Back alignment and domain information |
|---|
| >COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 | Back alignment and domain information |
|---|
| >cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors | Back alignment and domain information |
|---|
| >cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src | Back alignment and domain information |
|---|
| >KOG0983|consensus | Back alignment and domain information |
|---|
| >PLN02310 triacylglycerol lipase | Back alignment and domain information |
|---|
| >cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 | Back alignment and domain information |
|---|
| >PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases | Back alignment and domain information |
|---|
| >cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase | Back alignment and domain information |
|---|
| >cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase | Back alignment and domain information |
|---|
| >cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase | Back alignment and domain information |
|---|
| >KOG0192|consensus | Back alignment and domain information |
|---|
| >cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 | Back alignment and domain information |
|---|
| >cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 | Back alignment and domain information |
|---|
| >cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 | Back alignment and domain information |
|---|
| >PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants | Back alignment and domain information |
|---|
| >PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins | Back alignment and domain information |
|---|
| >cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase | Back alignment and domain information |
|---|
| >cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase | Back alignment and domain information |
|---|
| >cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor | Back alignment and domain information |
|---|
| >KOG1187|consensus | Back alignment and domain information |
|---|
| >PRK09188 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae | Back alignment and domain information |
|---|
| >cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 | Back alignment and domain information |
|---|
| >COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 | Back alignment and domain information |
|---|
| >cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 | Back alignment and domain information |
|---|
| >cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase | Back alignment and domain information |
|---|
| >cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
| >cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk | Back alignment and domain information |
|---|
| >cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 | Back alignment and domain information |
|---|
| >cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 | Back alignment and domain information |
|---|
| >KOG0614|consensus | Back alignment and domain information |
|---|
| >cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 | Back alignment and domain information |
|---|
| >cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase | Back alignment and domain information |
|---|
| >cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 | Back alignment and domain information |
|---|
| >cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase | Back alignment and domain information |
|---|
| >PHA03210 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >KOG1151|consensus | Back alignment and domain information |
|---|
| >PF12048 DUF3530: Protein of unknown function (DUF3530); InterPro: IPR022529 This family of proteins is functionally uncharacterised | Back alignment and domain information |
|---|
| >KOG0666|consensus | Back alignment and domain information |
|---|
| >cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors | Back alignment and domain information |
|---|
| >KOG4391|consensus | Back alignment and domain information |
|---|
| >cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases | Back alignment and domain information |
|---|
| >cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase | Back alignment and domain information |
|---|
| >PHA02988 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B | Back alignment and domain information |
|---|
| >cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 | Back alignment and domain information |
|---|
| >cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A | Back alignment and domain information |
|---|
| >cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 | Back alignment and domain information |
|---|
| >KOG0199|consensus | Back alignment and domain information |
|---|
| >cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase | Back alignment and domain information |
|---|
| >cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes | Back alignment and domain information |
|---|
| >KOG0197|consensus | Back alignment and domain information |
|---|
| >cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 | Back alignment and domain information |
|---|
| >PLN03037 lipase class 3 family protein; Provisional | Back alignment and domain information |
|---|
| >cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) | Back alignment and domain information |
|---|
| >PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A | Back alignment and domain information |
|---|
| >PLN02802 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases | Back alignment and domain information |
|---|
| >cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase | Back alignment and domain information |
|---|
| >cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 | Back alignment and domain information |
|---|
| >KOG0574|consensus | Back alignment and domain information |
|---|
| >KOG1094|consensus | Back alignment and domain information |
|---|
| >KOG0578|consensus | Back alignment and domain information |
|---|
| >cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C | Back alignment and domain information |
|---|
| >PLN02571 triacylglycerol lipase | Back alignment and domain information |
|---|
| >KOG3847|consensus | Back alignment and domain information |
|---|
| >KOG1290|consensus | Back alignment and domain information |
|---|
| >KOG0587|consensus | Back alignment and domain information |
|---|
| >PHA02882 putative serine/threonine kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02324 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins | Back alignment and domain information |
|---|
| >cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 | Back alignment and domain information |
|---|
| >PRK10439 enterobactin/ferric enterobactin esterase; Provisional | Back alignment and domain information |
|---|
| >COG4188 Predicted dienelactone hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0193|consensus | Back alignment and domain information |
|---|
| >KOG4257|consensus | Back alignment and domain information |
|---|
| >KOG1095|consensus | Back alignment and domain information |
|---|
| >COG3946 VirJ Type IV secretory pathway, VirJ component [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0576|consensus | Back alignment and domain information |
|---|
| >KOG2052|consensus | Back alignment and domain information |
|---|
| >KOG0584|consensus | Back alignment and domain information |
|---|
| >PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PLN02753 triacylglycerol lipase | Back alignment and domain information |
|---|
| >COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >KOG1989|consensus | Back alignment and domain information |
|---|
| >PF11339 DUF3141: Protein of unknown function (DUF3141); InterPro: IPR024501 This family of proteins appears to be predominantly expressed in Proteobacteria | Back alignment and domain information |
|---|
| >KOG4279|consensus | Back alignment and domain information |
|---|
| >KOG2565|consensus | Back alignment and domain information |
|---|
| >PLN02719 triacylglycerol lipase | Back alignment and domain information |
|---|
| >KOG0984|consensus | Back alignment and domain information |
|---|
| >COG0400 Predicted esterase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3653|consensus | Back alignment and domain information |
|---|
| >PRK04940 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3975|consensus | Back alignment and domain information |
|---|
| >KOG4372|consensus | Back alignment and domain information |
|---|
| >KOG1345|consensus | Back alignment and domain information |
|---|
| >KOG3043|consensus | Back alignment and domain information |
|---|
| >PLN02761 lipase class 3 family protein | Back alignment and domain information |
|---|
| >KOG4627|consensus | Back alignment and domain information |
|---|
| >KOG0196|consensus | Back alignment and domain information |
|---|
| >PLN02847 triacylglycerol lipase | Back alignment and domain information |
|---|
| >KOG0579|consensus | Back alignment and domain information |
|---|
| >KOG4569|consensus | Back alignment and domain information |
|---|
| >PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH | Back alignment and domain information |
|---|
| >COG3150 Predicted esterase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2183|consensus | Back alignment and domain information |
|---|
| >KOG4278|consensus | Back alignment and domain information |
|---|
| >KOG0603|consensus | Back alignment and domain information |
|---|
| >KOG1025|consensus | Back alignment and domain information |
|---|
| >KOG1163|consensus | Back alignment and domain information |
|---|
| >COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >KOG2281|consensus | Back alignment and domain information |
|---|
| >KOG0604|consensus | Back alignment and domain information |
|---|
| >COG0657 Aes Esterase/lipase [Lipid metabolism] | Back alignment and domain information |
|---|
| >KOG0599|consensus | Back alignment and domain information |
|---|
| >KOG4540|consensus | Back alignment and domain information |
|---|
| >COG5153 CVT17 Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking and secretion / Lipid metabolism] | Back alignment and domain information |
|---|
| >PLN03225 Serine/threonine-protein kinase SNT7; Provisional | Back alignment and domain information |
|---|
| >PF02273 Acyl_transf_2: Acyl transferase; InterPro: IPR003157 LuxD proteins are bacterial acyl transferases | Back alignment and domain information |
|---|
| >KOG4645|consensus | Back alignment and domain information |
|---|
| >PLN03224 probable serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >COG0627 Predicted esterase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3967|consensus | Back alignment and domain information |
|---|
| >KOG2931|consensus | Back alignment and domain information |
|---|
| >PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function | Back alignment and domain information |
|---|
| >PRK10345 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3 | Back alignment and domain information |
|---|
| >KOG4721|consensus | Back alignment and domain information |
|---|
| >KOG1515|consensus | Back alignment and domain information |
|---|
| >KOG2237|consensus | Back alignment and domain information |
|---|
| >KOG3101|consensus | Back alignment and domain information |
|---|
| >smart00090 RIO RIO-like kinase | Back alignment and domain information |
|---|
| >COG2936 Predicted acyl esterases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0669|consensus | Back alignment and domain information |
|---|
| >COG2272 PnbA Carboxylesterase type B [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK10359 lipopolysaccharide core biosynthesis protein; Provisional | Back alignment and domain information |
|---|
| >KOG1165|consensus | Back alignment and domain information |
|---|
| >COG1770 PtrB Protease II [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function | Back alignment and domain information |
|---|
| >COG4099 Predicted peptidase [General function prediction only] | Back alignment and domain information |
|---|
| >PF04083 Abhydro_lipase: Partial alpha/beta-hydrolase lipase region; InterPro: IPR006693 The alpha/beta hydrolase fold is common to several hydrolytic enzymes of widely differing phylogenetic origin and catalytic function | Back alignment and domain information |
|---|
| >KOG2385|consensus | Back alignment and domain information |
|---|
| >KOG2182|consensus | Back alignment and domain information |
|---|
| >PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters | Back alignment and domain information |
|---|
| >PF08237 PE-PPE: PE-PPE domain; InterPro: IPR013228 The human pathogen Mycobacterium tuberculosis harbours a large number of genes that encode proteins whose N-termini contain the characteristic motifs Pro-Glu (PE) or Pro-Pro-Glu (PPE) | Back alignment and domain information |
|---|
| >KOG0670|consensus | Back alignment and domain information |
|---|
| >KOG1167|consensus | Back alignment and domain information |
|---|
| >KOG2112|consensus | Back alignment and domain information |
|---|
| >cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain | Back alignment and domain information |
|---|
| >COG2382 Fes Enterochelin esterase and related enzymes [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 283 | ||||
| 2bmc_A | 306 | Aurora-2 T287d T288d Complexed With Pha-680632 Leng | 2e-11 | ||
| 2j4z_A | 306 | Structure Of Aurora-2 In Complex With Pha-680626 Le | 2e-11 | ||
| 1muo_A | 297 | Crystal Structure Of Aurora-2, An Oncogenic Serine- | 2e-11 | ||
| 3r21_A | 271 | Design, Synthesis, And Biological Evaluation Of Pyr | 3e-11 | ||
| 2wtv_A | 285 | Aurora-A Inhibitor Structure Length = 285 | 4e-11 | ||
| 2wtw_A | 285 | Aurora-A Inhibitor Structure (2nd Crystal Form) Len | 5e-11 | ||
| 1ol6_A | 282 | Structure Of Unphosphorylated D274n Mutant Of Auror | 5e-11 | ||
| 2xng_A | 283 | Structure Of Aurora-A Bound To A Selective Imidazop | 5e-11 | ||
| 2dwb_A | 285 | Aurora-A Kinase Complexed With Amppnp Length = 285 | 5e-11 | ||
| 3unz_A | 279 | Aurora A In Complex With Rpm1679 Length = 279 | 5e-11 | ||
| 2x6d_A | 285 | Aurora-A Bound To An Inhibitor Length = 285 | 5e-11 | ||
| 3fdn_A | 279 | Structure-Based Drug Design Of Novel Aurora Kinase | 5e-11 | ||
| 1ol5_A | 282 | Structure Of Aurora-A 122-403, Phosphorylated On Th | 5e-11 | ||
| 2c6e_A | 283 | Aurora A Kinase Activated Mutant (T287d) In Complex | 5e-11 | ||
| 2xne_A | 272 | Structure Of Aurora-A Bound To An Imidazopyrazine I | 5e-11 | ||
| 3qbn_A | 281 | Structure Of Human Aurora A In Complex With A Diami | 5e-11 | ||
| 2w1d_A | 275 | Structure Determination Of Aurora Kinase In Complex | 5e-11 | ||
| 2w1c_A | 275 | Structure Determination Of Aurora Kinase In Complex | 5e-11 | ||
| 3nrm_A | 283 | Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito | 6e-11 | ||
| 2c6d_A | 275 | Aurora A Kinase Activated Mutant (T287d) In Complex | 7e-11 | ||
| 3coh_A | 268 | Crystal Structure Of Aurora-A In Complex With A Pen | 1e-10 | ||
| 2xru_A | 280 | Aurora-A T288e Complexed With Pha-828300 Length = 2 | 1e-10 | ||
| 3lau_A | 287 | Crystal Structure Of Aurora2 Kinase In Complex With | 1e-10 | ||
| 2j50_A | 280 | Structure Of Aurora-2 In Complex With Pha-739358 Le | 1e-10 | ||
| 3h0y_A | 268 | Aurora A In Complex With A Bisanilinopyrimidine Len | 1e-10 | ||
| 1mq4_A | 272 | Crystal Structure Of Aurora-A Protein Kinase Length | 1e-10 | ||
| 3ha6_A | 268 | Crystal Structure Of Aurora A In Complex With Tpx2 | 1e-10 | ||
| 3e5a_A | 268 | Crystal Structure Of Aurora A In Complex With Vx-68 | 1e-10 | ||
| 3o50_A | 267 | Crystal Structure Of Benzamide 9 Bound To Auroraa L | 1e-10 | ||
| 2wqe_A | 262 | Structure Of S155r Aurora-A Somatic Mutant Length = | 3e-10 | ||
| 4af3_A | 292 | Human Aurora B Kinase In Complex With Incenp And Vx | 3e-10 | ||
| 3d14_A | 272 | Crystal Structure Of Mouse Aurora A (Asn186->gly, L | 6e-10 | ||
| 3daj_A | 272 | Crystal Structure Of Aurora A Complexed With An Inh | 6e-10 | ||
| 2vrx_A | 285 | Structure Of Aurora B Kinase In Complex With Zm4474 | 2e-09 | ||
| 2bfx_B | 284 | Mechanism Of Aurora-B Activation By Incenp And Inhi | 2e-09 | ||
| 2bfy_A | 284 | Complex Of Aurora-B With Incenp And Hesperidin. Len | 2e-08 |
| >pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 | Back alignment and structure |
|
| >pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 | Back alignment and structure |
| >pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 | Back alignment and structure |
| >pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 | Back alignment and structure |
| >pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 | Back alignment and structure |
| >pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 | Back alignment and structure |
| >pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 | Back alignment and structure |
| >pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 | Back alignment and structure |
| >pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 | Back alignment and structure |
| >pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 | Back alignment and structure |
| >pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 | Back alignment and structure |
| >pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 | Back alignment and structure |
| >pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 | Back alignment and structure |
| >pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 | Back alignment and structure |
| >pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 | Back alignment and structure |
| >pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 | Back alignment and structure |
| >pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 | Back alignment and structure |
| >pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 | Back alignment and structure |
| >pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 | Back alignment and structure |
| >pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 | Back alignment and structure |
| >pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 | Back alignment and structure |
| >pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 | Back alignment and structure |
| >pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 | Back alignment and structure |
| >pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 | Back alignment and structure |
| >pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 | Back alignment and structure |
| >pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 | Back alignment and structure |
| >pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 | Back alignment and structure |
| >pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 | Back alignment and structure |
| >pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 | Back alignment and structure |
| >pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 | Back alignment and structure |
| >pdb|4AF3|A Chain A, Human Aurora B Kinase In Complex With Incenp And Vx-680 Length = 292 | Back alignment and structure |
| >pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 | Back alignment and structure |
| >pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 | Back alignment and structure |
| >pdb|2VRX|A Chain A, Structure Of Aurora B Kinase In Complex With Zm447439 Length = 285 | Back alignment and structure |
| >pdb|2BFY|A Chain A, Complex Of Aurora-B With Incenp And Hesperidin. Length = 284 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 283 | |||
| 3fdn_A | 279 | Serine/threonine-protein kinase 6; aurora kinase i | 3e-17 | |
| 2vgo_A | 284 | Serine/threonine-protein kinase 12-A; nucleotide-b | 8e-17 | |
| 3cok_A | 278 | Serine/threonine-protein kinase PLK4; POLO-like ki | 2e-14 | |
| 1isp_A | 181 | Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 | 5e-13 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 5e-11 | |
| 2rku_A | 294 | Serine/threonine-protein kinase PLK1; structure of | 1e-10 | |
| 2owb_A | 335 | Serine/threonine-protein kinase PLK1; catalytic do | 2e-10 | |
| 1uu3_A | 310 | HPDK1, 3-phosphoinositide dependent protein kinase | 5e-10 | |
| 2x5x_A | 342 | PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE | 9e-10 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 2e-09 | |
| 2pml_X | 348 | PFPK7, Ser/Thr protein kinase; phosphorylati trans | 5e-09 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 5e-09 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 8e-09 | |
| 3icv_A | 316 | Lipase B, CALB; circular permutation, cleavage on | 9e-09 | |
| 1ys1_X | 320 | Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h | 1e-08 | |
| 1tca_A | 317 | Lipase; hydrolase(carboxylic esterase); HET: NAG; | 3e-08 | |
| 1fot_A | 318 | TPK1 delta, CAMP-dependent protein kinase type 1; | 4e-08 | |
| 3fle_A | 249 | SE_1780 protein; structural genomics, APC61035.1, | 1e-07 | |
| 3pvu_A | 695 | Beta-adrenergic receptor kinase 1; transferase, se | 4e-07 | |
| 2zyr_A | 484 | Lipase, putative; fatty acid, hydrolase; HET: 1PE; | 9e-07 | |
| 1ex9_A | 285 | Lactonizing lipase; alpha-beta hydrolase fold, pho | 1e-06 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 1e-06 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 1e-06 | |
| 1xjd_A | 345 | Protein kinase C, theta type; PKC-theta, ATP, AMP, | 1e-06 | |
| 3q60_A | 371 | ROP5B; pseudokinase, transferase; HET: ATP; 1.72A | 1e-06 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 2e-06 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 2e-06 | |
| 1zy4_A | 303 | Serine/threonine-protein kinase GCN2; translation | 2e-06 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 3e-06 | |
| 3ds8_A | 254 | LIN2722 protein; unkonwn function, structural geno | 3e-06 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 5e-06 | |
| 3txo_A | 353 | PKC-L, NPKC-ETA, protein kinase C ETA type; phosph | 6e-06 | |
| 3byv_A | 377 | Rhoptry kinase; malaria, transferase, structural g | 6e-06 | |
| 1o6l_A | 337 | RAC-beta serine/threonine protein kinase; protein | 9e-06 | |
| 2i0e_A | 353 | Protein kinase C-beta II; serine/threonine protein | 1e-05 | |
| 3hko_A | 345 | Calcium/calmodulin-dependent protein kinase with d | 1e-05 | |
| 3aln_A | 327 | Dual specificity mitogen-activated protein kinase; | 1e-05 | |
| 3eqc_A | 360 | Dual specificity mitogen-activated protein kinase; | 1e-05 | |
| 4fr4_A | 384 | YANK1, serine/threonine-protein kinase 32A; struct | 1e-05 | |
| 3a8x_A | 345 | Protein kinase C IOTA type; transferase; HET: TPO; | 2e-05 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 2e-05 | |
| 2jam_A | 304 | Calcium/calmodulin-dependent protein kinase type 1 | 2e-05 | |
| 2a19_B | 284 | Interferon-induced, double-stranded RNA-activated | 2e-05 | |
| 3lp5_A | 250 | Putative cell surface hydrolase; structural genom | 3e-05 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 3e-05 | |
| 3cek_A | 313 | Dual specificity protein kinase TTK; HMPS1, PYT, E | 3e-05 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 3e-05 | |
| 3an0_A | 340 | Dual specificity mitogen-activated protein kinase; | 4e-05 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 4e-05 | |
| 2buj_A | 317 | Serine/threonine-protein kinase 16; transferase, A | 4e-05 | |
| 3p1a_A | 311 | MYT1 kinase, membrane-associated tyrosine- and thr | 5e-05 | |
| 2wei_A | 287 | Calmodulin-domain protein kinase 1, putative; nucl | 5e-05 | |
| 3f3z_A | 277 | Calcium/calmodulin-dependent protein kinase with d | 5e-05 | |
| 3fme_A | 290 | Dual specificity mitogen-activated protein kinase; | 5e-05 | |
| 3pe6_A | 303 | Monoglyceride lipase; alpha-beta hydrolase fold, 2 | 6e-05 | |
| 2wqm_A | 310 | Serine/threonine-protein kinase NEK7; ATP-binding, | 7e-05 | |
| 3hju_A | 342 | Monoglyceride lipase; alpha/beta hydrolase, hydrol | 7e-05 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 7e-05 | |
| 4euu_A | 319 | Serine/threonine-protein kinase TBK1; ATP binding, | 7e-05 | |
| 4eut_A | 396 | Serine/threonine-protein kinase TBK1; ATP binding, | 7e-05 | |
| 3is5_A | 285 | Calcium-dependent protein kinase; CDPK, structural | 8e-05 | |
| 3bhy_A | 283 | Death-associated protein kinase 3; death associate | 1e-04 | |
| 2dyl_A | 318 | Dual specificity mitogen-activated protein kinase | 1e-04 | |
| 3qd2_B | 332 | Eukaryotic translation initiation factor 2-alpha; | 1e-04 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 1e-04 | |
| 4apc_A | 350 | Serine/threonine-protein kinase NEK1; transferase; | 2e-04 | |
| 3dbq_A | 343 | Dual specificity protein kinase TTK; MPS1 structur | 2e-04 | |
| 3g51_A | 325 | Ribosomal protein S6 kinase alpha-3; N-terminal ki | 2e-04 | |
| 3a99_A | 320 | Proto-oncogene serine/threonine-protein kinase PI; | 2e-04 | |
| 2rau_A | 354 | Putative esterase; NP_343859.1, putative lipase, s | 2e-04 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 2e-04 | |
| 2h6d_A | 276 | 5'-AMP-activated protein kinase catalytic subunit | 2e-04 | |
| 4g31_A | 299 | Eukaryotic translation initiation factor 2-alpha; | 2e-04 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 2e-04 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 2e-04 | |
| 2y0a_A | 326 | Death-associated protein kinase 1; transferase, ca | 2e-04 | |
| 3uc3_A | 361 | Serine/threonine-protein kinase SRK2I; SNRK2, ABA | 2e-04 | |
| 3dls_A | 335 | PAS domain-containing serine/threonine-protein KI; | 3e-04 | |
| 2vwi_A | 303 | Serine/threonine-protein kinase OSR1; STE kinase, | 3e-04 | |
| 3qa8_A | 676 | MGC80376 protein; kinase ubiquitin-like domain, ph | 3e-04 | |
| 3soa_A | 444 | Calcium/calmodulin-dependent protein kinase type a | 3e-04 | |
| 2yab_A | 361 | Death-associated protein kinase 2; apoptosis, tran | 3e-04 | |
| 2w5a_A | 279 | Serine/threonine-protein kinase NEK2; Ser/Thr prot | 3e-04 | |
| 1x8b_A | 289 | WEE1HU, WEE1-like protein kinase; cell cycle, tran | 3e-04 | |
| 2a2a_A | 321 | Death-associated protein kinase 2; autoinhibition, | 3e-04 | |
| 1tki_A | 321 | Titin; serine kinase, muscle, autoinhibition; 2.00 | 3e-04 | |
| 2ycf_A | 322 | Serine/threonine-protein kinase CHK2; transferase, | 4e-04 | |
| 2iwi_A | 312 | Serine/threonine-protein kinase PIM-2; nucleotide- | 4e-04 | |
| 3e7e_A | 365 | HBUB1, BUB1A, mitotic checkpoint serine/threonine- | 4e-04 | |
| 2eue_A | 275 | Carbon catabolite derepressing protein kinase; kin | 5e-04 | |
| 2y94_A | 476 | 5'-AMP-activated protein kinase catalytic subunit; | 5e-04 | |
| 3m2w_A | 299 | MAP kinase-activated protein kinase 2; small molec | 5e-04 | |
| 3a62_A | 327 | Ribosomal protein S6 kinase beta-1; kinase domain, | 5e-04 | |
| 3dzo_A | 413 | Rhoptry kinase domain; parasitic disease, transfer | 7e-04 | |
| 2y7j_A | 365 | Phosphorylase B kinase gamma catalytic chain, test | 8e-04 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 9e-04 | |
| 3niz_A | 311 | Rhodanese family protein; structural genomics, str | 9e-04 |
| >3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 | Back alignment and structure |
|---|
Score = 78.8 bits (195), Expect = 3e-17
Identities = 27/55 (49%), Positives = 41/55 (74%)
Query: 216 NKSYRWQMSDFEVGCPLGTGKFGHVYLAKEKTTQIMIALKVLYKVEIINERMTHQ 270
+K +W + DFE+G PLG GKFG+VYLA+EK ++ ++ALKVL+K ++ + HQ
Sbjct: 1 SKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQ 55
|
| >2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 | Back alignment and structure |
|---|
| >3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 | Back alignment and structure |
|---|
| >1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Length = 181 | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 | Back alignment and structure |
|---|
| >2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 | Back alignment and structure |
|---|
| >1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 | Back alignment and structure |
|---|
| >2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Length = 342 | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 | Back alignment and structure |
|---|
| >2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 | Back alignment and structure |
|---|
| >3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Length = 316 | Back alignment and structure |
|---|
| >1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Length = 320 | Back alignment and structure |
|---|
| >1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Length = 317 | Back alignment and structure |
|---|
| >1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 | Back alignment and structure |
|---|
| >3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Length = 249 | Back alignment and structure |
|---|
| >3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 | Back alignment and structure |
|---|
| >2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Length = 484 | Back alignment and structure |
|---|
| >1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Length = 285 | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 | Back alignment and structure |
|---|
| >1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 | Back alignment and structure |
|---|
| >3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Length = 254 | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 | Back alignment and structure |
|---|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 | Back alignment and structure |
|---|
| >1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 | Back alignment and structure |
|---|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 | Back alignment and structure |
|---|
| >3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 | Back alignment and structure |
|---|
| >3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 | Back alignment and structure |
|---|
| >2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 | Back alignment and structure |
|---|
| >2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 | Back alignment and structure |
|---|
| >3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Length = 250 | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 | Back alignment and structure |
|---|
| >3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 | Back alignment and structure |
|---|
| >3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 | Back alignment and structure |
|---|
| >3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Length = 303 | Back alignment and structure |
|---|
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 | Back alignment and structure |
|---|
| >3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Length = 342 | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 | Back alignment and structure |
|---|
| >4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 | Back alignment and structure |
|---|
| >4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 | Back alignment and structure |
|---|
| >3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 | Back alignment and structure |
|---|
| >3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 | Back alignment and structure |
|---|
| >2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 | Back alignment and structure |
|---|
| >3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 | Back alignment and structure |
|---|
| >4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 | Back alignment and structure |
|---|
| >3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 | Back alignment and structure |
|---|
| >2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Length = 354 | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 | Back alignment and structure |
|---|
| >2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 | Back alignment and structure |
|---|
| >4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 | Back alignment and structure |
|---|
| >2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 | Back alignment and structure |
|---|
| >3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 | Back alignment and structure |
|---|
| >2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 | Back alignment and structure |
|---|
| >3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 | Back alignment and structure |
|---|
| >3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 | Back alignment and structure |
|---|
| >2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 | Back alignment and structure |
|---|
| >2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 | Back alignment and structure |
|---|
| >1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 | Back alignment and structure |
|---|
| >2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 | Back alignment and structure |
|---|
| >1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 | Back alignment and structure |
|---|
| >2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 | Back alignment and structure |
|---|
| >2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 | Back alignment and structure |
|---|
| >3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 | Back alignment and structure |
|---|
| >3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 | Back alignment and structure |
|---|
| >3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 283 | |||
| 4fbl_A | 281 | LIPS lipolytic enzyme; thermostable, structural ge | 99.68 | |
| 2wfl_A | 264 | Polyneuridine-aldehyde esterase; alkaloid metaboli | 99.66 | |
| 3icv_A | 316 | Lipase B, CALB; circular permutation, cleavage on | 99.66 | |
| 1ehy_A | 294 | Protein (soluble epoxide hydrolase); alpha/beta hy | 99.65 | |
| 1xkl_A | 273 | SABP2, salicylic acid-binding protein 2; alpha-bet | 99.64 | |
| 1brt_A | 277 | Bromoperoxidase A2; haloperoxidase, oxidoreductase | 99.64 | |
| 3c6x_A | 257 | Hydroxynitrilase; atomic resolution, hydroxynitril | 99.64 | |
| 2xt0_A | 297 | Haloalkane dehalogenase; hydrolase, alpha-beta hyd | 99.63 | |
| 1zoi_A | 276 | Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo | 99.63 | |
| 1r3d_A | 264 | Conserved hypothetical protein VC1974; structural | 99.63 | |
| 2cjp_A | 328 | Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu | 99.63 | |
| 3bf7_A | 255 | Esterase YBFF; thioesterase, helical CAP, hydrolas | 99.63 | |
| 1b6g_A | 310 | Haloalkane dehalogenase; hydrolase, alpha/beta-hyd | 99.63 | |
| 1q0r_A | 298 | RDMC, aclacinomycin methylesterase; anthracycline, | 99.63 | |
| 2wj6_A | 276 | 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid | 99.62 | |
| 3sty_A | 267 | Methylketone synthase 1; alpha/beta hydrolase, dec | 99.62 | |
| 1hkh_A | 279 | Gamma lactamase; hydrolase, alpha/beta hydrolase, | 99.62 | |
| 1a88_A | 275 | Chloroperoxidase L; haloperoxidase, oxidoreductase | 99.61 | |
| 2wtm_A | 251 | EST1E; hydrolase; 1.60A {Clostridium proteoclastic | 99.61 | |
| 1a8q_A | 274 | Bromoperoxidase A1; haloperoxidase, oxidoreductase | 99.6 | |
| 3v48_A | 268 | Aminohydrolase, putative aminoacrylate hydrolase R | 99.6 | |
| 2xua_A | 266 | PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate | 99.6 | |
| 1a8s_A | 273 | Chloroperoxidase F; haloperoxidase, oxidoreductase | 99.6 | |
| 3lp5_A | 250 | Putative cell surface hydrolase; structural genom | 99.6 | |
| 3bwx_A | 285 | Alpha/beta hydrolase; YP_496220.1, joint center fo | 99.59 | |
| 2xmz_A | 269 | Hydrolase, alpha/beta hydrolase fold family; menaq | 99.59 | |
| 1tqh_A | 247 | Carboxylesterase precursor; tetrahedral intermedia | 99.59 | |
| 1iup_A | 282 | META-cleavage product hydrolase; aromatic compound | 99.59 | |
| 2ocg_A | 254 | Valacyclovir hydrolase; alpha beta hydrolase fold; | 99.58 | |
| 3om8_A | 266 | Probable hydrolase; structural genomics, PSI-2, pr | 99.58 | |
| 3pe6_A | 303 | Monoglyceride lipase; alpha-beta hydrolase fold, 2 | 99.58 | |
| 2x5x_A | 342 | PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE | 99.57 | |
| 3fle_A | 249 | SE_1780 protein; structural genomics, APC61035.1, | 99.57 | |
| 3ia2_A | 271 | Arylesterase; alpha-beta hydrolase fold, transitio | 99.57 | |
| 1pja_A | 302 | Palmitoyl-protein thioesterase 2 precursor; hydrol | 99.57 | |
| 3afi_E | 316 | Haloalkane dehalogenase; A/B-hydrolase, hydrolase; | 99.57 | |
| 2yys_A | 286 | Proline iminopeptidase-related protein; TTHA1809, | 99.57 | |
| 3dqz_A | 258 | Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl | 99.56 | |
| 1tht_A | 305 | Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. | 99.56 | |
| 1ex9_A | 285 | Lactonizing lipase; alpha-beta hydrolase fold, pho | 99.56 | |
| 1ys1_X | 320 | Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h | 99.56 | |
| 2puj_A | 286 | 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; | 99.56 | |
| 1tca_A | 317 | Lipase; hydrolase(carboxylic esterase); HET: NAG; | 99.55 | |
| 2wue_A | 291 | 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas | 99.55 | |
| 3ds8_A | 254 | LIN2722 protein; unkonwn function, structural geno | 99.55 | |
| 3fob_A | 281 | Bromoperoxidase; structural genomics, IDP00046, ba | 99.55 | |
| 1wom_A | 271 | RSBQ, sigma factor SIGB regulation protein RSBQ; a | 99.55 | |
| 3pfb_A | 270 | Cinnamoyl esterase; alpha/beta hydrolase fold, hyd | 99.54 | |
| 3hju_A | 342 | Monoglyceride lipase; alpha/beta hydrolase, hydrol | 99.54 | |
| 1mtz_A | 293 | Proline iminopeptidase; alpha-beta hydrolase, CAP | 99.54 | |
| 3nwo_A | 330 | PIP, proline iminopeptidase; structural genomics, | 99.54 | |
| 1k8q_A | 377 | Triacylglycerol lipase, gastric; APHA beta hydrola | 99.54 | |
| 3r0v_A | 262 | Alpha/beta hydrolase fold protein; structural geno | 99.54 | |
| 1m33_A | 258 | BIOH protein; alpha-betta-alpha sandwich, structur | 99.53 | |
| 3ibt_A | 264 | 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, | 99.53 | |
| 3c5v_A | 316 | PME-1, protein phosphatase methylesterase 1; demet | 99.53 | |
| 3qit_A | 286 | CURM TE, polyketide synthase; thioesterase, alpha/ | 99.53 | |
| 3hss_A | 293 | Putative bromoperoxidase; alpha beta hydrolase, ox | 99.52 | |
| 3r40_A | 306 | Fluoroacetate dehalogenase; FACD, defluorinase, al | 99.52 | |
| 3fsg_A | 272 | Alpha/beta superfamily hydrolase; PF00561, MCSG, P | 99.52 | |
| 3kda_A | 301 | CFTR inhibitory factor (CIF); alpha/beta hydrolase | 99.52 | |
| 3u1t_A | 309 | DMMA haloalkane dehalogenase; alpha/beta-hydrolase | 99.52 | |
| 1c4x_A | 285 | BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di | 99.51 | |
| 2psd_A | 318 | Renilla-luciferin 2-monooxygenase; alpha/beta-hydr | 99.51 | |
| 3dkr_A | 251 | Esterase D; alpha beta hydrolase, mechanism, catal | 99.5 | |
| 2q0x_A | 335 | Protein DUF1749, uncharacterized protein; alpha/be | 99.5 | |
| 1isp_A | 181 | Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 | 99.49 | |
| 4f0j_A | 315 | Probable hydrolytic enzyme; alpha/beta hydrolase f | 99.49 | |
| 1ei9_A | 279 | Palmitoyl protein thioesterase 1; alpha/beta hydro | 99.49 | |
| 1azw_A | 313 | Proline iminopeptidase; aminopeptidase, serine pro | 99.49 | |
| 3qvm_A | 282 | OLEI00960; structural genomics, PSI-biology, midwe | 99.48 | |
| 4dnp_A | 269 | DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu | 99.48 | |
| 4g9e_A | 279 | AHL-lactonase, alpha/beta hydrolase fold protein; | 99.47 | |
| 1wm1_A | 317 | Proline iminopeptidase; complex with inhibitor, hy | 99.47 | |
| 1j1i_A | 296 | META cleavage compound hydrolase; carbazole degrad | 99.47 | |
| 2rau_A | 354 | Putative esterase; NP_343859.1, putative lipase, s | 99.47 | |
| 3g9x_A | 299 | Haloalkane dehalogenase; alpha/beta hydrolase, hel | 99.46 | |
| 3qyj_A | 291 | ALR0039 protein; alpha/beta fold, hydrolase; 1.78A | 99.46 | |
| 3rm3_A | 270 | MGLP, thermostable monoacylglycerol lipase; alpha/ | 99.46 | |
| 1u2e_A | 289 | 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase | 99.45 | |
| 3oos_A | 278 | Alpha/beta hydrolase family protein; APC67239.0, p | 99.45 | |
| 2dsn_A | 387 | Thermostable lipase; T1 lipase, hydrolase; 1.50A { | 99.45 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 99.44 | |
| 3llc_A | 270 | Putative hydrolase; structural genomics, joint cen | 99.43 | |
| 2r11_A | 306 | Carboxylesterase NP; 2632844, putative hydrolase, | 99.43 | |
| 2qmq_A | 286 | Protein NDRG2, protein NDR2; alpha/beta-hydrolases | 99.42 | |
| 2e3j_A | 356 | Epoxide hydrolase EPHB; epoxide hydrolase B, struc | 99.42 | |
| 3b12_A | 304 | Fluoroacetate dehalogenase; dehalogease, hydrolase | 99.14 | |
| 3qmv_A | 280 | Thioesterase, REDJ; alpha/beta hydrolase fold, hyd | 99.42 | |
| 2zyr_A | 484 | Lipase, putative; fatty acid, hydrolase; HET: 1PE; | 99.42 | |
| 3p2m_A | 330 | Possible hydrolase; alpha/beta hydrolase superfami | 99.41 | |
| 3l80_A | 292 | Putative uncharacterized protein SMU.1393C; alpha/ | 99.41 | |
| 2qjw_A | 176 | Uncharacterized protein XCC1541; putative hydrolas | 99.41 | |
| 3bdi_A | 207 | Uncharacterized protein TA0194; NP_393672.1, predi | 99.4 | |
| 3i1i_A | 377 | Homoserine O-acetyltransferase; structural genomic | 99.4 | |
| 2hih_A | 431 | Lipase 46 kDa form; A1 phospholipase, phospholipid | 99.4 | |
| 4i19_A | 388 | Epoxide hydrolase; structural genomics, PSI-biolog | 99.39 | |
| 2qvb_A | 297 | Haloalkane dehalogenase 3; RV2579, alpha-beta hydr | 99.39 | |
| 3vdx_A | 456 | Designed 16NM tetrahedral protein CAGE containing | 99.39 | |
| 3trd_A | 208 | Alpha/beta hydrolase; cellular processes; 1.50A {C | 99.38 | |
| 3fla_A | 267 | RIFR; alpha-beta hydrolase thioesterase, hydrolase | 99.38 | |
| 3kxp_A | 314 | Alpha-(N-acetylaminomethylene)succinic acid hydrol | 99.38 | |
| 1mj5_A | 302 | 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; | 99.38 | |
| 1ufo_A | 238 | Hypothetical protein TT1662; alpha-beta fold, hydr | 99.38 | |
| 2i3d_A | 249 | AGR_C_3351P, hypothetical protein ATU1826; structu | 99.38 | |
| 2fuk_A | 220 | XC6422 protein; A/B hydrolase, structural genomics | 99.35 | |
| 3e0x_A | 245 | Lipase-esterase related protein; APC60309, clostri | 99.35 | |
| 1imj_A | 210 | CIB, CCG1-interacting factor B; alpha/beta hydrola | 99.32 | |
| 2pl5_A | 366 | Homoserine O-acetyltransferase; alpha/beta hydrola | 99.31 | |
| 1w52_X | 452 | Pancreatic lipase related protein 2; detergent, cl | 99.31 | |
| 1auo_A | 218 | Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl | 99.3 | |
| 1uxo_A | 192 | YDEN protein; hydrolase, A/B hydrolase, esterase, | 99.3 | |
| 2vat_A | 444 | Acetyl-COA--deacetylcephalosporin C acetyltransfer | 99.3 | |
| 2y6u_A | 398 | Peroxisomal membrane protein LPX1; hydrolase, puta | 99.29 | |
| 3g02_A | 408 | Epoxide hydrolase; alpha/beta hydrolase fold, enan | 99.29 | |
| 3cn9_A | 226 | Carboxylesterase; alpha/beta hydrolase fold super- | 99.29 | |
| 1fj2_A | 232 | Protein (acyl protein thioesterase 1); alpha/beta | 99.29 | |
| 1bu8_A | 452 | Protein (pancreatic lipase related protein 2); hyd | 99.29 | |
| 3ksr_A | 290 | Putative serine hydrolase; catalytic triad, struct | 99.29 | |
| 3lcr_A | 319 | Tautomycetin biosynthetic PKS; alpha-beta hydrolas | 99.29 | |
| 2b61_A | 377 | Homoserine O-acetyltransferase; acyl-enzyme, aspar | 99.28 | |
| 3n2z_B | 446 | Lysosomal Pro-X carboxypeptidase; alpha/beta hydro | 99.26 | |
| 1gpl_A | 432 | RP2 lipase; serine esterase, hydrolase, lipid degr | 99.26 | |
| 2o2g_A | 223 | Dienelactone hydrolase; YP_324580.1, structural ge | 99.26 | |
| 2qs9_A | 194 | Retinoblastoma-binding protein 9; B5T overexpresse | 99.24 | |
| 2h1i_A | 226 | Carboxylesterase; structural genomics, PSI-2, prot | 99.24 | |
| 1qlw_A | 328 | Esterase; anisotropic refinement, atomic resolutio | 99.23 | |
| 3h04_A | 275 | Uncharacterized protein; protein with unknown func | 99.22 | |
| 2pbl_A | 262 | Putative esterase/lipase/thioesterase; alpha/beta- | 99.21 | |
| 2r8b_A | 251 | AGR_C_4453P, uncharacterized protein ATU2452; APC6 | 99.21 | |
| 1jfr_A | 262 | Lipase; serine hydrolase; 1.90A {Streptomyces exfo | 99.21 | |
| 3og9_A | 209 | Protein YAHD A copper inducible hydrolase; alpha/b | 99.21 | |
| 1hpl_A | 449 | Lipase; hydrolase(carboxylic esterase); 2.30A {Equ | 99.2 | |
| 1zi8_A | 236 | Carboxymethylenebutenolidase; alpha and beta prote | 99.19 | |
| 4aw0_A | 311 | HPDK1, 3-phosphoinositide-dependent protein kinase | 99.18 | |
| 3ils_A | 265 | PKS, aflatoxin biosynthesis polyketide synthase; A | 99.18 | |
| 3fnb_A | 405 | Acylaminoacyl peptidase SMU_737; alpha-beta-alpha | 99.18 | |
| 1kez_A | 300 | Erythronolide synthase; polyketide synthase, modul | 99.17 | |
| 2k2q_B | 242 | Surfactin synthetase thioesterase subunit; A/B-hyd | 99.16 | |
| 4fle_A | 202 | Esterase; structural genomics, PSI-biology, northe | 99.16 | |
| 2hdw_A | 367 | Hypothetical protein PA2218; alpha/beta hydrolase | 99.15 | |
| 3b5e_A | 223 | MLL8374 protein; NP_108484.1, carboxylesterase, st | 99.12 | |
| 3bxp_A | 277 | Putative lipase/esterase; putative carboxylesteras | 99.12 | |
| 3f67_A | 241 | Putative dienelactone hydrolase; alpha-beta-alpha | 99.12 | |
| 1rp1_A | 450 | Pancreatic lipase related protein 1; hydrolase, li | 99.12 | |
| 1vkh_A | 273 | Putative serine hydrolase; structural genomics, jo | 99.11 | |
| 3hxk_A | 276 | Sugar hydrolase; alpha-beta protein., structural g | 99.11 | |
| 3bdv_A | 191 | Uncharacterized protein DUF1234; DUF1234 family pr | 99.09 | |
| 3vis_A | 306 | Esterase; alpha/beta-hydrolase fold, polyethylene | 99.09 | |
| 3u0v_A | 239 | Lysophospholipase-like protein 1; alpha, beta hydr | 99.07 | |
| 3mve_A | 415 | FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ | 99.05 | |
| 3k2i_A | 422 | Acyl-coenzyme A thioesterase 4; alpha/beta hydrola | 99.02 | |
| 3d0k_A | 304 | Putative poly(3-hydroxybutyrate) depolymerase LPQ; | 99.02 | |
| 3bjr_A | 283 | Putative carboxylesterase; structural genomics, jo | 99.01 | |
| 3tej_A | 329 | Enterobactin synthase component F; nonribosomal pe | 99.01 | |
| 3v5w_A | 689 | G-protein coupled receptor kinase 2; inhibitor com | 99.01 | |
| 3e4d_A | 278 | Esterase D; S-formylglutathione hydrolase, hydrola | 98.98 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 98.97 | |
| 3hyh_A | 275 | Carbon catabolite-derepressing protein kinase; kin | 98.97 | |
| 4b9d_A | 350 | Serine/threonine-protein kinase NEK1; transferase, | 98.97 | |
| 2o7r_A | 338 | CXE carboxylesterase; alpha/beta hydrolase; 1.40A | 98.97 | |
| 3fcy_A | 346 | Xylan esterase 1; alpha/beta hydrolase, carbohydra | 98.97 | |
| 3hlk_A | 446 | Acyl-coenzyme A thioesterase 2, mitochondrial; alp | 98.96 | |
| 1l7a_A | 318 | Cephalosporin C deacetylase; structural genomics, | 98.96 | |
| 2jbw_A | 386 | Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine | 98.96 | |
| 4e15_A | 303 | Kynurenine formamidase; alpha/beta hydrolase fold, | 98.95 | |
| 3tjm_A | 283 | Fatty acid synthase; thioesterase domain, fatty ac | 98.94 | |
| 2zsh_A | 351 | Probable gibberellin receptor GID1L1; plant hormon | 98.94 | |
| 2hm7_A | 310 | Carboxylesterase; alpha/beta hydrolase fold, hydro | 98.94 | |
| 3d7r_A | 326 | Esterase; alpha/beta fold, hydrolase; 2.01A {Staph | 98.93 | |
| 3h2g_A | 397 | Esterase; xanthomonas oryzae PV. oryzae, cell WALL | 98.91 | |
| 3ain_A | 323 | 303AA long hypothetical esterase; carboxylesterase | 98.91 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 98.9 | |
| 4fih_A | 346 | Serine/threonine-protein kinase PAK 4; kinase doma | 98.9 | |
| 4g31_A | 299 | Eukaryotic translation initiation factor 2-alpha; | 98.9 | |
| 2hfk_A | 319 | Pikromycin, type I polyketide synthase pikaiv; alp | 98.88 | |
| 1vlq_A | 337 | Acetyl xylan esterase; TM0077, structural genomics | 98.88 | |
| 4h0c_A | 210 | Phospholipase/carboxylesterase; PSI-biology, midwe | 98.88 | |
| 2cb9_A | 244 | Fengycin synthetase; thioesterase, non-ribosomal p | 98.88 | |
| 2c7b_A | 311 | Carboxylesterase, ESTE1; carboxyesterase, thermoph | 98.87 | |
| 1jjf_A | 268 | Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x | 98.85 | |
| 3azo_A | 662 | Aminopeptidase; POP family, hydrolase; 2.00A {Stre | 98.85 | |
| 3ubd_A | 304 | Ribosomal protein S6 kinase alpha-3; kinase-inhibi | 98.83 | |
| 3d59_A | 383 | Platelet-activating factor acetylhydrolase; secret | 98.82 | |
| 1jmk_C | 230 | SRFTE, surfactin synthetase; thioesterase, non-rib | 98.82 | |
| 4fie_A | 423 | Serine/threonine-protein kinase PAK 4; kinase doma | 98.81 | |
| 2uz0_A | 263 | Esterase, tributyrin esterase; alpha/beta hydrolas | 98.8 | |
| 2qru_A | 274 | Uncharacterized protein; alpha/beta-hydrolase, str | 98.8 | |
| 4ao6_A | 259 | Esterase; hydrolase, thermo label; 1.60A {Unidenti | 98.8 | |
| 3k6k_A | 322 | Esterase/lipase; alpha/beta hydrolase fold; 2.20A | 98.79 | |
| 1jkm_A | 361 | Brefeldin A esterase; serine hydrolase, degradatio | 98.79 | |
| 3i6y_A | 280 | Esterase APC40077; lipase, structural genomics, PS | 98.78 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 98.77 | |
| 1lzl_A | 323 | Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod | 98.77 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 98.76 | |
| 3g8y_A | 391 | SUSD/RAGB-associated esterase-like protein; struct | 98.76 | |
| 2fx5_A | 258 | Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse | 98.75 | |
| 1jji_A | 311 | Carboxylesterase; alpha-beta hydrolase fold, hydro | 98.73 | |
| 4b99_A | 398 | Mitogen-activated protein kinase 7; transferase, i | 98.72 | |
| 1dqz_A | 280 | 85C, protein (antigen 85-C); fibronectin, structur | 98.72 | |
| 4b6g_A | 283 | Putative esterase; hydrolase, formaldehyde detoxif | 98.72 | |
| 2wir_A | 313 | Pesta, alpha/beta hydrolase fold-3 domain protein; | 98.71 | |
| 3fpq_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 98.69 | |
| 1ycd_A | 243 | Hypothetical 27.3 kDa protein in AAP1-SMF2 interge | 98.68 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 98.68 | |
| 3fcx_A | 282 | FGH, esterase D, S-formylglutathione hydrolase; re | 98.68 | |
| 2dst_A | 131 | Hypothetical protein TTHA1544; conserved hypotheti | 98.66 | |
| 3ls2_A | 280 | S-formylglutathione hydrolase; psychrophilic organ | 98.66 | |
| 4asz_A | 299 | BDNF/NT-3 growth factors receptor; transferase, TR | 98.64 | |
| 1z68_A | 719 | Fibroblast activation protein, alpha subunit; sepr | 98.62 | |
| 1xfd_A | 723 | DIP, dipeptidyl aminopeptidase-like protein 6, dip | 98.62 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 98.62 | |
| 3nuz_A | 398 | Putative acetyl xylan esterase; structural genomic | 98.61 | |
| 1r88_A | 280 | MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP | 98.61 | |
| 1yr2_A | 741 | Prolyl oligopeptidase; prolyl endopeptidase, mecha | 98.6 | |
| 1sfr_A | 304 | Antigen 85-A; alpha/beta hydrolase, structural gen | 98.59 | |
| 1o6l_A | 337 | RAC-beta serine/threonine protein kinase; protein | 98.59 | |
| 3fak_A | 322 | Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc | 98.57 | |
| 4gt4_A | 308 | Tyrosine-protein kinase transmembrane receptor RO; | 98.57 | |
| 1fot_A | 318 | TPK1 delta, CAMP-dependent protein kinase type 1; | 98.56 | |
| 2bkl_A | 695 | Prolyl endopeptidase; mechanistic study, celiac sp | 98.56 | |
| 3hmm_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 98.55 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 98.54 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 98.54 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 98.53 | |
| 4fr4_A | 384 | YANK1, serine/threonine-protein kinase 32A; struct | 98.52 | |
| 2xdw_A | 710 | Prolyl endopeptidase; alpha/beta-hydrolase, amnesi | 98.52 | |
| 3ebl_A | 365 | Gibberellin receptor GID1; alpha/beta hydrolase, l | 98.52 | |
| 1xjd_A | 345 | Protein kinase C, theta type; PKC-theta, ATP, AMP, | 98.52 | |
| 3ga7_A | 326 | Acetyl esterase; phosphoserine, IDP00896, hydrolas | 98.52 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 98.5 | |
| 3iuj_A | 693 | Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas | 98.5 | |
| 4a5s_A | 740 | Dipeptidyl peptidase 4 soluble form; hydrolase, ty | 98.49 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 98.49 | |
| 3txo_A | 353 | PKC-L, NPKC-ETA, protein kinase C ETA type; phosph | 98.48 | |
| 3doh_A | 380 | Esterase; alpha-beta hydrolase, beta sheet; 2.60A | 98.47 | |
| 2xe4_A | 751 | Oligopeptidase B; hydrolase-inhibitor complex, hyd | 98.46 | |
| 4ezi_A | 377 | Uncharacterized protein; alpha-beta hydrolases fol | 98.45 | |
| 1lns_A | 763 | X-prolyl dipeptidyl aminopetidase; alpha beta hydr | 98.44 | |
| 1gkl_A | 297 | Endo-1,4-beta-xylanase Y; hydrolase, esterase fami | 98.44 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 98.43 | |
| 3a8x_A | 345 | Protein kinase C IOTA type; transferase; HET: TPO; | 98.42 | |
| 3iii_A | 560 | COCE/NOND family hydrolase; structural genomics, c | 98.41 | |
| 3fdn_A | 279 | Serine/threonine-protein kinase 6; aurora kinase i | 98.41 | |
| 1mpx_A | 615 | Alpha-amino acid ester hydrolase; alpha/beta hydro | 98.41 | |
| 3h4j_B | 336 | AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin | 98.4 | |
| 2i0e_A | 353 | Protein kinase C-beta II; serine/threonine protein | 98.39 | |
| 3i2k_A | 587 | Cocaine esterase; alpha/beta hydrolase, hydrolase; | 98.37 | |
| 2px6_A | 316 | Thioesterase domain; thioesaterse domain, orlistat | 98.37 | |
| 3o0g_A | 292 | Cell division protein kinase 5; kinase activator c | 98.36 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 98.36 | |
| 4fhz_A | 285 | Phospholipase/carboxylesterase; alpha/beta hydrola | 98.36 | |
| 3uc3_A | 361 | Serine/threonine-protein kinase SRK2I; SNRK2, ABA | 98.36 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 98.35 | |
| 2yab_A | 361 | Death-associated protein kinase 2; apoptosis, tran | 98.35 | |
| 3fe3_A | 328 | MAP/microtubule affinity-regulating kinase 3; seri | 98.33 | |
| 4f9c_A | 361 | Cell division cycle 7-related protein kinase; Ser/ | 98.33 | |
| 3qh4_A | 317 | Esterase LIPW; structural genomics, ssgcid, seattl | 98.32 | |
| 3zgw_A | 347 | Maternal embryonic leucine zipper kinase; transfer | 98.31 | |
| 2y94_A | 476 | 5'-AMP-activated protein kinase catalytic subunit; | 98.31 | |
| 3qd2_B | 332 | Eukaryotic translation initiation factor 2-alpha; | 98.3 | |
| 2zv2_A | 298 | Calcium/calmodulin-dependent protein kinase kinas; | 98.29 | |
| 3c0i_A | 351 | Peripheral plasma membrane protein CASK; neurexin, | 98.27 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 98.27 | |
| 3uqc_A | 286 | Probable conserved transmembrane protein; structur | 98.26 | |
| 3mtl_A | 324 | Cell division protein kinase 16; pctaire1, indirub | 98.26 | |
| 2vgo_A | 284 | Serine/threonine-protein kinase 12-A; nucleotide-b | 98.25 | |
| 3tki_A | 323 | Serine/threonine-protein kinase CHK1; cell checkpo | 98.25 | |
| 3omv_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 98.24 | |
| 2qr7_A | 342 | Ribosomal protein S6 kinase alpha-3; kinase domain | 98.23 | |
| 3fme_A | 290 | Dual specificity mitogen-activated protein kinase; | 98.23 | |
| 1tki_A | 321 | Titin; serine kinase, muscle, autoinhibition; 2.00 | 98.22 | |
| 3gbz_A | 329 | Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- | 98.22 | |
| 2b9v_A | 652 | Alpha-amino acid ester hydrolase; catalytic triad, | 98.21 | |
| 1tib_A | 269 | Lipase; hydrolase(carboxylic esterase); 1.84A {The | 98.21 | |
| 3cok_A | 278 | Serine/threonine-protein kinase PLK4; POLO-like ki | 98.21 | |
| 4hvt_A | 711 | Ritya.17583.B, post-proline cleaving enzyme; ssgci | 98.21 | |
| 3a62_A | 327 | Ribosomal protein S6 kinase beta-1; kinase domain, | 98.2 | |
| 4f0f_A | 287 | Serine/threonine-protein kinase ROCO4; LRRK2, ATP- | 98.2 | |
| 3ork_A | 311 | Serine/threonine protein kinase; structural genomi | 98.19 | |
| 3gni_B | 389 | Strad alpha; kinase fold, pseudokinase, alpha heli | 98.18 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 98.18 | |
| 3s95_A | 310 | LIMK-1, LIM domain kinase 1; structural genomics, | 98.18 | |
| 1ob3_A | 288 | PFPK5, cell division control protein 2 homolog; tr | 98.18 | |
| 2eue_A | 275 | Carbon catabolite derepressing protein kinase; kin | 98.17 | |
| 2r3i_A | 299 | Cell division protein kinase 2; serine/threonine-p | 98.17 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 98.16 | |
| 4euu_A | 319 | Serine/threonine-protein kinase TBK1; ATP binding, | 98.16 | |
| 2y0a_A | 326 | Death-associated protein kinase 1; transferase, ca | 98.16 | |
| 2h6d_A | 276 | 5'-AMP-activated protein kinase catalytic subunit | 98.15 | |
| 3ttj_A | 464 | Mitogen-activated protein kinase 10; JNK3, protein | 98.15 | |
| 3eb0_A | 383 | Putative uncharacterized protein; kinase cryptospo | 98.15 | |
| 3fxz_A | 297 | Serine/threonine-protein kinase PAK 1; transferase | 98.15 | |
| 3soa_A | 444 | Calcium/calmodulin-dependent protein kinase type a | 98.15 | |
| 3aln_A | 327 | Dual specificity mitogen-activated protein kinase; | 98.15 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 98.14 | |
| 3dls_A | 335 | PAS domain-containing serine/threonine-protein KI; | 98.14 | |
| 2pmi_A | 317 | Negative RE, cyclin-dependent protein kinase PHO85 | 98.14 | |
| 4ase_A | 353 | Vascular endothelial growth factor receptor 2; tra | 98.14 | |
| 3g33_A | 308 | Cell division protein kinase 4; Ser/Thr protein ki | 98.13 | |
| 3hko_A | 345 | Calcium/calmodulin-dependent protein kinase with d | 98.13 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 98.12 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 98.12 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 98.12 | |
| 2ycf_A | 322 | Serine/threonine-protein kinase CHK2; transferase, | 98.11 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 98.11 | |
| 4agu_A | 311 | Cyclin-dependent kinase-like 1; transferase, phosp | 98.11 | |
| 4eut_A | 396 | Serine/threonine-protein kinase TBK1; ATP binding, | 98.11 | |
| 3rp9_A | 458 | Mitogen-activated protein kinase; structural genom | 98.11 | |
| 4eqm_A | 294 | Protein kinase; transferase; HET: ANP; 3.00A {Stap | 98.1 | |
| 3kk8_A | 284 | Calcium/calmodulin dependent protein kinase II; AT | 98.1 | |
| 3niz_A | 311 | Rhodanese family protein; structural genomics, str | 98.1 | |
| 3soc_A | 322 | Activin receptor type-2A; structural genomics cons | 98.1 | |
| 2h34_A | 309 | Serine/threonine-protein kinase PKNE; apoenzyme, t | 98.09 | |
| 3an0_A | 340 | Dual specificity mitogen-activated protein kinase; | 98.09 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 98.08 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 98.08 | |
| 3n9x_A | 432 | Phosphotransferase; malaria kinase, structural gen | 98.08 | |
| 2dyl_A | 318 | Dual specificity mitogen-activated protein kinase | 98.07 | |
| 3is5_A | 285 | Calcium-dependent protein kinase; CDPK, structural | 98.07 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 98.06 | |
| 2a2a_A | 321 | Death-associated protein kinase 2; autoinhibition, | 98.06 | |
| 2xrw_A | 371 | Mitogen-activated protein kinase 8; transcription, | 98.06 | |
| 3kn6_A | 325 | Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 | 98.05 | |
| 4exu_A | 371 | Mitogen-activated protein kinase 13; P38 kinase, t | 98.05 | |
| 2vwi_A | 303 | Serine/threonine-protein kinase OSR1; STE kinase, | 98.05 | |
| 2wtk_C | 305 | Serine/threonine-protein kinase 11; transferase-me | 98.04 | |
| 3bhy_A | 283 | Death-associated protein kinase 3; death associate | 98.04 | |
| 1tia_A | 279 | Lipase; hydrolase(carboxylic esterase); 2.10A {Pen | 98.04 | |
| 3llt_A | 360 | Serine/threonine kinase-1, pflammer; lammer kinase | 98.03 | |
| 3eqc_A | 360 | Dual specificity mitogen-activated protein kinase; | 98.03 | |
| 3oz6_A | 388 | Mitogen-activated protein kinase 1, serine/threon | 98.02 | |
| 1ua2_A | 346 | CAK, cell division protein kinase 7; cell cycle, p | 98.02 | |
| 1u5q_A | 348 | Serine/threonine protein kinase TAO2; transferase; | 98.01 | |
| 2jam_A | 304 | Calcium/calmodulin-dependent protein kinase type 1 | 98.01 | |
| 3nsz_A | 330 | CK II alpha, casein kinase II subunit alpha; inhib | 98.01 | |
| 2rku_A | 294 | Serine/threonine-protein kinase PLK1; structure of | 98.01 | |
| 3kfa_A | 288 | Tyrosine-protein kinase ABL1; CML, drug resistance | 98.01 | |
| 1j1b_A | 420 | Glycogen synthase kinase-3 beta; complex, TAU, AMP | 98.01 | |
| 2owb_A | 335 | Serine/threonine-protein kinase PLK1; catalytic do | 98.01 | |
| 3qyz_A | 364 | Mitogen-activated protein kinase 1; transferase, s | 98.0 | |
| 4aaa_A | 331 | Cyclin-dependent kinase-like 2; transferase, phosp | 98.0 | |
| 3f3z_A | 277 | Calcium/calmodulin-dependent protein kinase with d | 97.99 | |
| 2b9h_A | 353 | MAP kinase FUS3, mitogen-activated protein kinase | 97.99 | |
| 3fhr_A | 336 | MAP kinase-activated protein kinase 3; kinase-inhi | 97.98 | |
| 3p1a_A | 311 | MYT1 kinase, membrane-associated tyrosine- and thr | 97.98 | |
| 2yex_A | 276 | Serine/threonine-protein kinase CHK1; transferase, | 97.98 | |
| 1x8b_A | 289 | WEE1HU, WEE1-like protein kinase; cell cycle, tran | 97.98 | |
| 1zy4_A | 303 | Serine/threonine-protein kinase GCN2; translation | 97.98 | |
| 3m2w_A | 299 | MAP kinase-activated protein kinase 2; small molec | 97.97 | |
| 3ugc_A | 295 | Tyrosine-protein kinase JAK2; small molecule inhib | 97.97 | |
| 4f21_A | 246 | Carboxylesterase/phospholipase family protein; str | 97.97 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 97.97 | |
| 2wqm_A | 310 | Serine/threonine-protein kinase NEK7; ATP-binding, | 97.96 | |
| 3coi_A | 353 | Mitogen-activated protein kinase 13; P38D, P38delt | 97.96 | |
| 1nxk_A | 400 | MAP kinase-activated protein kinase 2; MK2, phosph | 97.96 | |
| 3mi9_A | 351 | Cell division protein kinase 9; P-TEFB, HIV-1, pro | 97.96 | |
| 3vhe_A | 359 | Vascular endothelial growth factor receptor 2; kin | 97.96 | |
| 1cm8_A | 367 | Phosphorylated MAP kinase P38-gamma; phosphorylati | 97.95 | |
| 3kmu_A | 271 | ILK, integrin-linked kinase; cell adhesion, ANK re | 97.95 | |
| 4hcu_A | 269 | Tyrosine-protein kinase ITK/TSK; transferase-trans | 97.95 | |
| 2ivs_A | 314 | Proto-oncogene tyrosine-protein kinase receptor RE | 97.95 | |
| 2wei_A | 287 | Calmodulin-domain protein kinase 1, putative; nucl | 97.94 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 97.94 | |
| 3e3p_A | 360 | Protein kinase, putative glycogen synthase kinase; | 97.93 | |
| 4e5w_A | 302 | Tyrosine-protein kinase JAK1; kinase domain, trans | 97.93 | |
| 2j7t_A | 302 | Serine/threonine-protein kinase 10; transferase, A | 97.93 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 97.92 | |
| 4fvq_A | 289 | Tyrosine-protein kinase JAK2; janus protein kinase | 97.92 | |
| 2w5a_A | 279 | Serine/threonine-protein kinase NEK2; Ser/Thr prot | 97.92 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 97.92 | |
| 2c30_A | 321 | Serine/threonine-protein kinase PAK 6; CRIB domain | 97.91 | |
| 2fst_X | 367 | Mitogen-activated protein kinase 14; active mutant | 97.91 | |
| 3guu_A | 462 | Lipase A; protein structure, hydrolase; HET: 1PE; | 97.9 | |
| 1tgl_A | 269 | Triacyl-glycerol acylhydrolase; carboxylic esteras | 97.9 | |
| 2pml_X | 348 | PFPK7, Ser/Thr protein kinase; phosphorylati trans | 97.9 | |
| 1lgy_A | 269 | Lipase, triacylglycerol lipase; hydrolase (carboxy | 97.89 | |
| 2psq_A | 370 | Fibroblast growth factor receptor 2; kinase domain | 97.89 | |
| 2ac3_A | 316 | MAP kinase-interacting serine/threonine kinase 2; | 97.89 | |
| 3com_A | 314 | Serine/threonine-protein kinase 4; MST1, STE20-lik | 97.88 | |
| 1phk_A | 298 | Phosphorylase kinase; glycogen metabolism, transfe | 97.88 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 97.88 | |
| 3gen_A | 283 | Tyrosine-protein kinase BTK; bruton'S tyrosine kin | 97.87 | |
| 1luf_A | 343 | Muscle-specific tyrosine kinase receptor MUSK; pho | 97.87 | |
| 2i6l_A | 320 | Mitogen-activated protein kinase 6; MAPK6, ERK3, e | 97.87 | |
| 3kex_A | 325 | Receptor tyrosine-protein kinase ERBB-3; kinase do | 97.86 | |
| 3q4u_A | 301 | Activin receptor type-1; structural genomics conso | 97.86 | |
| 2buj_A | 317 | Serine/threonine-protein kinase 16; transferase, A | 97.85 | |
| 2izr_A | 330 | Casein kinase I isoform gamma-3; serine/threonine- | 97.84 | |
| 3byv_A | 377 | Rhoptry kinase; malaria, transferase, structural g | 97.84 | |
| 3sxs_A | 268 | Cytoplasmic tyrosine-protein kinase BMX; transfera | 97.84 | |
| 1t4h_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 97.84 | |
| 3a7i_A | 303 | MST3 kinase, serine/threonine kinase 24 (STE20 hom | 97.83 | |
| 2a19_B | 284 | Interferon-induced, double-stranded RNA-activated | 97.81 | |
| 3t9t_A | 267 | Tyrosine-protein kinase ITK/TSK; kinase domain, al | 97.8 | |
| 3qup_A | 323 | Tyrosine-protein kinase receptor TYRO3; protein ki | 97.8 | |
| 3dtc_A | 271 | Mitogen-activated protein kinase kinase kinase 9; | 97.8 | |
| 3cc6_A | 281 | Protein tyrosine kinase 2 beta; focal adhesion kin | 97.8 | |
| 1t46_A | 313 | HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom | 97.79 | |
| 3kvw_A | 429 | DYRK2, dual specificity tyrosine-phosphorylation-r | 97.79 | |
| 3poz_A | 327 | Epidermal growth factor receptor; kinase domain, a | 97.79 | |
| 2iwi_A | 312 | Serine/threonine-protein kinase PIM-2; nucleotide- | 97.79 | |
| 3pg1_A | 362 | Mitogen-activated protein kinase, putative (MAP K | 97.78 | |
| 1fvr_A | 327 | Tyrosine-protein kinase TIE-2; tyrosine kinase, tr | 97.78 | |
| 3lxl_A | 327 | Tyrosine-protein kinase JAK3; TYK2, inflammation, | 97.78 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 97.77 | |
| 3ll6_A | 337 | Cyclin G-associated kinase; transferase, protein k | 97.77 | |
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 97.77 | |
| 1uwc_A | 261 | Feruloyl esterase A; hydrolase, serine esterase, x | 97.76 | |
| 2clq_A | 295 | Mitogen-activated protein kinase kinase kinase 5; | 97.75 | |
| 3lzb_A | 327 | Epidermal growth factor receptor; epidermal growth | 97.75 | |
| 3mdy_A | 337 | Bone morphogenetic protein receptor type-1B; compl | 97.74 | |
| 1xbb_A | 291 | Tyrosine-protein kinase SYK; gleevec, STI-571, ima | 97.74 | |
| 3gxj_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 97.74 | |
| 3a99_A | 320 | Proto-oncogene serine/threonine-protein kinase PI; | 97.72 | |
| 1qpc_A | 279 | LCK kinase; alpha beta fold, transferase; HET: PTR | 97.72 | |
| 2y7j_A | 365 | Phosphorylase B kinase gamma catalytic chain, test | 97.72 | |
| 1rjb_A | 344 | FL cytokine receptor; kinase, structure, autoinhib | 97.72 | |
| 3g2f_A | 336 | Bone morphogenetic protein receptor type-2; kinase | 97.72 | |
| 1b6c_B | 342 | TGF-B superfamily receptor type I; complex (isomer | 97.71 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 97.71 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 97.71 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 97.7 | |
| 3lm5_A | 327 | Serine/threonine-protein kinase 17B; STK17B, serin | 97.7 | |
| 1mp8_A | 281 | Focal adhesion kinase 1; tyrosine protein kinase, | 97.7 | |
| 1byg_A | 278 | CSK, protein (C-terminal SRC kinase); protein kina | 97.69 | |
| 2eva_A | 307 | TAK1 kinase - TAB1 chimera fusion protein; transfe | 97.69 | |
| 2i1m_A | 333 | Macrophage colony-stimulating factor 1 receptor; k | 97.69 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 97.68 | |
| 4e7w_A | 394 | Glycogen synthase kinase 3; GSK3, PTyr195, transfe | 97.67 | |
| 1wak_A | 397 | Serine/threonine-protein kinase SPRK1; SRPK, trans | 97.67 | |
| 2xir_A | 316 | Vascular endothelial growth factor receptor 2; ang | 97.67 | |
| 3uim_A | 326 | Brassinosteroid insensitive 1-associated receptor; | 97.67 | |
| 1p4o_A | 322 | Insulin-like growth factor I receptor protein; IGF | 97.66 | |
| 3lxp_A | 318 | Non-receptor tyrosine-protein kinase TYK2; JAK3, i | 97.66 | |
| 3pls_A | 298 | Macrophage-stimulating protein receptor; protein k | 97.64 | |
| 2w1i_A | 326 | JAK2; chromosomal rearrangement, nucleotide-bindin | 97.63 | |
| 2x7f_A | 326 | TRAF2 and NCK-interacting protein kinase; serine/t | 97.62 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 97.61 | |
| 3g7n_A | 258 | Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A | 97.61 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 97.61 | |
| 3brb_A | 313 | Proto-oncogene tyrosine-protein kinase MER; ATP-bi | 97.61 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 97.6 | |
| 1q8y_A | 373 | SR protein kinase; transferase; HET: ADP ADE; 2.05 | 97.6 | |
| 3op5_A | 364 | Serine/threonine-protein kinase VRK1; adenosine tr | 97.59 | |
| 2qkw_B | 321 | Protein kinase; three-helix bundle motif, AVRPTO-P | 97.56 | |
| 2vx3_A | 382 | Dual specificity tyrosine-phosphorylation- regula | 97.54 | |
| 3uue_A | 279 | LIP1, secretory lipase (family 3); LID-domain, hyd | 97.54 | |
| 1blx_A | 326 | Cyclin-dependent kinase 6; inhibitor protein, cycl | 97.54 | |
| 3rgf_A | 405 | Cyclin-dependent kinase 8; protein kinase complex, | 97.54 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 97.54 | |
| 3e7e_A | 365 | HBUB1, BUB1A, mitotic checkpoint serine/threonine- | 97.53 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 97.52 | |
| 3dbq_A | 343 | Dual specificity protein kinase TTK; MPS1 structur | 97.51 | |
| 4fl3_A | 635 | Tyrosine-protein kinase SYK; transferase; HET: ANP | 97.48 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 97.48 | |
| 1u46_A | 291 | ACK-1, activated CDC42 kinase 1; tyrosine kinase, | 97.47 | |
| 3q60_A | 371 | ROP5B; pseudokinase, transferase; HET: ATP; 1.72A | 97.46 | |
| 1u59_A | 287 | Tyrosine-protein kinase ZAP-70; transferase; HET: | 97.45 | |
| 2rio_A | 434 | Serine/threonine-protein kinase/endoribonuclease I | 97.44 | |
| 2v62_A | 345 | Serine/threonine-protein kinase VRK2; transferase, | 97.43 | |
| 1csn_A | 298 | Casein kinase-1; phosphotransferase; HET: ATP; 2.0 | 97.43 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 97.41 | |
| 3c8d_A | 403 | Enterochelin esterase; alpha-beta-alpha sandwich, | 97.39 | |
| 3p23_A | 432 | Serine/threonine-protein kinase/endoribonuclease; | 97.38 | |
| 3ngm_A | 319 | Extracellular lipase; secret lipase, hydrolase; 2. | 97.38 | |
| 3f66_A | 298 | Hepatocyte growth factor receptor; C-Met, protein | 97.31 | |
| 3o0d_A | 301 | YALI0A20350P, triacylglycerol lipase; alpha/beta-h | 97.29 | |
| 1z57_A | 339 | Dual specificity protein kinase CLK1; protein tyro | 97.28 | |
| 2vuw_A | 336 | Serine/threonine-protein kinase haspin; cell cycle | 97.28 | |
| 2nru_A | 307 | Interleukin-1 receptor-associated kinase 4; inhibi | 97.27 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 97.24 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 97.2 | |
| 3cek_A | 313 | Dual specificity protein kinase TTK; HMPS1, PYT, E | 97.19 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 97.19 | |
| 3og7_A | 289 | AKAP9-BRAF fusion protein; proto-oncogene, V600E, | 97.16 | |
| 3c1x_A | 373 | Hepatocyte growth factor receptor; receptor tyrosi | 97.11 | |
| 2qm0_A | 275 | BES; alpha-beta structure, structural genomics, PS | 97.11 | |
| 2jii_A | 352 | Serine/threonine-protein kinase VRK3 molecule: VA | 97.09 | |
| 3qa8_A | 676 | MGC80376 protein; kinase ubiquitin-like domain, ph | 97.08 | |
| 2eu9_A | 355 | Dual specificity protein kinase CLK3; kinase domai | 96.96 | |
| 4hgt_A | 296 | Casein kinase I isoform delta; CK1D, inhibitor, tr | 96.92 | |
| 3uzp_A | 296 | CKI-delta, CKID, casein kinase I isoform delta; CK | 96.9 | |
| 1qe3_A | 489 | PNB esterase, para-nitrobenzyl esterase; alpha-bet | 96.81 | |
| 2ogt_A | 498 | Thermostable carboxylesterase EST50; alpha/beta hy | 96.74 | |
| 3qpa_A | 197 | Cutinase; alpha-beta hydrolase fold, esterase, hyd | 96.72 | |
| 3qpd_A | 187 | Cutinase 1; alpha-beta hydrolase fold, esterase, h | 96.55 | |
| 3dcn_A | 201 | Cutinase, cutin hydrolase; catalytic triad, secret | 96.5 | |
| 4fol_A | 299 | FGH, S-formylglutathione hydrolase; D-type esteras | 96.48 | |
| 1qoz_A | 207 | AXE, acetyl xylan esterase; hydrolase, xylan degra | 96.44 | |
| 3sv0_A | 483 | Casein kinase I-like; typical kinase domain fold, | 96.42 | |
| 1g66_A | 207 | Acetyl xylan esterase II; serine hydrolase, acetyl | 96.39 | |
| 3gff_A | 331 | IROE-like serine hydrolase; NP_718593.1, structura | 96.38 | |
| 2gzs_A | 278 | IROE protein; enterobactin, salmochelin, DFP, hydr | 96.26 | |
| 2ory_A | 346 | Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph | 96.01 | |
| 3hc7_A | 254 | Gene 12 protein, GP12; alpha/beta sandwich, cell a | 95.98 | |
| 3dzo_A | 413 | Rhoptry kinase domain; parasitic disease, transfer | 95.74 | |
| 2yij_A | 419 | Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid | 94.64 | |
| 2czq_A | 205 | Cutinase-like protein; alpha/beta hydrolase fold, | 95.65 | |
| 4ebb_A | 472 | Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2 | 95.63 |
| >4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A | Back alignment and structure |
|---|
Probab=99.68 E-value=5.8e-17 Score=137.16 Aligned_cols=88 Identities=13% Similarity=0.209 Sum_probs=73.8
Q ss_pred HHHHHHHHHhCCc-ccCCCcCcCCCCCCC-CCCcchHHHHHHHHHHHHHHHHcCCCCEEEEEeCcccHHHHHHHHcCChh
Q psy4395 87 FSYIAAALVGLGY-QRDLSMRGAPYDFRK-APNENQEYFANFKALIEETYDLNGGTPVVLVAHSMGSLMCLYFLQRQSSA 164 (283)
Q Consensus 87 ~~~l~~~L~~~g~-~~~~d~~g~g~~~r~-~~~~~~~~~~~l~~~i~~~~~~~~~~~v~lvgHSmGg~va~~~~~~~~~~ 164 (283)
|..+++.|+++|| |+++|+||||.+... ......++.+|+.++++.+.+.. .+++|+||||||.+++.++..+|+.
T Consensus 67 ~~~la~~La~~Gy~Via~Dl~GhG~S~~~~~~~~~~~~~~d~~~~~~~l~~~~--~~v~lvG~S~GG~ia~~~a~~~p~~ 144 (281)
T 4fbl_A 67 MRFLAEGFARAGYTVATPRLTGHGTTPAEMAASTASDWTADIVAAMRWLEERC--DVLFMTGLSMGGALTVWAAGQFPER 144 (281)
T ss_dssp GHHHHHHHHHTTCEEEECCCTTSSSCHHHHHTCCHHHHHHHHHHHHHHHHHHC--SEEEEEEETHHHHHHHHHHHHSTTT
T ss_pred HHHHHHHHHHCCCEEEEECCCCCCCCCccccCCCHHHHHHHHHHHHHHHHhCC--CeEEEEEECcchHHHHHHHHhCchh
Confidence 4578999999999 999999999977431 22356778899999999887653 4899999999999999999999987
Q ss_pred HHhhhhcceEEecCCCC
Q psy4395 165 WKSKFVRSLVSLAAPWG 181 (283)
Q Consensus 165 ~~~~~v~~~i~i~~p~~ 181 (283)
|+++|+++++..
T Consensus 145 -----v~~lvl~~~~~~ 156 (281)
T 4fbl_A 145 -----FAGIMPINAALR 156 (281)
T ss_dssp -----CSEEEEESCCSC
T ss_pred -----hhhhhcccchhc
Confidence 999999988754
|
| >2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* | Back alignment and structure |
|---|
| >3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* | Back alignment and structure |
|---|
| >1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 | Back alignment and structure |
|---|
| >1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* | Back alignment and structure |
|---|
| >1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A | Back alignment and structure |
|---|
| >3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... | Back alignment and structure |
|---|
| >2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} | Back alignment and structure |
|---|
| >1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A | Back alignment and structure |
|---|
| >1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 | Back alignment and structure |
|---|
| >2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* | Back alignment and structure |
|---|
| >3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A | Back alignment and structure |
|---|
| >1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A | Back alignment and structure |
|---|
| >1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* | Back alignment and structure |
|---|
| >2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* | Back alignment and structure |
|---|
| >3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* | Back alignment and structure |
|---|
| >1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* | Back alignment and structure |
|---|
| >1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* | Back alignment and structure |
|---|
| >1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} | Back alignment and structure |
|---|
| >2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A | Back alignment and structure |
|---|
| >1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A | Back alignment and structure |
|---|
| >2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A | Back alignment and structure |
|---|
| >3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* | Back alignment and structure |
|---|
| >2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A | Back alignment and structure |
|---|
| >3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A | Back alignment and structure |
|---|
| >1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 | Back alignment and structure |
|---|
| >3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* | Back alignment and structure |
|---|
| >2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 | Back alignment and structure |
|---|
| >1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 | Back alignment and structure |
|---|
| >1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E | Back alignment and structure |
|---|
| >2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A | Back alignment and structure |
|---|
| >1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* | Back alignment and structure |
|---|
| >2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A | Back alignment and structure |
|---|
| >3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} | Back alignment and structure |
|---|
| >3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* | Back alignment and structure |
|---|
| >3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* | Back alignment and structure |
|---|
| >3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A | Back alignment and structure |
|---|
| >3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* | Back alignment and structure |
|---|
| >3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 | Back alignment and structure |
|---|
| >3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P | Back alignment and structure |
|---|
| >3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} | Back alignment and structure |
|---|
| >3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A | Back alignment and structure |
|---|
| >3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A | Back alignment and structure |
|---|
| >3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} | Back alignment and structure |
|---|
| >3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A | Back alignment and structure |
|---|
| >3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} | Back alignment and structure |
|---|
| >1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 | Back alignment and structure |
|---|
| >2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A | Back alignment and structure |
|---|
| >3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A | Back alignment and structure |
|---|
| >2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A | Back alignment and structure |
|---|
| >4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A | Back alignment and structure |
|---|
| >1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 | Back alignment and structure |
|---|
| >3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} | Back alignment and structure |
|---|
| >4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A | Back alignment and structure |
|---|
| >4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A | Back alignment and structure |
|---|
| >1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* | Back alignment and structure |
|---|
| >1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 | Back alignment and structure |
|---|
| >2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A | Back alignment and structure |
|---|
| >3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} | Back alignment and structure |
|---|
| >3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A | Back alignment and structure |
|---|
| >1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} | Back alignment and structure |
|---|
| >2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A | Back alignment and structure |
|---|
| >2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* | Back alignment and structure |
|---|
| >3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A | Back alignment and structure |
|---|
| >3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* | Back alignment and structure |
|---|
| >2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* | Back alignment and structure |
|---|
| >3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} | Back alignment and structure |
|---|
| >4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} | Back alignment and structure |
|---|
| >2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A | Back alignment and structure |
|---|
| >3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A | Back alignment and structure |
|---|
| >3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* | Back alignment and structure |
|---|
| >3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A | Back alignment and structure |
|---|
| >1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 | Back alignment and structure |
|---|
| >2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 | Back alignment and structure |
|---|
| >2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 | Back alignment and structure |
|---|
| >3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 | Back alignment and structure |
|---|
| >2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 | Back alignment and structure |
|---|
| >1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} | Back alignment and structure |
|---|
| >1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* | Back alignment and structure |
|---|
| >1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 | Back alignment and structure |
|---|
| >2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* | Back alignment and structure |
|---|
| >2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* | Back alignment and structure |
|---|
| >3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* | Back alignment and structure |
|---|
| >3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* | Back alignment and structure |
|---|
| >1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* | Back alignment and structure |
|---|
| >3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} | Back alignment and structure |
|---|
| >2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 | Back alignment and structure |
|---|
| >3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} | Back alignment and structure |
|---|
| >1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A | Back alignment and structure |
|---|
| >2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} | Back alignment and structure |
|---|
| >2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* | Back alignment and structure |
|---|
| >3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 | Back alignment and structure |
|---|
| >3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 | Back alignment and structure |
|---|
| >1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* | Back alignment and structure |
|---|
| >4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... | Back alignment and structure |
|---|
| >3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} | Back alignment and structure |
|---|
| >3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A | Back alignment and structure |
|---|
| >2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A | Back alignment and structure |
|---|
| >4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* | Back alignment and structure |
|---|
| >3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A | Back alignment and structure |
|---|
| >1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 | Back alignment and structure |
|---|
| >3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} | Back alignment and structure |
|---|
| >3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} | Back alignment and structure |
|---|
| >3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A | Back alignment and structure |
|---|
| >3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} | Back alignment and structure |
|---|
| >3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A | Back alignment and structure |
|---|
| >3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A | Back alignment and structure |
|---|
| >3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A | Back alignment and structure |
|---|
| >4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* | Back alignment and structure |
|---|
| >2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A | Back alignment and structure |
|---|
| >3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} | Back alignment and structure |
|---|
| >3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* | Back alignment and structure |
|---|
| >2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 | Back alignment and structure |
|---|
| >4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A | Back alignment and structure |
|---|
| >3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A | Back alignment and structure |
|---|
| >2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* | Back alignment and structure |
|---|
| >2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A | Back alignment and structure |
|---|
| >3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A | Back alignment and structure |
|---|
| >3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* | Back alignment and structure |
|---|
| >4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* | Back alignment and structure |
|---|
| >4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* | Back alignment and structure |
|---|
| >2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A | Back alignment and structure |
|---|
| >1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* | Back alignment and structure |
|---|
| >4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* | Back alignment and structure |
|---|
| >2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} | Back alignment and structure |
|---|
| >1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* | Back alignment and structure |
|---|
| >3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A | Back alignment and structure |
|---|
| >3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* | Back alignment and structure |
|---|
| >3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* | Back alignment and structure |
|---|
| >1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 | Back alignment and structure |
|---|
| >4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} | Back alignment and structure |
|---|
| >2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A | Back alignment and structure |
|---|
| >3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A | Back alignment and structure |
|---|
| >1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} | Back alignment and structure |
|---|
| >2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} | Back alignment and structure |
|---|
| >1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* | Back alignment and structure |
|---|
| >4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 | Back alignment and structure |
|---|
| >3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* | Back alignment and structure |
|---|
| >1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 | Back alignment and structure |
|---|
| >1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} | Back alignment and structure |
|---|
| >1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 | Back alignment and structure |
|---|
| >1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... | Back alignment and structure |
|---|
| >3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A | Back alignment and structure |
|---|
| >4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A | Back alignment and structure |
|---|
| >1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* | Back alignment and structure |
|---|
| >3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* | Back alignment and structure |
|---|
| >3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* | Back alignment and structure |
|---|
| >3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* | Back alignment and structure |
|---|
| >4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A | Back alignment and structure |
|---|
| >2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} | Back alignment and structure |
|---|
| >4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 | Back alignment and structure |
|---|
| >1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* | Back alignment and structure |
|---|
| >3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* | Back alignment and structure |
|---|
| >3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* | Back alignment and structure |
|---|
| >3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... | Back alignment and structure |
|---|
| >1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 | Back alignment and structure |
|---|
| >3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* | Back alignment and structure |
|---|
| >3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A | Back alignment and structure |
|---|
| >2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* | Back alignment and structure |
|---|
| >4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* | Back alignment and structure |
|---|
| >3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B | Back alignment and structure |
|---|
| >2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* | Back alignment and structure |
|---|
| >3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A | Back alignment and structure |
|---|
| >4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* | Back alignment and structure |
|---|
| >3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} | Back alignment and structure |
|---|
| >2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A | Back alignment and structure |
|---|
| >3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... | Back alignment and structure |
|---|
| >3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* | Back alignment and structure |
|---|
| >3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A | Back alignment and structure |
|---|
| >3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A | Back alignment and structure |
|---|
| >1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* | Back alignment and structure |
|---|
| >2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A | Back alignment and structure |
|---|
| >1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* | Back alignment and structure |
|---|
| >3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* | Back alignment and structure |
|---|
| >3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* | Back alignment and structure |
|---|
| >3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A | Back alignment and structure |
|---|
| >2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A | Back alignment and structure |
|---|
| >4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* | Back alignment and structure |
|---|
| >3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* | Back alignment and structure |
|---|
| >3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* | Back alignment and structure |
|---|
| >3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* | Back alignment and structure |
|---|
| >4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* | Back alignment and structure |
|---|
| >3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* | Back alignment and structure |
|---|
| >3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* | Back alignment and structure |
|---|
| >3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* | Back alignment and structure |
|---|
| >2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* | Back alignment and structure |
|---|
| >2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A | Back alignment and structure |
|---|
| >2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... | Back alignment and structure |
|---|
| >3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A | Back alignment and structure |
|---|
| >4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A | Back alignment and structure |
|---|
| >2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* | Back alignment and structure |
|---|
| >2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... | Back alignment and structure |
|---|
| >1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 | Back alignment and structure |
|---|
| >3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... | Back alignment and structure |
|---|
| >3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* | Back alignment and structure |
|---|
| >2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A | Back alignment and structure |
|---|
| >3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... | Back alignment and structure |
|---|
| >2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* | Back alignment and structure |
|---|
| >3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... | Back alignment and structure |
|---|
| >1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* | Back alignment and structure |
|---|
| >3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... | Back alignment and structure |
|---|
| >4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* | Back alignment and structure |
|---|
| >3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* | Back alignment and structure |
|---|
| >2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* | Back alignment and structure |
|---|
| >3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... | Back alignment and structure |
|---|
| >1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* | Back alignment and structure |
|---|
| >1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A | Back alignment and structure |
|---|
| >3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* | Back alignment and structure |
|---|
| >3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... | Back alignment and structure |
|---|
| >4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* | Back alignment and structure |
|---|
| >3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} | Back alignment and structure |
|---|
| >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C | Back alignment and structure |
|---|
| >3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* | Back alignment and structure |
|---|
| >3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* | Back alignment and structure |
|---|
| >1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* | Back alignment and structure |
|---|
| >4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* | Back alignment and structure |
|---|
| >2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} | Back alignment and structure |
|---|
| >4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* | Back alignment and structure |
|---|
| >2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} | Back alignment and structure |
|---|
| >4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* | Back alignment and structure |
|---|
| >2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* | Back alignment and structure |
|---|
| >2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... | Back alignment and structure |
|---|
| >3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* | Back alignment and structure |
|---|
| >1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A | Back alignment and structure |
|---|
| >2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* | Back alignment and structure |
|---|
| >1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A | Back alignment and structure |
|---|
| >2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* | Back alignment and structure |
|---|
| >3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} | Back alignment and structure |
|---|
| >2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* | Back alignment and structure |
|---|
| >3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A | Back alignment and structure |
|---|
| >3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* | Back alignment and structure |
|---|
| >1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A | Back alignment and structure |
|---|
| >3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* | Back alignment and structure |
|---|
| >2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* | Back alignment and structure |
|---|
| >3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 | Back alignment and structure |
|---|
| >3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* | Back alignment and structure |
|---|
| >1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* | Back alignment and structure |
|---|
| >3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* | Back alignment and structure |
|---|
| >3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* | Back alignment and structure |
|---|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* | Back alignment and structure |
|---|
| >3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... | Back alignment and structure |
|---|
| >1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* | Back alignment and structure |
|---|
| >2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... | Back alignment and structure |
|---|
| >1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* | Back alignment and structure |
|---|
| >1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* | Back alignment and structure |
|---|
| >2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} | Back alignment and structure |
|---|
| >1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... | Back alignment and structure |
|---|
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* | Back alignment and structure |
|---|
| >3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A | Back alignment and structure |
|---|
| >3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* | Back alignment and structure |
|---|
| >2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* | Back alignment and structure |
|---|
| >3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* | Back alignment and structure |
|---|
| >1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B | Back alignment and structure |
|---|
| >3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* | Back alignment and structure |
|---|
| >1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* | Back alignment and structure |
|---|
| >2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} | Back alignment and structure |
|---|
| >1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... | Back alignment and structure |
|---|
| >3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* | Back alignment and structure |
|---|
| >2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A | Back alignment and structure |
|---|
| >2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* | Back alignment and structure |
|---|
| >2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* | Back alignment and structure |
|---|
| >4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A | Back alignment and structure |
|---|
| >3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A | Back alignment and structure |
|---|
| >1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A | Back alignment and structure |
|---|
| >2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A | Back alignment and structure |
|---|
| >3qpa_A Cutinase; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted; HET: MIR; 0.85A {Nectria haematococca} PDB: 3qpc_A* 1cex_A 1oxm_A* 1cui_A 1cus_A 2cut_A 1cuj_A 1cuy_A 1xzl_A* 1xzk_A* 1xzm_A* 1cuh_A 1cuu_A 3esc_A* 1cua_A* 3esa_A* 3esb_A* 3ef3_A* 3esd_A* 1cux_A ... | Back alignment and structure |
|---|
| >3qpd_A Cutinase 1; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted, phosphorylated Ser residue; HET: SEP; 1.57A {Aspergillus oryzae} PDB: 3gbs_A | Back alignment and structure |
|---|
| >3dcn_A Cutinase, cutin hydrolase; catalytic triad, secreted, serine esterase; 1.90A {Glomerella cingulata} SCOP: c.69.1.0 PDB: 3dd5_A 3dea_A* | Back alignment and structure |
|---|
| >4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* | Back alignment and structure |
|---|
| >1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30 | Back alignment and structure |
|---|
| >3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A* | Back alignment and structure |
|---|
| >3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* | Back alignment and structure |
|---|
| >2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} | Back alignment and structure |
|---|
| >3hc7_A Gene 12 protein, GP12; alpha/beta sandwich, cell adhesion; 2.00A {Mycobacterium phage D29} | Back alignment and structure |
|---|
| >3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2czq_A Cutinase-like protein; alpha/beta hydrolase fold, hydrolase; HET: CIT; 1.05A {Cryptococcus SP} | Back alignment and structure |
|---|
| >4ebb_A Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2.00A {Homo sapiens} PDB: 3jyh_A* 3n0t_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 283 | ||||
| d1rdqe_ | 350 | d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni | 1e-10 | |
| d2j4za1 | 263 | d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur | 4e-10 | |
| d1tcaa_ | 317 | c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Cand | 3e-09 | |
| d1fota_ | 316 | d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni | 3e-08 | |
| d1o6la_ | 337 | d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap | 3e-07 | |
| d1omwa3 | 364 | d.144.1.7 (A:186-549) G-protein coupled receptor k | 5e-07 | |
| d1xjda_ | 320 | d.144.1.7 (A:) Protein kinase C, theta type {Human | 6e-07 | |
| d1uu3a_ | 288 | d.144.1.7 (A:) 3-phosphoinositide dependent protei | 1e-06 | |
| d1opja_ | 287 | d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou | 3e-06 | |
| d3bqca1 | 328 | d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu | 3e-06 | |
| d1q8ya_ | 362 | d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces | 4e-06 | |
| d1gz8a_ | 298 | d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H | 4e-06 | |
| d1k2pa_ | 258 | d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum | 4e-06 | |
| d3blha1 | 318 | d.144.1.7 (A:8-325) Cell division protein kinase 9 | 4e-06 | |
| d1nvra_ | 271 | d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { | 5e-06 | |
| d1xwsa_ | 273 | d.144.1.7 (A:) Proto-oncogene serine/threonine-pro | 6e-06 | |
| d1koba_ | 352 | d.144.1.7 (A:) Twitchin, kinase domain {California | 6e-06 | |
| d1fmka3 | 285 | d.144.1.7 (A:249-533) c-src tyrosine kinase {Human | 6e-06 | |
| d1o6ya_ | 277 | d.144.1.7 (A:) Mycobacterial protein kinase PknB, | 8e-06 | |
| d1ispa_ | 179 | c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: | 8e-06 | |
| d1sm2a_ | 263 | d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu | 8e-06 | |
| d1ex9a_ | 285 | c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [Tax | 9e-06 | |
| d1koaa2 | 350 | d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C | 1e-05 | |
| d2java1 | 269 | d.144.1.7 (A:3-271) Serine/threonine-protein kinas | 1e-05 | |
| d1jksa_ | 293 | d.144.1.7 (A:) Death-associated protein kinase, Da | 1e-05 | |
| d1unla_ | 292 | d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H | 1e-05 | |
| d1s9ja_ | 322 | d.144.1.7 (A:) Dual specificity mitogen-activated | 1e-05 | |
| d1vzoa_ | 322 | d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 | 2e-05 | |
| d1q5ka_ | 350 | d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs | 2e-05 | |
| d1a06a_ | 307 | d.144.1.7 (A:) Calmodulin-dependent protein kinase | 3e-05 | |
| d2jfla1 | 288 | d.144.1.7 (A:21-308) STE20-like serine/threonine-p | 3e-05 | |
| d1qpca_ | 272 | d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom | 3e-05 | |
| d2gfsa1 | 348 | d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa | 3e-05 | |
| d2b1pa1 | 355 | d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 | 4e-05 | |
| d1phka_ | 277 | d.144.1.7 (A:) gamma-subunit of glycogen phosphory | 4e-05 | |
| d1tkia_ | 321 | d.144.1.7 (A:) Titin, kinase domain {Human (Homo s | 5e-05 | |
| d1cm8a_ | 346 | d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s | 7e-05 | |
| d2ozaa1 | 335 | d.144.1.7 (A:51-385) MAP kinase activated protein | 7e-05 | |
| d1yhwa1 | 293 | d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ | 7e-05 | |
| d1pmea_ | 345 | d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien | 7e-05 | |
| d1byga_ | 262 | d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) | 1e-04 | |
| d1u5ra_ | 309 | d.144.1.7 (A:) Serine/threonine protein kinase TAO | 1e-04 | |
| d1csna_ | 293 | d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast | 2e-04 | |
| d1xkka_ | 317 | d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- | 2e-04 | |
| d1ckia_ | 299 | d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n | 2e-04 | |
| d1ywna1 | 299 | d.144.1.7 (A:818-1166) Vascular endothelial growth | 3e-04 | |
| d1blxa_ | 305 | d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H | 3e-04 | |
| d1ob3a_ | 286 | d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod | 3e-04 | |
| d1t46a_ | 311 | d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens | 5e-04 | |
| d1ua2a_ | 299 | d.144.1.7 (A:) Cell division protein kinase 7, CDK | 5e-04 | |
| d1rjba_ | 325 | d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s | 6e-04 | |
| d1jpaa_ | 299 | d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou | 6e-04 | |
| d1u46a_ | 273 | d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum | 7e-04 | |
| d1mp8a_ | 273 | d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma | 9e-04 | |
| d1fvra_ | 309 | d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ | 0.001 | |
| d1t4ha_ | 270 | d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa | 0.001 | |
| d1lufa_ | 301 | d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n | 0.001 | |
| d1p4oa_ | 308 | d.144.1.7 (A:) Insulin-like growth factor 1 recept | 0.001 | |
| d1uwha_ | 276 | d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) | 0.002 | |
| d1mo2a_ | 255 | c.69.1.22 (A:) Erythromycin polyketide synthase {S | 0.002 | |
| d1mqba_ | 283 | d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum | 0.002 | |
| d1fgka_ | 299 | d.144.1.7 (A:) Fibroblast growth factor receptor 1 | 0.003 | |
| d1zara2 | 191 | d.144.1.9 (A:91-281) Rio2 serine protein kinase C- | 0.003 |
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Protein kinase-like (PK-like) superfamily: Protein kinase-like (PK-like) family: Protein kinases, catalytic subunit domain: cAMP-dependent PK, catalytic subunit species: Mouse (Mus musculus) [TaxId: 10090]
Score = 59.0 bits (142), Expect = 1e-10
Identities = 21/78 (26%), Positives = 37/78 (47%)
Query: 193 ENKENVEEYLKKMQTHYDAREAPNKSYRWQMSDFEVGCPLGTGKFGHVYLAKEKTTQIMI 252
+E+V+E+L K + + + Q+ F+ LGTG FG V L K K +
Sbjct: 10 SEQESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHY 69
Query: 253 ALKVLYKVEIINERMTHQ 270
A+K+L K +++ +
Sbjct: 70 AMKILDKQKVVKLKQIEH 87
|
| >d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Length = 317 | Back information, alignment and structure |
|---|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 | Back information, alignment and structure |
|---|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 | Back information, alignment and structure |
|---|
| >d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 | Back information, alignment and structure |
|---|
| >d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 | Back information, alignment and structure |
|---|
| >d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 | Back information, alignment and structure |
|---|
| >d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 | Back information, alignment and structure |
|---|
| >d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Length = 179 | Back information, alignment and structure |
|---|
| >d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Length = 285 | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 | Back information, alignment and structure |
|---|
| >d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 | Back information, alignment and structure |
|---|
| >d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 | Back information, alignment and structure |
|---|
| >d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 | Back information, alignment and structure |
|---|
| >d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 | Back information, alignment and structure |
|---|
| >d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 | Back information, alignment and structure |
|---|
| >d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 | Back information, alignment and structure |
|---|
| >d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 | Back information, alignment and structure |
|---|
| >d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 | Back information, alignment and structure |
|---|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 | Back information, alignment and structure |
|---|
| >d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Length = 255 | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 283 | |||
| d1ex9a_ | 285 | Lipase {Pseudomonas aeruginosa [TaxId: 287]} | 99.76 | |
| d1cvla_ | 319 | Lipase {Chromobacterium viscosum [TaxId: 42739]} | 99.76 | |
| d1ispa_ | 179 | Lipase A {Bacillus subtilis [TaxId: 1423]} | 99.72 | |
| d1pjaa_ | 268 | Palmitoyl protein thioesterase 2 {Human (Homo sapi | 99.7 | |
| d1tcaa_ | 317 | Triacylglycerol lipase {Yeast (Candida antarctica) | 99.66 | |
| d1k8qa_ | 377 | Gastric lipase {Dog (Canis familiaris) [TaxId: 961 | 99.61 | |
| d1q0ra_ | 297 | Aclacinomycin methylesterase RdmC {Streptomyces pu | 99.61 | |
| d1c4xa_ | 281 | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas | 99.6 | |
| d1brta_ | 277 | Bromoperoxidase A2 {Streptomyces aureofaciens [Tax | 99.59 | |
| d1zd3a2 | 322 | Mammalian epoxide hydrolase, C-terminal domain {Hu | 99.58 | |
| d1xkla_ | 258 | Salicylic acid-binding protein 2 (SABP2) {Common t | 99.57 | |
| d1b6ga_ | 310 | Haloalkane dehalogenase {Xanthobacter autotrophicu | 99.57 | |
| d1hkha_ | 279 | Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] | 99.57 | |
| d1mtza_ | 290 | Tricorn interacting factor F1 {Archaeon Thermoplas | 99.57 | |
| d1ehya_ | 293 | Bacterial epoxide hydrolase {Agrobacterium radioba | 99.56 | |
| d3c70a1 | 256 | Hydroxynitrile lyase {Rubber tree (Hevea brasilien | 99.56 | |
| d1imja_ | 208 | Ccg1/TafII250-interacting factor B (Cib) {Human (H | 99.54 | |
| d1r3da_ | 264 | Hypothetical protein VC1974 {Vibrio cholerae [TaxI | 99.53 | |
| d1j1ia_ | 268 | Meta cleavage compound hydrolase CarC {Janthinobac | 99.52 | |
| d1a8qa_ | 274 | Bromoperoxidase A1 {Streptomyces aureofaciens [Tax | 99.52 | |
| d1bn7a_ | 291 | Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 | 99.51 | |
| d1uk8a_ | 271 | Meta-cleavage product hydrolase CumD {Pseudomonas | 99.51 | |
| d2rhwa1 | 283 | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas | 99.49 | |
| d1a88a_ | 275 | Chloroperoxidase L {Streptomyces lividans [TaxId: | 99.49 | |
| d1tqha_ | 242 | Carboxylesterase Est {Bacillus stearothermophilus | 99.48 | |
| d1thta_ | 302 | Myristoyl-ACP-specific thioesterase {Vibrio harvey | 99.48 | |
| d1mj5a_ | 298 | Haloalkane dehalogenase {Sphingomonas paucimobilis | 99.45 | |
| d1azwa_ | 313 | Proline iminopeptidase {Xanthomonas campestris, pv | 99.42 | |
| d1m33a_ | 256 | Biotin biosynthesis protein BioH {Escherichia coli | 99.41 | |
| d1ku0a_ | 388 | Lipase L1 {Bacillus stearothermophilus [TaxId: 142 | 99.41 | |
| d1ei9a_ | 279 | Palmitoyl protein thioesterase 1 {Cow (Bos taurus) | 99.4 | |
| d1a8sa_ | 273 | Chloroperoxidase F {Pseudomonas fluorescens [TaxId | 99.39 | |
| d1va4a_ | 271 | Arylesterase {Pseudomonas fluorescens [TaxId: 294] | 99.38 | |
| d1xkta_ | 286 | Fatty acid synthase {Human (Homo sapiens) [TaxId: | 99.33 | |
| d1uxoa_ | 186 | Hypothetical protein YdeN {Bacillus subtilis [TaxI | 99.28 | |
| d1wm1a_ | 313 | Proline aminopeptidase {Serratia marcescens [TaxId | 99.27 | |
| d2h7xa1 | 283 | Picromycin polyketide synthase {Streptomyces venez | 99.17 | |
| d1jmkc_ | 230 | Surfactin synthetase, SrfA {Bacillus subtilis [Tax | 99.17 | |
| d2fuka1 | 218 | XC6422 protein {Xanthomonas campestris [TaxId: 339 | 99.15 | |
| d1qo7a_ | 394 | Bacterial epoxide hydrolase {Aspergillus niger [Ta | 99.12 | |
| d2j4za1 | 263 | Aurora-related kinase 1 (aurora-2) {Human (Homo sa | 99.09 | |
| d2jbwa1 | 360 | 2,6-dihydropseudooxynicotine hydrolase {Arthrobact | 99.08 | |
| d2dsta1 | 122 | Hypothetical protein TTHA1544 {Thermus thermophilu | 99.05 | |
| d1o6la_ | 337 | Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 | 99.04 | |
| d1fota_ | 316 | cAMP-dependent PK, catalytic subunit {Baker's yeas | 99.04 | |
| d1mo2a_ | 255 | Erythromycin polyketide synthase {Saccharopolyspor | 99.01 | |
| d1uu3a_ | 288 | 3-phosphoinositide dependent protein kinase-1 Pdk1 | 98.99 | |
| d1rdqe_ | 350 | cAMP-dependent PK, catalytic subunit {Mouse (Mus m | 98.97 | |
| d1ufoa_ | 238 | Hypothetical protein TT1662 {Thermus thermophilus | 98.95 | |
| d1xjda_ | 320 | Protein kinase C, theta type {Human (Homo sapiens) | 98.95 | |
| d1omwa3 | 364 | G-protein coupled receptor kinase 2 {Cow (Bos taur | 98.94 | |
| d1nvra_ | 271 | Cell cycle checkpoint kinase chk1 {Human (Homo sap | 98.93 | |
| d1gz8a_ | 298 | Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T | 98.89 | |
| d1jksa_ | 293 | Death-associated protein kinase, Dap {Human (Homo | 98.87 | |
| d1a06a_ | 307 | Calmodulin-dependent protein kinase {Rat (Rattus n | 98.84 | |
| d2java1 | 269 | Serine/threonine-protein kinase Nek2 {Human (Homo | 98.83 | |
| d1tkia_ | 321 | Titin, kinase domain {Human (Homo sapiens) [TaxId: | 98.83 | |
| d1s9ja_ | 322 | Dual specificity mitogen-activated protein kinase | 98.82 | |
| d1koaa2 | 350 | Twitchin, kinase domain {Caenorhabditis elegans, p | 98.81 | |
| d1koba_ | 352 | Twitchin, kinase domain {California sea hare (Aply | 98.8 | |
| d1opja_ | 287 | Abelsone tyrosine kinase (abl) {Mouse (Mus musculu | 98.77 | |
| d1phka_ | 277 | gamma-subunit of glycogen phosphorylase kinase (Ph | 98.77 | |
| d1u5ra_ | 309 | Serine/threonine protein kinase TAO2 {Rat (Rattus | 98.76 | |
| d1yhwa1 | 293 | pak1 {Human (Homo sapiens) [TaxId: 9606]} | 98.76 | |
| d2jfla1 | 288 | STE20-like serine/threonine-protein kinase, SLK {H | 98.75 | |
| d1ob3a_ | 286 | Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) | 98.7 | |
| d1unla_ | 292 | Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T | 98.69 | |
| d1o6ya_ | 277 | Mycobacterial protein kinase PknB, catalytic domai | 98.68 | |
| d1jfra_ | 260 | Lipase {Streptomyces exfoliatus [TaxId: 1905]} | 98.67 | |
| d1k2pa_ | 258 | Bruton's tyrosine kinase (Btk) {Human (Homo sapien | 98.66 | |
| d1xwsa_ | 273 | Proto-oncogene serine/threonine-protein kinase Pim | 98.65 | |
| d2ozaa1 | 335 | MAP kinase activated protein kinase 2, mapkap2 {Hu | 98.64 | |
| d3bqca1 | 328 | Protein kinase CK2, alpha subunit {Rattus norvegic | 98.62 | |
| d1cm8a_ | 346 | MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: | 98.6 | |
| d1t4ha_ | 270 | Protein kinase wnk1 {Human (Homo sapiens) [TaxId: | 98.59 | |
| d2b1pa1 | 355 | c-jun N-terminal kinase (jnk3s) {Human (Homo sapie | 98.58 | |
| d3b5ea1 | 209 | Uncharacterized protein Mll8374 {Mesorhizobium lot | 98.57 | |
| d1vkha_ | 263 | Putative serine hydrolase Ydr428c {Baker's yeast ( | 98.57 | |
| d1sm2a_ | 263 | Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie | 98.56 | |
| d1q5ka_ | 350 | Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho | 98.55 | |
| d1fj2a_ | 229 | Acyl protein thioesterase 1 {Human (Homo sapiens) | 98.54 | |
| d1qpca_ | 272 | Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax | 98.54 | |
| d3blha1 | 318 | Cell division protein kinase 9, CDK9 {Human (Homo | 98.53 | |
| d2hu7a2 | 260 | Acylamino-acid-releasing enzyme, C-terminal donain | 98.53 | |
| d2gfsa1 | 348 | MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] | 98.53 | |
| d1fmka3 | 285 | c-src tyrosine kinase {Human (Homo sapiens) [TaxId | 98.5 | |
| d1xkka_ | 317 | EGF receptor tyrosine kinase, Erbb-1 {Human (Homo | 98.48 | |
| d1byga_ | 262 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 98.48 | |
| d1vzoa_ | 322 | Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( | 98.47 | |
| d1pmea_ | 345 | MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 | 98.45 | |
| d2h1ia1 | 202 | Carboxylesterase {Bacillus cereus [TaxId: 1396]} | 98.44 | |
| d2r8ba1 | 203 | Uncharacterized protein Atu2452 {Agrobacterium tum | 98.44 | |
| d1blxa_ | 305 | Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T | 98.41 | |
| d1fvra_ | 309 | Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | 98.4 | |
| d1jpaa_ | 299 | ephb2 receptor tyrosine kinase {Mouse (Mus musculu | 98.4 | |
| d1u46a_ | 273 | Activated CDC42 kinase 1, ACK1 {Human (Homo sapien | 98.39 | |
| d2vata1 | 376 | Acetyl-CoA:deacetylcephalosporin C acetyltransfera | 98.39 | |
| d1mqba_ | 283 | epha2 receptor tyrosine kinase {Human (Homo sapien | 98.39 | |
| d1lufa_ | 301 | Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax | 98.37 | |
| d2i3da1 | 218 | Hypothetical protein Atu1826 {Agrobacterium tumefa | 98.37 | |
| d1l7aa_ | 318 | Cephalosporin C deacetylase {Bacillus subtilis [Ta | 98.35 | |
| d1vjya_ | 303 | Type I TGF-beta receptor R4 {Human (Homo sapiens) | 98.35 | |
| d1rjba_ | 325 | Fl cytokine receptor {Human (Homo sapiens) [TaxId: | 98.34 | |
| d2pl5a1 | 362 | Homoserine O-acetyltransferase {Leptospira interro | 98.34 | |
| d1mp8a_ | 273 | Focal adhesion kinase 1 (fak) {Human (Homo sapiens | 98.33 | |
| d2pbla1 | 261 | Uncharacterized protein TM1040_2492 {Silicibacter | 98.32 | |
| d1t46a_ | 311 | c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] | 98.31 | |
| d2b61a1 | 357 | Homoserine O-acetyltransferase {Haemophilus influe | 98.3 | |
| d1fgka_ | 299 | Fibroblast growth factor receptor 1 {Human (Homo s | 98.29 | |
| d1p4oa_ | 308 | Insulin-like growth factor 1 receptor {Human (Homo | 98.29 | |
| d1xbba_ | 277 | Tyrosine-protein kinase SYK {Human (Homo sapiens) | 98.29 | |
| d1qlwa_ | 318 | A novel bacterial esterase {Alcaligenes sp. [TaxId | 98.29 | |
| d1u59a_ | 285 | Tyrosine-protein kinase ZAP-70 {Human (Homo sapien | 98.27 | |
| d1q8ya_ | 362 | Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T | 98.21 | |
| d1rp1a2 | 337 | Pancreatic lipase, N-terminal domain {Dog (Canis f | 98.13 | |
| d1uwha_ | 276 | B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} | 98.11 | |
| d1vlqa_ | 322 | Acetyl xylan esterase TM0077 {Thermotoga maritima | 98.01 | |
| d1csna_ | 293 | Casein kinase-1, CK1 {Fission yeast (Schizosacchar | 97.98 | |
| d1dqza_ | 280 | Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 | 97.98 | |
| d1r88a_ | 267 | Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta | 97.98 | |
| d1bu8a2 | 338 | Pancreatic lipase, N-terminal domain {Rat (Rattus | 97.97 | |
| d1sfra_ | 288 | Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 | 97.92 | |
| d1ckia_ | 299 | Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax | 97.91 | |
| d1xfda2 | 258 | Dipeptidyl aminopeptidase-like protein 6, DPP6, C- | 97.9 | |
| d1ywna1 | 299 | Vascular endothelial growth factor receptor 2 (kdr | 97.85 | |
| d1r0pa_ | 311 | Hepatocyte growth factor receptor, c-MET {Human (H | 97.84 | |
| d1mpxa2 | 381 | Alpha-amino acid ester hydrolase {Xanthomonas citr | 97.8 | |
| d1lnsa3 | 405 | X-Prolyl dipeptidyl aminopeptidase PepX, middle do | 97.64 | |
| d2bgra2 | 258 | Dipeptidyl peptidase IV/CD26, C-terminal domain {P | 97.63 | |
| d1jjfa_ | 255 | Feruloyl esterase domain of the cellulosomal xylan | 97.62 | |
| d1auoa_ | 218 | Carboxylesterase {Pseudomonas fluorescens [TaxId: | 97.61 | |
| d1ju3a2 | 347 | Bacterial cocaine esterase N-terminal domain {Rhod | 97.57 | |
| d1dina_ | 233 | Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI | 97.57 | |
| d1tiaa_ | 271 | Triacylglycerol lipase {Penicillium camembertii [T | 97.54 | |
| d1tiba_ | 269 | Triacylglycerol lipase {Thermomyces lanuginosus, f | 97.54 | |
| d1lgya_ | 265 | Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 | 97.47 | |
| d1wb4a1 | 273 | Feruloyl esterase domain of the cellulosomal xylan | 97.44 | |
| d2b9va2 | 385 | Alpha-amino acid ester hydrolase {Acetobacter past | 97.44 | |
| d1pv1a_ | 299 | Hypothetical esterase YJL068C {Baker's yeast (Sacc | 97.41 | |
| d3tgla_ | 265 | Triacylglycerol lipase {Rhizomucor miehei [TaxId: | 97.4 | |
| d1uwca_ | 261 | Feruloyl esterase A {Aspergillus niger [TaxId: 506 | 97.4 | |
| d1jkma_ | 358 | Carboxylesterase {Bacillus subtilis, brefeldin A e | 96.87 | |
| d1lzla_ | 317 | Heroin esterase {Rhodococcus sp. [TaxId: 1831]} | 96.76 | |
| d1cexa_ | 197 | Cutinase {Fungus (Fusarium solani), subsp. pisi [T | 96.17 | |
| d3c8da2 | 246 | Enterochelin esterase, catalytic domain {Shigella | 96.09 | |
| d1u4na_ | 308 | Carboxylesterase {Alicyclobacillus acidocaldarius | 94.49 | |
| d1qoza_ | 207 | Acetylxylan esterase {Trichoderma reesei [TaxId: 5 | 94.32 | |
| d1g66a_ | 207 | Acetylxylan esterase {Penicillium purpurogenum [Ta | 93.91 | |
| d1jjia_ | 311 | Carboxylesterase {Archaeon Archaeoglobus fulgidus | 93.61 | |
| d2gzsa1 | 265 | Enterobactin and salmochelin hydrolase IroE {Esche | 90.75 | |
| d2d81a1 | 318 | Polyhydroxybutyrate depolymerase {Penicillium funi | 89.81 | |
| d1ivya_ | 452 | Human 'protective protein', HPP {Human (Homo sapie | 88.9 |
| >d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: alpha/beta-Hydrolases superfamily: alpha/beta-Hydrolases family: Bacterial lipase domain: Lipase species: Pseudomonas aeruginosa [TaxId: 287]
Probab=99.76 E-value=6.3e-19 Score=147.59 Aligned_cols=88 Identities=25% Similarity=0.230 Sum_probs=76.0
Q ss_pred hHHHHHHHHHhCCc-ccCCCcCcCCCCCCCCCCcchHHHHHHHHHHHHHHHHcCCCCEEEEEeCcccHHHHHHHHcCChh
Q psy4395 86 YFSYIAAALVGLGY-QRDLSMRGAPYDFRKAPNENQEYFANFKALIEETYDLNGGTPVVLVAHSMGSLMCLYFLQRQSSA 164 (283)
Q Consensus 86 ~~~~l~~~L~~~g~-~~~~d~~g~g~~~r~~~~~~~~~~~~l~~~i~~~~~~~~~~~v~lvgHSmGg~va~~~~~~~~~~ 164 (283)
||..+.+.|++.|| |++.|+++++.+ ....+++.+.|+.+.+..+..||++|||||||+++++++..+|+.
T Consensus 27 yw~~i~~~L~~~G~~v~~~~~~~~~~~--------~~~a~~l~~~i~~~~~~~g~~~v~ligHS~GG~~~r~~~~~~p~~ 98 (285)
T d1ex9a_ 27 YWFGIPSALRRDGAQVYVTEVSQLDTS--------EVRGEQLLQQVEEIVALSGQPKVNLIGHSHGGPTIRYVAAVRPDL 98 (285)
T ss_dssp SSTTHHHHHHHTTCCEEEECCCSSSCH--------HHHHHHHHHHHHHHHHHHCCSCEEEEEETTHHHHHHHHHHHCGGG
T ss_pred hHHHHHHHHHhCCCEEEEeCCCCCCCc--------HHHHHHHHHHHHHHHHHcCCCeEEEEEECccHHHHHHHHHHCCcc
Confidence 46678999999999 899999988743 345577788888888778888999999999999999999999987
Q ss_pred HHhhhhcceEEecCCCCcchhh
Q psy4395 165 WKSKFVRSLVSLAAPWGGSVKA 186 (283)
Q Consensus 165 ~~~~~v~~~i~i~~p~~g~~~~ 186 (283)
|+++|++++|+.|++.+
T Consensus 99 -----v~~lv~i~tPh~Gs~~a 115 (285)
T d1ex9a_ 99 -----IASATSVGAPHKGSDTA 115 (285)
T ss_dssp -----EEEEEEESCCTTCCHHH
T ss_pred -----ceeEEEECCCCCCCHHH
Confidence 99999999999998764
|
| >d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} | Back information, alignment and structure |
|---|
| >d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} | Back information, alignment and structure |
|---|
| >d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} | Back information, alignment and structure |
|---|
| >d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} | Back information, alignment and structure |
|---|
| >d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} | Back information, alignment and structure |
|---|
| >d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} | Back information, alignment and structure |
|---|
| >d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} | Back information, alignment and structure |
|---|
| >d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} | Back information, alignment and structure |
|---|
| >d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} | Back information, alignment and structure |
|---|
| >d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} | Back information, alignment and structure |
|---|
| >d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} | Back information, alignment and structure |
|---|
| >d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} | Back information, alignment and structure |
|---|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} | Back information, alignment and structure |
|---|
| >d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} | Back information, alignment and structure |
|---|
| >d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} | Back information, alignment and structure |
|---|
| >d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} | Back information, alignment and structure |
|---|
| >d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} | Back information, alignment and structure |
|---|
| >d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} | Back information, alignment and structure |
|---|
| >d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} | Back information, alignment and structure |
|---|
| >d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} | Back information, alignment and structure |
|---|
| >d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} | Back information, alignment and structure |
|---|
| >d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} | Back information, alignment and structure |
|---|
| >d1qoza_ c.69.1.30 (A:) Acetylxylan esterase {Trichoderma reesei [TaxId: 51453]} | Back information, alignment and structure |
|---|
| >d1g66a_ c.69.1.30 (A:) Acetylxylan esterase {Penicillium purpurogenum [TaxId: 28575]} | Back information, alignment and structure |
|---|
| >d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} | Back information, alignment and structure |
|---|
| >d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|