Psyllid ID: psy4395


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280---
MTGKEKRCQETVEVRKEMPGDGGSQVEARLNKTETVHYICDKTTSNWFTLWLNLELLVPEVIDCFIDNLRLVYNNVTHPFVRVGSYFSYIAAALVGLGYQRDLSMRGAPYDFRKAPNENQEYFANFKALIEETYDLNGGTPVVLVAHSMGSLMCLYFLQRQSSAWKSKFVRSLVSLAAPWGGSVKAVKVFAVENKENVEEYLKKMQTHYDAREAPNKSYRWQMSDFEVGCPLGTGKFGHVYLAKEKTTQIMIALKVLYKVEIINERMTHQGMILAFTCYRNPH
ccccccccccccccEEEEccccccccEEEEcccccccccccccccccEEEEcccccccccccccccccccEEEEccccccEEEcccHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHccccccccccccccccccccccccccEEEHHHcccHHHHHHHHHHccccccccccccccccccccccccccccccccccEEEEEEEccccEEEEEEccHHHHHHcccEEEEEEEHHHcccccc
ccccccccccccccEEEEEccccccEEEEcccccccccccEccccccEEEEEcHHHHccccccccHHcEEEEEcccccccEccccHHHHHHHHHHHcccccccEEEEccccccccccccHHHHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHccHHHHHHHHHHHHHccccccccHHHHHHHHcccccccccccHHHHHHHHccccccccccccHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccc
mtgkekrcQETVEVrkempgdggsqvEARLNKTETVHYICDKTTSNWFTLWLNLELLVPEVIDCFIDNLrlvynnvthpfvrvGSYFSYIAAALVGLGyqrdlsmrgapydfrkapnenQEYFANFKALIEEtydlnggtPVVLVAHSMGSLMCLYFLQRQSSAWKSKFVRSLVSLaapwggsvKAVKVFAVENKENVEEYLKKMQThydareapnksyrwqmsdfevgcplgtgkfghvylAKEKTTQIMIALKVLYKVEIINERMTHQGMILAFTCYRNPH
mtgkekrcqetvevrkempgdggsqvEARLNKTETVHYICDKTTSNWFTLWLNLELLVPEVIDCFIDNLRLVYNNVTHPFVRVGSYFSYIAAALVGLGYQRDLSMRGAPYDFRKAPNENQEYFANFKALIEETYDLNGGTPVVLVAHSMGSLMCLYFLQRQSSAWKSKFVRSLVSlaapwggsvkAVKVFAVENKENVEEYLKKMQTHYDAREAPNKSYRWQMSDFEVGCPLGTGKFGHVYLAKEKTTQIMIALKVLYKVEIINERMTHQGMILAFTCYRNPH
MTGKEKRCQETVEVRKEMPGDGGSQVEARLNKTETVHYICDKTTSNWFTLWLNLELLVPEVIDCFIDNLRLVYNNVTHPFVRVGSYFSYIAAALVGLGYQRDLSMRGAPYDFRKAPNENQEYFANFKALIEETYDLNGGTPVVLVAHSMGSLMCLYFLQRQSSAWKSKFVRSLVSLAAPWGGSVKAVKVFAVENKENVEEYLKKMQTHYDAREAPNKSYRWQMSDFEVGCPLGTGKFGHVYLAKEKTTQIMIALKVLYKVEIINERMTHQGMILAFTCYRNPH
*******************************KTETVHYICDKTTSNWFTLWLNLELLVPEVIDCFIDNLRLVYNNVTHPFVRVGSYFSYIAAALVGLGYQRDLSMRGAPYDFRKAPNENQEYFANFKALIEETYDLNGGTPVVLVAHSMGSLMCLYFLQRQSSAWKSKFVRSLVSLAAPWGGSVKAVKVFAVENKENVEEYLKKMQTHYDAREAPNKSYRWQMSDFEVGCPLGTGKFGHVYLAKEKTTQIMIALKVLYKVEIINERMTHQGMILAFTCY****
**************RKEMPGDGGSQVEARLNKTETVHYICDKTTSNWFTLWLNLELLVPEVIDCFIDNLRLVYNNVTHPFVRVGSYFSYIAAALVGLGYQRDLSMRGAPYDFRKAPNENQEYFANFKALIEETYDLNGGTPVVLVAHSMGSLMCLYFLQRQSSAWKSKFVRSLVSLAAPWGGSVKAVKVFAVENKENVEEYLKKMQTHYDAREAPNKSYRWQMSDFEVGCPLGTGKFGHVYLAKEKTTQIMIALKVLYKVEIINERMTHQGMILAFTCYR***
************************QVEARLNKTETVHYICDKTTSNWFTLWLNLELLVPEVIDCFIDNLRLVYNNVTHPFVRVGSYFSYIAAALVGLGYQRDLSMRGAPYDFRKAPNENQEYFANFKALIEETYDLNGGTPVVLVAHSMGSLMCLYFLQRQSSAWKSKFVRSLVSLAAPWGGSVKAVKVFAVENKENVEEYLKKMQTHYDAREAPNKSYRWQMSDFEVGCPLGTGKFGHVYLAKEKTTQIMIALKVLYKVEIINERMTHQGMILAFTCYRNPH
*********ETVEVRKEMPGDGGSQVEARLNKTETVHYICDKTTSNWFTLWLNLELLVPEVIDCFIDNLRLVYNNVTHPFVRVGSYFSYIAAALVGLGYQRDLSMRGAPYDFRKAPNENQEYFANFKALIEETYDLNGGTPVVLVAHSMGSLMCLYFLQRQSSAWKSKFVRSLVSLAAPWGGSVKAVKVFAVENKENVEEYLKKMQTHYDAREAPNKSYRWQMSDFEVGCPLGTGKFGHVYLAKEKTTQIMIALKVLYKVEIINERMTHQGMILAFTCYRN**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTGKEKRCQETVEVRKEMPGDGGSQVEARLNKTETVHYICDKTTSNWFTLWLNLELLVPEVIDCFIDNLRLVYNNVTHPFVRVGSYFSYIAAALVGLGYQRDLSMRGAPYDFRKAPNENQEYFANFKALIEETYDLNGGTPVVLVAHSMGSLMCLYFLQRQSSAWKSKFVRSLVSLAAPWGGSVKAVKVFAVENKENVEEYLKKMQTHYDAREAPNKSYRWQMSDFEVGCPLGTGKFGHVYLAKEKTTQIMIALKVLYKVEIINERMTHQGMILAFTCYRNPH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query283 2.2.26 [Sep-21-2011]
Q8NCC3412 Group XV phospholipase A2 yes N/A 0.636 0.436 0.497 2e-52
Q675A5413 Group XV phospholipase A2 yes N/A 0.636 0.435 0.492 8e-46
Q8VEB4412 Group XV phospholipase A2 yes N/A 0.636 0.436 0.487 3e-45
Q6XPZ3408 Group XV phospholipase A2 yes N/A 0.706 0.490 0.456 1e-44
Q8WMP9407 Group XV phospholipase A2 yes N/A 0.636 0.442 0.473 4e-44
P53760413 Phosphatidylcholine-stero no N/A 0.636 0.435 0.404 2e-38
P16301438 Phosphatidylcholine-stero no N/A 0.636 0.410 0.365 9e-37
P53761440 Phosphatidylcholine-stero no N/A 0.636 0.409 0.370 2e-36
Q08758440 Phosphatidylcholine-stero N/A N/A 0.636 0.409 0.370 3e-36
P04180440 Phosphatidylcholine-stero no N/A 0.636 0.409 0.370 3e-36
>sp|Q8NCC3|PAG15_HUMAN Group XV phospholipase A2 OS=Homo sapiens GN=PLA2G15 PE=1 SV=2 Back     alignment and function desciption
 Score =  206 bits (524), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 103/207 (49%), Positives = 133/207 (64%), Gaps = 27/207 (13%)

Query: 18  MPGDGGSQVEARLNKTETVHYICDKTTSNWFTLWLNLELLVPEVIDCFIDNLRLVYNNVT 77
           +PGD G+Q+EA+L+K   VHY+C K T ++FT+WLNLELL+P +IDC+IDN+RLVYN  +
Sbjct: 43  VPGDLGNQLEAKLDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTS 102

Query: 78  HPF-------VR-------------------VGSYFSYIAAALVGLGYQRDLSMRGAPYD 111
                     VR                   VGSYF  +  +LVG GY R   +RGAPYD
Sbjct: 103 RATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYD 162

Query: 112 FRKAPNENQEYFANFKALIEETYDLNGGTPVVLVAHSMGSLMCLYFLQRQSSAWKSKFVR 171
           +R+APNEN  YF   + +IEE Y L GG PVVLVAHSMG++  LYFLQRQ  AWK K++R
Sbjct: 163 WRRAPNENGPYFLALREMIEEMYQLYGG-PVVLVAHSMGNMYTLYFLQRQPQAWKDKYIR 221

Query: 172 SLVSLAAPWGGSVKAVKVFAVENKENV 198
           + VSL APWGG  K ++V A  +   +
Sbjct: 222 AFVSLGAPWGGVAKTLRVLASGDNNRI 248




Has transacylase and calcium-independent phospholipase A2 activity. Catalyzes the formation of 1-O-acyl-N-acetylsphingosine and the concomitant release of a lyso-phospholipid (By similarity). May have weak lysophospholipase activity.
Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: -
>sp|Q675A5|PAG15_RAT Group XV phospholipase A2 OS=Rattus norvegicus GN=Pla2g15 PE=1 SV=1 Back     alignment and function description
>sp|Q8VEB4|PAG15_MOUSE Group XV phospholipase A2 OS=Mus musculus GN=Pla2g15 PE=1 SV=1 Back     alignment and function description
>sp|Q6XPZ3|PAG15_CANFA Group XV phospholipase A2 OS=Canis familiaris GN=PLA2G15 PE=2 SV=1 Back     alignment and function description
>sp|Q8WMP9|PAG15_BOVIN Group XV phospholipase A2 OS=Bos taurus GN=PLA2G15 PE=1 SV=1 Back     alignment and function description
>sp|P53760|LCAT_CHICK Phosphatidylcholine-sterol acyltransferase (Fragment) OS=Gallus gallus GN=LCAT PE=2 SV=1 Back     alignment and function description
>sp|P16301|LCAT_MOUSE Phosphatidylcholine-sterol acyltransferase OS=Mus musculus GN=Lcat PE=1 SV=2 Back     alignment and function description
>sp|P53761|LCAT_RABIT Phosphatidylcholine-sterol acyltransferase OS=Oryctolagus cuniculus GN=LCAT PE=2 SV=1 Back     alignment and function description
>sp|Q08758|LCAT_PAPAN Phosphatidylcholine-sterol acyltransferase OS=Papio anubis GN=LCAT PE=2 SV=1 Back     alignment and function description
>sp|P04180|LCAT_HUMAN Phosphatidylcholine-sterol acyltransferase OS=Homo sapiens GN=LCAT PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query283
91083367 401 PREDICTED: similar to phosphatidylcholin 0.618 0.436 0.532 1e-58
307194576 408 1-O-acylceramide synthase [Harpegnathos 0.618 0.428 0.554 2e-58
307188073 408 1-O-acylceramide synthase [Camponotus fl 0.618 0.428 0.554 2e-57
156538577 408 PREDICTED: group XV phospholipase A2-lik 0.646 0.448 0.547 1e-56
383865126 407 PREDICTED: group XV phospholipase A2-lik 0.717 0.498 0.502 1e-56
332020092 408 Group XV phospholipase A2 [Acromyrmex ec 0.618 0.428 0.549 3e-56
328791555 407 PREDICTED: group XV phospholipase A2-lik 0.717 0.498 0.493 1e-55
193643698 399 PREDICTED: group XV phospholipase A2-lik 0.639 0.453 0.512 2e-55
380028758379 PREDICTED: group XV phospholipase A2-lik 0.717 0.535 0.489 4e-55
321478536 423 hypothetical protein DAPPUDRAFT_303258 [ 0.710 0.475 0.451 9e-55
>gi|91083367|ref|XP_966553.1| PREDICTED: similar to phosphatidylcholine-sterol acyltransferase (lecithin-cholesterol acyltransferase) [Tribolium castaneum] gi|270007779|gb|EFA04227.1| hypothetical protein TcasGA2_TC014478 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  232 bits (591), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 107/201 (53%), Positives = 147/201 (73%), Gaps = 26/201 (12%)

Query: 18  MPGDGGSQVEARLNKTETVHYICDKTTSNWFTLWLNLELLVPEVIDCFIDNLRLVYNNVT 77
           +PGDGGSQVEA+LNK+ +VHYIC+KTTS++F +WLN+ELLVP VIDC+IDN++L+Y+N T
Sbjct: 29  IPGDGGSQVEAKLNKSASVHYICEKTTSDFFNIWLNMELLVPLVIDCWIDNIKLIYDNAT 88

Query: 78  HPF-------VRV-------------------GSYFSYIAAALVGLGYQRDLSMRGAPYD 111
                     +R+                   G+YF+ IA  LV LG++R+ +M+GAPYD
Sbjct: 89  RTTRNNDGVEIRIPGFGGTETVEWLDPSHASAGAYFNSIAKTLVSLGHERNKTMKGAPYD 148

Query: 112 FRKAPNENQEYFANFKALIEETYDLNGGTPVVLVAHSMGSLMCLYFLQRQSSAWKSKFVR 171
           FRKAPNENQ++F + KALIE+TY  N   PV+++AHSMG  M L+FL +Q+  WK K++R
Sbjct: 149 FRKAPNENQQFFTDLKALIEQTYTENNNQPVIIIAHSMGGPMSLFFLNQQTQDWKDKYIR 208

Query: 172 SLVSLAAPWGGSVKAVKVFAV 192
           SLV+L+  WGGS+KAVKV+A+
Sbjct: 209 SLVTLSGAWGGSMKAVKVYAI 229




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307194576|gb|EFN76868.1| 1-O-acylceramide synthase [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307188073|gb|EFN72905.1| 1-O-acylceramide synthase [Camponotus floridanus] Back     alignment and taxonomy information
>gi|156538577|ref|XP_001607467.1| PREDICTED: group XV phospholipase A2-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383865126|ref|XP_003708026.1| PREDICTED: group XV phospholipase A2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|332020092|gb|EGI60538.1| Group XV phospholipase A2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|328791555|ref|XP_624472.3| PREDICTED: group XV phospholipase A2-like [Apis mellifera] Back     alignment and taxonomy information
>gi|193643698|ref|XP_001951433.1| PREDICTED: group XV phospholipase A2-like isoform 1 [Acyrthosiphon pisum] gi|328708587|ref|XP_003243738.1| PREDICTED: group XV phospholipase A2-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|380028758|ref|XP_003698055.1| PREDICTED: group XV phospholipase A2-like [Apis florea] Back     alignment and taxonomy information
>gi|321478536|gb|EFX89493.1| hypothetical protein DAPPUDRAFT_303258 [Daphnia pulex] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query283
UNIPROTKB|Q8NCC3412 PLA2G15 "Group XV phospholipas 0.381 0.262 0.596 7.7e-52
RGD|1302982413 Pla2g15 "phospholipase A2, gro 0.381 0.261 0.577 2e-51
UNIPROTKB|Q6XPZ3408 PLA2G15 "Group XV phospholipas 0.477 0.330 0.474 6.8e-51
MGI|MGI:2178076412 Pla2g15 "phospholipase A2, gro 0.381 0.262 0.568 6.8e-51
UNIPROTKB|H3BMU8298 PLA2G15 "Group XV phospholipas 0.261 0.248 0.586 2.4e-50
UNIPROTKB|Q8WMP9407 PLA2G15 "Group XV phospholipas 0.477 0.331 0.445 3.7e-50
UNIPROTKB|E1C0B0415 PLA2G15 "Uncharacterized prote 0.381 0.260 0.532 9.8e-50
ZFIN|ZDB-GENE-030131-6948469 pla2g15 "phospholipase A2, gro 0.406 0.245 0.491 6.5e-47
FB|FBgn0051683421 CG31683 [Drosophila melanogast 0.385 0.258 0.559 8.6e-47
FB|FBgn0042175421 CG18858 [Drosophila melanogast 0.385 0.258 0.559 1.4e-46
UNIPROTKB|Q8NCC3 PLA2G15 "Group XV phospholipase A2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 340 (124.7 bits), Expect = 7.7e-52, Sum P(2) = 7.7e-52
 Identities = 65/109 (59%), Positives = 79/109 (72%)

Query:    83 VGSYFSYIAAALVGLGYQRDLSMRGAPYDFRKAPNENQEYFANFKALIEETYDLNGGTPV 142
             VGSYF  +  +LVG GY R   +RGAPYD+R+APNEN  YF   + +IEE Y L GG PV
Sbjct:   134 VGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGG-PV 192

Query:   143 VLVAHSMGSLMCLYFLQRQSSAWKSKFVRSLVSLAAPWGGSVKAVKVFA 191
             VLVAHSMG++  LYFLQRQ  AWK K++R+ VSL APWGG  K ++V A
Sbjct:   193 VLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLA 241


GO:0005739 "mitochondrion" evidence=IEA
GO:0006672 "ceramide metabolic process" evidence=IEA
GO:0046470 "phosphatidylcholine metabolic process" evidence=IEA
GO:0005576 "extracellular region" evidence=IEA
GO:0005764 "lysosome" evidence=ISS;NAS
GO:0008374 "O-acyltransferase activity" evidence=ISS
GO:0047499 "calcium-independent phospholipase A2 activity" evidence=ISS
GO:0005543 "phospholipid binding" evidence=TAS
GO:0004622 "lysophospholipase activity" evidence=TAS
GO:0009062 "fatty acid catabolic process" evidence=TAS
RGD|1302982 Pla2g15 "phospholipase A2, group XV" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6XPZ3 PLA2G15 "Group XV phospholipase A2" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:2178076 Pla2g15 "phospholipase A2, group XV" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|H3BMU8 PLA2G15 "Group XV phospholipase A2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q8WMP9 PLA2G15 "Group XV phospholipase A2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1C0B0 PLA2G15 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-6948 pla2g15 "phospholipase A2, group XV" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0051683 CG31683 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0042175 CG18858 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.3.10.691

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query283
pfam02450 377 pfam02450, LACT, Lecithin:cholesterol acyltransfer 1e-38
PLN02733 440 PLN02733, PLN02733, phosphatidylcholine-sterol O-a 4e-10
cd05581 280 cd05581, STKc_PDK1, Catalytic domain of the Protei 6e-09
PTZ00263 329 PTZ00263, PTZ00263, protein kinase A catalytic sub 2e-08
COG2267298 COG2267, PldB, Lysophospholipase [Lipid metabolism 2e-06
smart00220 254 smart00220, S_TKc, Serine/Threonine protein kinase 3e-06
PLN02517 642 PLN02517, PLN02517, phosphatidylcholine-sterol O-a 3e-06
cd05610 669 cd05610, STKc_MASTL, Catalytic domain of the Prote 5e-06
COG1075336 COG1075, LipA, Predicted acetyltransferases and hy 8e-06
cd06623 264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 2e-05
cd05580 290 cd05580, STKc_PKA, Catalytic domain of the Protein 2e-05
cd05573 350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 7e-05
pfam00069 260 pfam00069, Pkinase, Protein kinase domain 1e-04
cd05612 291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 2e-04
pfam12697187 pfam12697, Abhydrolase_6, Alpha/beta hydrolase fam 2e-04
cd05596 370 cd05596, STKc_ROCK, Catalytic domain of the Protei 2e-04
pfam00561226 pfam00561, Abhydrolase_1, alpha/beta hydrolase fol 3e-04
cd05579 265 cd05579, STKc_MAST_like, Catalytic domain of Micro 0.001
cd05574 316 cd05574, STKc_phototropin_like, Catalytic domain o 0.002
cd05122 253 cd05122, PKc_STE, Catalytic domain of STE family P 0.002
cd05123 250 cd05123, STKc_AGC, Catalytic domain of AGC family 0.003
cd05622 371 cd05622, STKc_ROCK1, Catalytic domain of the Prote 0.003
cd07838 287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 0.003
>gnl|CDD|217043 pfam02450, LACT, Lecithin:cholesterol acyltransferase Back     alignment and domain information
 Score =  138 bits (350), Expect = 1e-38
 Identities = 62/171 (36%), Positives = 91/171 (53%), Gaps = 28/171 (16%)

Query: 48  FTLWLNLELLVPEVIDCFIDNLRLVYNNVT-----HPFVRV-----GSYFSY-------- 89
           F +WL+L + +P ++DC+IDN R+V N         P V++     G+  S         
Sbjct: 2   FEIWLDLNVFLPRLVDCWIDNTRMVLNKSCWHVMNDPGVKIRPPGFGATQSVEYLDLSKI 61

Query: 90  --------IAAALVGLGYQRDLSMRGAPYDFRKAPNENQEYFANFKALIEETYDLNGGTP 141
                   +   LV +GY+R+ ++  APYD+R +P E  +YF   K LIEE   L+G   
Sbjct: 62  AGYWIWHKVVKNLVNIGYERNKTVSAAPYDWRLSPAERDDYFKKLKQLIEEALKLSGQ-K 120

Query: 142 VVLVAHSMGSLMCLYFLQRQS-SAWKSKFVRSLVSLAAPWGGSVKAVKVFA 191
           VVL+ HSMG+L+ LYFL       WK + + + +SL AP  GS KAV+  A
Sbjct: 121 VVLIGHSMGNLLVLYFLLWVEAEGWKDQHIDAFISLGAPLLGSPKAVRALA 171


Lecithin:cholesterol acyltransferase (LACT) is involved in extracellular metabolism of plasma lipoproteins, including cholesterol. Length = 377

>gnl|CDD|215390 PLN02733, PLN02733, phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|225176 COG2267, PldB, Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|178132 PLN02517, PLN02517, phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|224001 COG1075, LipA, Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|221720 pfam12697, Abhydrolase_6, Alpha/beta hydrolase family Back     alignment and domain information
>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>gnl|CDD|201306 pfam00561, Abhydrolase_1, alpha/beta hydrolase fold Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 283
KOG2369|consensus 473 99.97
PLN02517 642 phosphatidylcholine-sterol O-acyltransferase 99.97
PLN02733 440 phosphatidylcholine-sterol O-acyltransferase 99.96
PF02450 389 LCAT: Lecithin:cholesterol acyltransferase; InterP 99.94
COG2267298 PldB Lysophospholipase [Lipid metabolism] 99.62
PRK10749330 lysophospholipase L2; Provisional 99.6
PLN02385349 hydrolase; alpha/beta fold family protein 99.59
PHA02857276 monoglyceride lipase; Provisional 99.58
PLN02965255 Probable pheophorbidase 99.58
KOG4409|consensus365 99.57
PLN02298330 hydrolase, alpha/beta fold family protein 99.57
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 99.56
PLN02824294 hydrolase, alpha/beta fold family protein 99.56
PLN02211273 methyl indole-3-acetate methyltransferase 99.56
PRK00870302 haloalkane dehalogenase; Provisional 99.54
PRK03592295 haloalkane dehalogenase; Provisional 99.54
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 99.52
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 99.52
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 99.52
PRK10673255 acyl-CoA esterase; Provisional 99.5
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 99.48
PRK10349256 carboxylesterase BioH; Provisional 99.48
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 99.47
PLN02511388 hydrolase 99.45
PLN02652395 hydrolase; alpha/beta fold family protein 99.45
PLN02679360 hydrolase, alpha/beta fold family protein 99.45
KOG1455|consensus313 99.43
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 99.43
PLN02578354 hydrolase 99.43
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 99.42
PRK10985324 putative hydrolase; Provisional 99.42
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 99.41
KOG1454|consensus326 99.4
PLN03084383 alpha/beta hydrolase fold protein; Provisional 99.4
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 99.4
PRK03204286 haloalkane dehalogenase; Provisional 99.39
TIGR03611257 RutD pyrimidine utilization protein D. This protei 99.39
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 99.37
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 99.37
COG1647243 Esterase/lipase [General function prediction only] 99.37
PLN02894402 hydrolase, alpha/beta fold family protein 99.36
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 99.36
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 99.35
PRK06489360 hypothetical protein; Provisional 99.35
PF01674219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 99.32
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 99.32
PRK08775343 homoserine O-acetyltransferase; Provisional 99.32
PLN02872395 triacylglycerol lipase 99.28
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 99.28
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 99.27
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 99.22
PRK07581339 hypothetical protein; Validated 99.17
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 99.17
KOG2382|consensus315 99.16
PRK13604307 luxD acyl transferase; Provisional 99.16
KOG2564|consensus343 99.12
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 99.11
PRK11071190 esterase YqiA; Provisional 99.11
TIGR01838 532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 99.11
KOG0598|consensus 357 99.1
PRK00175379 metX homoserine O-acetyltransferase; Provisional 99.1
KOG4178|consensus322 99.08
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 99.08
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this pr 99.08
PRK05855 582 short chain dehydrogenase; Validated 99.07
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 99.07
PRK10566249 esterase; Provisional 99.06
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 99.06
KOG0616|consensus 355 99.04
KOG1838|consensus409 99.03
PRK05077414 frsA fermentation/respiration switch protein; Revi 99.03
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 99.01
KOG0605|consensus 550 99.01
TIGR03502792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 99.0
KOG0580|consensus 281 98.99
PLN00021313 chlorophyllase 98.9
COG0429345 Predicted hydrolase of the alpha/beta-hydrolase fo 98.89
KOG3724|consensus 973 98.86
COG1075336 LipA Predicted acetyltransferases and hydrolases w 98.86
PRK07868 994 acyl-CoA synthetase; Validated 98.85
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 98.84
KOG0694|consensus 694 98.83
TIGR01839 560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 98.82
KOG0595|consensus 429 98.78
KOG0592|consensus 604 98.77
KOG0575|consensus 592 98.76
KOG0615|consensus 475 98.76
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 98.75
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 98.73
KOG0585|consensus 576 98.72
PLN02442283 S-formylglutathione hydrolase 98.69
KOG2624|consensus 403 98.66
PRK11460232 putative hydrolase; Provisional 98.65
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 98.65
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 98.63
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 98.6
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 98.59
COG3545181 Predicted esterase of the alpha/beta hydrolase fol 98.56
KOG0610|consensus 459 98.52
KOG0690|consensus 516 98.51
PF06342297 DUF1057: Alpha/beta hydrolase of unknown function 98.5
KOG0695|consensus 593 98.49
PF08538303 DUF1749: Protein of unknown function (DUF1749); In 98.46
PRK06765389 homoserine O-acetyltransferase; Provisional 98.45
COG4814288 Uncharacterized protein with an alpha/beta hydrola 98.45
KOG4667|consensus269 98.44
KOG0611|consensus 668 98.39
PLN02606306 palmitoyl-protein thioesterase 98.38
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 98.37
KOG0597|consensus 808 98.37
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 98.35
PTZ00263 329 protein kinase A catalytic subunit; Provisional 98.34
KOG0600|consensus 560 98.3
KOG1035|consensus 1351 98.28
cd05626 381 STKc_LATS2 Catalytic domain of the Protein Serine/ 98.27
KOG0581|consensus 364 98.27
KOG0659|consensus 318 98.26
KOG0032|consensus 382 98.25
COG3319257 Thioesterase domains of type I polyketide synthase 98.24
cd05599 364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 98.24
KOG2029|consensus697 98.24
cd05629 377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 98.22
PHA03212 391 serine/threonine kinase US3; Provisional 98.22
cd05628 363 STKc_NDR1 Catalytic domain of the Protein Serine/T 98.2
COG2945210 Predicted hydrolase of the alpha/beta superfamily 98.2
cd05598 376 STKc_LATS Catalytic domain of the Protein Serine/T 98.2
PF1214679 Hydrolase_4: Putative lysophospholipase; InterPro: 98.19
KOG2541|consensus296 98.19
PF06057192 VirJ: Bacterial virulence protein (VirJ); InterPro 98.18
cd05625 382 STKc_LATS1 Catalytic domain of the Protein Serine/ 98.18
PF02089279 Palm_thioest: Palmitoyl protein thioesterase; Inte 98.18
KOG0593|consensus 396 98.18
COG4757281 Predicted alpha/beta hydrolase [General function p 98.15
KOG0591|consensus 375 98.15
KOG0586|consensus 596 98.15
KOG4236|consensus 888 98.14
cd05597 331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 98.13
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 98.12
COG3208244 GrsT Predicted thioesterase involved in non-riboso 98.11
KOG0661|consensus 538 98.1
cd05596 370 STKc_ROCK Catalytic domain of the Protein Serine/T 98.1
cd07871 288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 98.1
KOG1152|consensus 772 98.09
COG3571213 Predicted hydrolase of the alpha/beta-hydrolase fo 98.09
KOG0663|consensus 419 98.08
KOG0986|consensus 591 98.07
cd05627 360 STKc_NDR2 Catalytic domain of the Protein Serine/T 98.07
cd05600 333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 98.06
cd05621 370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 98.06
cd07869 303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 98.06
KOG0658|consensus 364 98.05
cd05624 331 STKc_MRCK_beta Catalytic domain of the Protein Ser 98.05
cd05622 371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 98.04
PLN02633314 palmitoyl protein thioesterase family protein 98.04
PTZ00426 340 cAMP-dependent protein kinase catalytic subunit; P 98.03
KOG0582|consensus 516 98.03
cd05612 291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 98.0
PF12740259 Chlorophyllase2: Chlorophyllase enzyme; InterPro: 97.99
KOG0583|consensus 370 97.99
KOG1552|consensus258 97.97
PRK102521296 entF enterobactin synthase subunit F; Provisional 97.97
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 97.96
KOG0612|consensus 1317 97.96
cd05573 350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 97.96
COG3243 445 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me 97.96
cd05623 332 STKc_MRCK_alpha Catalytic domain of the Protein Se 97.93
KOG0608|consensus 1034 97.92
KOG4717|consensus 864 97.92
KOG0594|consensus 323 97.92
KOG0662|consensus 292 97.91
cd07872 309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 97.89
cd07873 301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 97.89
COG2021368 MET2 Homoserine acetyltransferase [Amino acid tran 97.89
cd05601 330 STKc_CRIK Catalytic domain of the Protein Serine/T 97.87
cd06649 331 PKc_MEK2 Catalytic domain of the dual-specificity 97.87
KOG0588|consensus 786 97.84
cd06617 283 PKc_MKK3_6 Catalytic domain of the dual-specificit 97.84
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 97.83
cd07876 359 STKc_JNK2 Catalytic domain of the Serine/Threonine 97.82
cd06650 333 PKc_MEK1 Catalytic domain of the dual-specificity 97.82
TIGR01849406 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, 97.81
cd07848 287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 97.81
PLN00034 353 mitogen-activated protein kinase kinase; Provision 97.8
PHA03209 357 serine/threonine kinase US3; Provisional 97.8
KOG0696|consensus 683 97.79
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 97.79
PTZ00036 440 glycogen synthase kinase; Provisional 97.77
KOG0589|consensus 426 97.75
cd07844 291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 97.75
PRK10162318 acetyl esterase; Provisional 97.74
COG0412236 Dienelactone hydrolase and related enzymes [Second 97.73
cd06615 308 PKc_MEK Catalytic domain of the dual-specificity P 97.71
PF00151331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 97.71
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 97.7
cd07874 355 STKc_JNK3 Catalytic domain of the Serine/Threonine 97.69
cd06619 279 PKc_MKK5 Catalytic domain of the dual-specificity 97.68
PHA03211 461 serine/threonine kinase US3; Provisional 97.67
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 97.66
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 97.65
cd05102 338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 97.65
cd05580 290 STKc_PKA Catalytic domain of the Protein Serine/Th 97.64
cd07870 291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 97.64
cd07845 309 STKc_CDK10 Catalytic domain of the Serine/Threonin 97.63
cd07878 343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 97.63
cd08228 267 STKc_Nek6 Catalytic domain of the Protein Serine/T 97.63
PF03403379 PAF-AH_p_II: Platelet-activating factor acetylhydr 97.61
cd07875 364 STKc_JNK1 Catalytic domain of the Serine/Threonine 97.58
cd06646 267 STKc_MAP4K5 Catalytic domain of the Protein Serine 97.58
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 97.57
PTZ00266 1021 NIMA-related protein kinase; Provisional 97.57
KOG0198|consensus 313 97.56
cd05609 305 STKc_MAST Catalytic domain of the Protein Serine/T 97.56
cd05096 304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 97.55
cd06652 265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 97.54
cd07877 345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 97.54
cd07850 353 STKc_JNK Catalytic domain of the Serine/Threonine 97.54
PLN00009 294 cyclin-dependent kinase A; Provisional 97.54
KOG2984|consensus277 97.53
KOG4840|consensus299 97.53
PF07224307 Chlorophyllase: Chlorophyllase; InterPro: IPR01082 97.53
cd07880 343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 97.52
KOG0577|consensus 948 97.51
cd06625 263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 97.5
cd06656 297 STKc_PAK3 Catalytic domain of the Protein Serine/T 97.5
cd06641 277 STKc_MST3 Catalytic domain of the Protein Serine/T 97.49
cd07865 310 STKc_CDK9 Catalytic domain of the Serine/Threonine 97.49
cd05064 266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 97.48
cd07856 328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 97.48
cd07862 290 STKc_CDK6 Catalytic domain of the Serine/Threonine 97.47
cd05107 401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 97.47
COG4782377 Uncharacterized protein conserved in bacteria [Fun 97.47
cd05104 375 PTKc_Kit Catalytic domain of the Protein Tyrosine 97.45
KOG0667|consensus 586 97.44
PF05677365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 97.44
cd07864 302 STKc_CDK12 Catalytic domain of the Serine/Threonin 97.44
cd06645 267 STKc_MAP4K3 Catalytic domain of the Protein Serine 97.43
cd06616 288 PKc_MKK4 Catalytic domain of the dual-specificity 97.42
cd06639 291 STKc_myosinIIIB Catalytic domain of the Protein Se 97.42
cd05103 343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 97.41
cd05090 283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 97.41
cd05114 256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 97.4
cd05108 316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 97.39
cd07847 286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 97.39
KOG0033|consensus 355 97.39
smart00824212 PKS_TE Thioesterase. Peptide synthetases are invol 97.39
cd08224 267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 97.38
cd06653 264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 97.38
PTZ00283 496 serine/threonine protein kinase; Provisional 97.38
cd06621 287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 97.38
cd05105 400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 97.37
cd06622 286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 97.37
cd08229 267 STKc_Nek7 Catalytic domain of the Protein Serine/T 97.37
cd05106 374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 97.36
cd07868 317 STKc_CDK8 Catalytic domain of the Serine/Threonine 97.35
cd06640 277 STKc_MST4 Catalytic domain of the Protein Serine/T 97.35
cd06613 262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 97.33
cd05574 316 STKc_phototropin_like Catalytic domain of Phototro 97.33
PLN00413479 triacylglycerol lipase 97.32
cd06620 284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 97.32
cd07849 336 STKc_ERK1_2_like Catalytic domain of Extracellular 97.32
cd05581 280 STKc_PDK1 Catalytic domain of the Protein Serine/T 97.32
cd06651 266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 97.32
cd06644 292 STKc_STK10_LOK Catalytic domain of the Protein Ser 97.3
cd06607 307 STKc_TAO Catalytic domain of the Protein Serine/Th 97.3
cd06611 280 STKc_SLK_like Catalytic domain of Ste20-like kinas 97.3
cd07879 342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 97.3
cd06654 296 STKc_PAK1 Catalytic domain of the Protein Serine/T 97.29
KOG4250|consensus 732 97.29
cd05072 261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 97.29
KOG0201|consensus 467 97.28
cd05052 263 PTKc_Abl Catalytic domain of the Protein Tyrosine 97.28
cd06638 286 STKc_myosinIIIA Catalytic domain of the Protein Se 97.28
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 97.28
cd06618 296 PKc_MKK7 Catalytic domain of the dual-specificity 97.28
cd07866 311 STKc_BUR1 Catalytic domain of the Serine/Threonine 97.28
cd06610 267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 97.28
KOG1553|consensus517 97.27
PLN02162475 triacylglycerol lipase 97.27
cd06608 275 STKc_myosinIII_like Catalytic domain of Class III 97.26
PTZ00284 467 protein kinase; Provisional 97.26
cd07858 337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 97.26
KOG0668|consensus 338 97.26
cd07846 286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 97.26
PHA03207 392 serine/threonine kinase US3; Provisional 97.25
KOG0660|consensus 359 97.23
cd06609 274 STKc_MST3_like Catalytic domain of Mammalian Ste20 97.23
PF11187224 DUF2974: Protein of unknown function (DUF2974); In 97.22
cd07833 288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 97.22
PTZ00267 478 NIMA-related protein kinase; Provisional 97.22
cd06629 272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 97.2
cd07854 342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 97.2
cd05066 267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 97.2
PF06259177 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR 97.19
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 97.19
cd05091 283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 97.19
PLN02408365 phospholipase A1 97.18
cd05067 260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 97.18
KOG1006|consensus 361 97.18
cd06655 296 STKc_PAK2 Catalytic domain of the Protein Serine/T 97.17
cd05113 256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 97.17
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 97.16
cd06623 264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 97.15
PF02129272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 97.15
cd06647 293 STKc_PAK_I Catalytic domain of the Protein Serine/ 97.14
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 97.14
cd06612 256 STKc_MST1_2 Catalytic domain of the Protein Serine 97.14
cd07855 334 STKc_ERK5 Catalytic domain of the Serine/Threonine 97.14
KOG1026|consensus 774 97.14
cd05109 279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 97.13
cd07867 317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 97.13
cd07843 293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 97.13
PHA03390 267 pk1 serine/threonine-protein kinase 1; Provisional 97.13
cd07837 295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 97.12
cd05088 303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 97.12
cd05050 288 PTKc_Musk Catalytic domain of the Protein Tyrosine 97.12
cd05065 269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 97.11
KOG0194|consensus 474 97.1
PF01083179 Cutinase: Cutinase; InterPro: IPR000675 Aerial pla 97.1
cd05032 277 PTKc_InsR_like Catalytic domain of Insulin Recepto 97.1
PTZ00024 335 cyclin-dependent protein kinase; Provisional 97.09
cd05081 284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 97.09
KOG0607|consensus 463 97.07
cd05034 261 PTKc_Src_like Catalytic domain of Src kinase-like 97.06
PTZ00472 462 serine carboxypeptidase (CBP1); Provisional 97.06
KOG2345|consensus 302 97.06
PLN02454414 triacylglycerol lipase 97.06
cd07852 337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 97.06
PF10503220 Esterase_phd: Esterase PHB depolymerase 97.05
PRK10115686 protease 2; Provisional 97.05
cd05033 266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 97.05
cd05061 288 PTKc_InsR Catalytic domain of the Protein Tyrosine 97.04
cd06624 268 STKc_ASK Catalytic domain of the Protein Serine/Th 97.04
PLN02934515 triacylglycerol lipase 97.04
cd05048 283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 97.03
cd05110 303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 97.03
cd05148 261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 97.03
COG2819264 Predicted hydrolase of the alpha/beta superfamily 97.02
cd05111 279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 97.02
cd05059 256 PTKc_Tec_like Catalytic domain of Tec-like Protein 97.01
cd05054 337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 97.01
cd05051 296 PTKc_DDR Catalytic domain of the Protein Tyrosine 97.01
cd05068 261 PTKc_Frk_like Catalytic domain of Fyn-related kina 97.0
cd05071 262 PTKc_Src Catalytic domain of the Protein Tyrosine 97.0
KOG0983|consensus 391 96.99
PLN02310405 triacylglycerol lipase 96.96
cd06635 317 STKc_TAO1 Catalytic domain of the Protein Serine/T 96.96
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 96.96
cd05036 277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 96.96
cd06605 265 PKc_MAPKK Catalytic domain of the dual-specificity 96.95
cd06643 282 STKc_SLK Catalytic domain of the Protein Serine/Th 96.95
KOG0192|consensus 362 96.95
cd05039 256 PTKc_Csk_like Catalytic domain of C-terminal Src k 96.92
cd05063 268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 96.91
cd06642 277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 96.9
cd06633 313 STKc_TAO3 Catalytic domain of the Protein Serine/T 96.9
PF07082250 DUF1350: Protein of unknown function (DUF1350); In 96.89
PF05277345 DUF726: Protein of unknown function (DUF726); Inte 96.89
cd05112 256 PTKc_Itk Catalytic domain of the Protein Tyrosine 96.88
cd06637 272 STKc_TNIK Catalytic domain of the Protein Serine/T 96.88
cd05062 277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 96.87
KOG1187|consensus 361 96.87
PRK09188 365 serine/threonine protein kinase; Provisional 96.86
PF00756251 Esterase: Putative esterase; InterPro: IPR000801 T 96.86
cd06636 282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 96.86
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 96.85
cd05097 295 PTKc_DDR_like Catalytic domain of Discoidin Domain 96.84
cd05055 302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 96.83
cd05101 304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 96.82
cd05095 296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 96.81
cd05098 307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 96.8
cd05057 279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 96.79
cd05073 260 PTKc_Hck Catalytic domain of the Protein Tyrosine 96.79
cd05038 284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 96.79
cd05070 260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 96.76
cd05080 283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 96.76
cd05079 284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 96.75
KOG0614|consensus 732 96.74
cd06659 297 STKc_PAK6 Catalytic domain of the Protein Serine/T 96.73
cd05083 254 PTKc_Chk Catalytic domain of the Protein Tyrosine 96.72
cd07851 343 STKc_p38 Catalytic domain of the Serine/Threonine 96.72
cd05089 297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 96.69
cd06614 286 STKc_PAK Catalytic domain of the Protein Serine/Th 96.69
PHA03210 501 serine/threonine kinase US3; Provisional 96.68
KOG1151|consensus 775 96.68
PF12048310 DUF3530: Protein of unknown function (DUF3530); In 96.67
KOG0666|consensus 438 96.67
cd05053 293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 96.66
KOG4391|consensus300 96.65
cd05049 280 PTKc_Trk Catalytic domain of the Protein Tyrosine 96.62
cd06917 277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 96.62
cd06648 285 STKc_PAK_II Catalytic domain of the Protein Serine 96.62
PHA02988 283 hypothetical protein; Provisional 96.61
cd05093 288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 96.6
cd05046 275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 96.59
cd05092 280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 96.58
cd06657 292 STKc_PAK4 Catalytic domain of the Protein Serine/T 96.57
KOG0199|consensus 1039 96.56
cd05082 256 PTKc_Csk Catalytic domain of the Protein Tyrosine 96.54
cd05100 334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 96.54
cd05069 260 PTKc_Yes Catalytic domain of the Protein Tyrosine 96.53
KOG0197|consensus 468 96.51
cd06634 308 STKc_TAO2 Catalytic domain of the Protein Serine/T 96.51
PLN03037525 lipase class 3 family protein; Provisional 96.5
cd05043 280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 96.47
PF12715390 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 96.46
PLN02802509 triacylglycerol lipase 96.46
PF03583290 LIP: Secretory lipase ; InterPro: IPR005152 This e 96.46
cd05056 270 PTKc_FAK Catalytic domain of the Protein Tyrosine 96.44
cd06658 292 STKc_PAK5 Catalytic domain of the Protein Serine/T 96.44
KOG0574|consensus 502 96.43
KOG1094|consensus 807 96.42
KOG0578|consensus 550 96.42
cd05094 291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 96.39
PLN02571413 triacylglycerol lipase 96.33
KOG3847|consensus399 96.33
KOG1290|consensus 590 96.31
KOG0587|consensus 953 96.3
PHA02882 294 putative serine/threonine kinase; Provisional 96.22
PLN02324415 triacylglycerol lipase 96.21
PF05448320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 96.2
cd05099 314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 96.18
PRK10439411 enterobactin/ferric enterobactin esterase; Provisi 96.16
COG4188365 Predicted dienelactone hydrolase [General function 96.15
KOG0193|consensus 678 96.15
KOG4257|consensus 974 96.15
KOG1095|consensus 1025 96.14
COG3946456 VirJ Type IV secretory pathway, VirJ component [In 96.12
KOG0576|consensus 829 96.1
KOG2052|consensus 513 96.09
KOG0584|consensus 632 96.08
PF05577 434 Peptidase_S28: Serine carboxypeptidase S28; InterP 96.07
PLN02753531 triacylglycerol lipase 96.01
COG3458321 Acetyl esterase (deacetylase) [Secondary metabolit 95.97
KOG1989|consensus 738 95.95
PF11339 581 DUF3141: Protein of unknown function (DUF3141); In 95.91
KOG4279|consensus 1226 95.83
KOG2565|consensus 469 95.83
PLN02719518 triacylglycerol lipase 95.77
KOG0984|consensus 282 95.75
COG0400207 Predicted esterase [General function prediction on 95.75
KOG3653|consensus 534 95.74
PRK04940180 hypothetical protein; Provisional 95.69
KOG3975|consensus301 95.67
KOG4372|consensus 405 95.64
KOG1345|consensus 378 95.63
KOG3043|consensus242 95.61
PLN02761527 lipase class 3 family protein 95.61
KOG4627|consensus270 95.61
KOG0196|consensus 996 95.58
PLN02847 633 triacylglycerol lipase 95.51
KOG0579|consensus 1187 95.49
KOG4569|consensus336 95.46
PF08840213 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term 95.43
COG3150191 Predicted esterase [General function prediction on 95.43
KOG2183|consensus 492 95.37
KOG4278|consensus 1157 95.32
KOG0603|consensus 612 95.29
KOG1025|consensus 1177 95.23
KOG1163|consensus 341 95.22
COG3509312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 95.16
KOG2281|consensus867 95.06
KOG0604|consensus 400 95.05
COG0657312 Aes Esterase/lipase [Lipid metabolism] 94.99
KOG0599|consensus 411 94.79
KOG4540|consensus425 94.73
COG5153425 CVT17 Putative lipase essential for disintegration 94.73
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 94.38
PF02273294 Acyl_transf_2: Acyl transferase; InterPro: IPR0031 94.33
KOG4645|consensus 1509 94.32
PLN03224 507 probable serine/threonine protein kinase; Provisio 94.25
COG0627316 Predicted esterase [General function prediction on 94.14
KOG3967|consensus297 93.75
KOG2931|consensus326 93.67
PF09752348 DUF2048: Uncharacterized conserved protein (DUF204 93.62
PRK10345 210 hypothetical protein; Provisional 93.59
PF03096283 Ndr: Ndr family; InterPro: IPR004142 This family c 93.42
KOG4721|consensus 904 93.13
KOG1515|consensus336 92.86
KOG2237|consensus712 92.57
KOG3101|consensus283 92.39
smart00090 237 RIO RIO-like kinase. 92.18
COG2936 563 Predicted acyl esterases [General function predict 91.94
KOG0669|consensus 376 91.85
COG2272 491 PnbA Carboxylesterase type B [Lipid metabolism] 91.64
PRK10359 232 lipopolysaccharide core biosynthesis protein; Prov 91.6
KOG1165|consensus 449 90.62
COG1770682 PtrB Protease II [Amino acid transport and metabol 90.26
PF11144403 DUF2920: Protein of unknown function (DUF2920); In 89.68
COG4099387 Predicted peptidase [General function prediction o 89.42
PF0408363 Abhydro_lipase: Partial alpha/beta-hydrolase lipas 88.76
KOG2385|consensus633 88.68
KOG2182|consensus 514 88.63
PF10340374 DUF2424: Protein of unknown function (DUF2424); In 88.42
PF08237225 PE-PPE: PE-PPE domain; InterPro: IPR013228 The hum 88.01
KOG0670|consensus 752 87.93
KOG1167|consensus 418 87.76
KOG2112|consensus206 87.76
cd05144 198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 87.1
COG2382299 Fes Enterochelin esterase and related enzymes [Ino 87.08
PRK04750 537 ubiB putative ubiquinone biosynthesis protein UbiB 86.34
>KOG2369|consensus Back     alignment and domain information
Probab=99.97  E-value=9.6e-31  Score=226.80  Aligned_cols=181  Identities=43%  Similarity=0.787  Sum_probs=167.3

Q ss_pred             cEEEecCCccccceEEec-CCCcce-eeeccCCCCccc--ccccccccccccccccccceeeeeeCCCCCc---------
Q psy4395          14 VRKEMPGDGGSQVEARLN-KTETVH-YICDKTTSNWFT--LWLNLELLVPEVIDCFIDNLRLVYNNVTHPF---------   80 (283)
Q Consensus        14 pvv~ipG~~gs~L~~~~~-~~~~~~-~~c~~~~~~~~~--~w~~~~~~~~~~~~~~~~~~~l~~~~~~~~~---------   80 (283)
                      ||++|||.+|+.|++.+. +|+..+ |.|.+.+..+||  +|.+..++++..++||.+...+.+|+.++.+         
T Consensus        32 pv~lv~g~gg~~l~~v~~~~p~vv~~W~~~~~a~~~FrkrLW~~~~~l~~~~~~cw~~~~~lvld~~tGLd~pg~~lRvp  111 (473)
T KOG2369|consen   32 PVLLVPGDGGSQLHPVLDGKPGVVRLWVCIKCAEGYFRKRLWLDLNMLLPKTIDCWCDNEHLVLDPETGLDPPGVKLRVP  111 (473)
T ss_pred             ceEEecCCccccccceecCCCCEEEEEEeecCchHHHhHHHhhhccccccccccccccceEEeecCccCCCCCcceeecC
Confidence            999999999999999999 899888 999999989997  9999999999999999999999999998776         


Q ss_pred             cc-------cc-chHHHHHHHHHhCCcccCCCcCcCCCCCCCCC---CcchHHHHHHHHHHHHHHHHcCCCCEEEEEeCc
Q psy4395          81 VR-------VG-SYFSYIAAALVGLGYQRDLSMRGAPYDFRKAP---NENQEYFANFKALIEETYDLNGGTPVVLVAHSM  149 (283)
Q Consensus        81 ~~-------~~-~~~~~l~~~L~~~g~~~~~d~~g~g~~~r~~~---~~~~~~~~~l~~~i~~~~~~~~~~~v~lvgHSm  149 (283)
                      +-       .+ .||+.+++.|...||.-.-+++|++||||++.   ...+.++.+|+..||...+.++++||+||+|||
T Consensus       112 gf~s~~~ld~~y~~w~~~i~~lv~~GYe~~~~l~ga~YDwRls~~~~e~rd~yl~kLK~~iE~~~~~~G~kkVvlisHSM  191 (473)
T KOG2369|consen  112 GFESLDYLDPGYWYWHELIENLVGIGYERGKTLFGAPYDWRLSYHNSEERDQYLSKLKKKIETMYKLNGGKKVVLISHSM  191 (473)
T ss_pred             CceeeecccchhHHHHHHHHHHHhhCcccCceeeccccchhhccCChhHHHHHHHHHHHHHHHHHHHcCCCceEEEecCC
Confidence            00       11 37999999999999998889999999999954   468899999999999999999988999999999


Q ss_pred             ccHHHHHHHHcCCh---hHHhhhhcceEEecCCCCcchhhHHHHhhhc
Q psy4395         150 GSLMCLYFLQRQSS---AWKSKFVRSLVSLAAPWGGSVKAVKVFAVEN  194 (283)
Q Consensus       150 Gg~va~~~~~~~~~---~~~~~~v~~~i~i~~p~~g~~~~~~~~~~g~  194 (283)
                      ||++.++|+.++++   .|++++|+++|.+++|+.|+++++..+.+|+
T Consensus       192 G~l~~lyFl~w~~~~~~~W~~k~I~sfvnig~p~lG~~k~v~~l~Sge  239 (473)
T KOG2369|consen  192 GGLYVLYFLKWVEAEGPAWCDKYIKSFVNIGAPWLGSPKAVKLLASGE  239 (473)
T ss_pred             ccHHHHHHHhcccccchhHHHHHHHHHHccCchhcCChHHHhHhhccc
Confidence            99999999999998   8999999999999999999999999999993



>PLN02517 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>KOG4409|consensus Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>KOG1455|consensus Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>KOG1454|consensus Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>KOG2382|consensus Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>KOG2564|consensus Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>KOG4178|consensus Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>KOG1838|consensus Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG3724|consensus Back     alignment and domain information
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>KOG0595|consensus Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>KOG0575|consensus Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>KOG2624|consensus Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold Back     alignment and domain information
>KOG0695|consensus Back     alignment and domain information
>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG4667|consensus Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>PLN02606 palmitoyl-protein thioesterase Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>KOG0600|consensus Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG2029|consensus Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>KOG2541|consensus Back     alignment and domain information
>PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>PF02089 Palm_thioest: Palmitoyl protein thioesterase; InterPro: IPR002472 Neuronal ceroid lipofuscinoses (NCL) represent a group of encephalopathies that occur in 1 in 12,500 children Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>KOG0586|consensus Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG0661|consensus Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>KOG1152|consensus Back     alignment and domain information
>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG0663|consensus Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>KOG0658|consensus Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>PLN02633 palmitoyl protein thioesterase family protein Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>KOG0582|consensus Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>KOG1552|consensus Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>KOG0608|consensus Back     alignment and domain information
>KOG4717|consensus Back     alignment and domain information
>KOG0594|consensus Back     alignment and domain information
>KOG0662|consensus Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>KOG0588|consensus Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>KOG0589|consensus Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>KOG2984|consensus Back     alignment and domain information
>KOG4840|consensus Back     alignment and domain information
>PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0577|consensus Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>KOG0667|consensus Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>smart00824 PKS_TE Thioesterase Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PLN00413 triacylglycerol lipase Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>KOG4250|consensus Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>KOG1553|consensus Back     alignment and domain information
>PLN02162 triacylglycerol lipase Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>KOG0668|consensus Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0660|consensus Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>PLN02408 phospholipase A1 Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>KOG1006|consensus Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>KOG1026|consensus Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>KOG0607|consensus Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>KOG2345|consensus Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>PLN02934 triacylglycerol lipase Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>KOG0983|consensus Back     alignment and domain information
>PLN02310 triacylglycerol lipase Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>KOG0192|consensus Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants Back     alignment and domain information
>PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>KOG1187|consensus Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG1151|consensus Back     alignment and domain information
>PF12048 DUF3530: Protein of unknown function (DUF3530); InterPro: IPR022529 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG0666|consensus Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>KOG4391|consensus Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>PLN03037 lipase class 3 family protein; Provisional Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A Back     alignment and domain information
>PLN02802 triacylglycerol lipase Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>KOG0574|consensus Back     alignment and domain information
>KOG1094|consensus Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>KOG3847|consensus Back     alignment and domain information
>KOG1290|consensus Back     alignment and domain information
>KOG0587|consensus Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>PLN02324 triacylglycerol lipase Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>COG4188 Predicted dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>KOG0193|consensus Back     alignment and domain information
>KOG4257|consensus Back     alignment and domain information
>KOG1095|consensus Back     alignment and domain information
>COG3946 VirJ Type IV secretory pathway, VirJ component [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0576|consensus Back     alignment and domain information
>KOG2052|consensus Back     alignment and domain information
>KOG0584|consensus Back     alignment and domain information
>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PLN02753 triacylglycerol lipase Back     alignment and domain information
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1989|consensus Back     alignment and domain information
>PF11339 DUF3141: Protein of unknown function (DUF3141); InterPro: IPR024501 This family of proteins appears to be predominantly expressed in Proteobacteria Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>KOG2565|consensus Back     alignment and domain information
>PLN02719 triacylglycerol lipase Back     alignment and domain information
>KOG0984|consensus Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>KOG3653|consensus Back     alignment and domain information
>PRK04940 hypothetical protein; Provisional Back     alignment and domain information
>KOG3975|consensus Back     alignment and domain information
>KOG4372|consensus Back     alignment and domain information
>KOG1345|consensus Back     alignment and domain information
>KOG3043|consensus Back     alignment and domain information
>PLN02761 lipase class 3 family protein Back     alignment and domain information
>KOG4627|consensus Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>PLN02847 triacylglycerol lipase Back     alignment and domain information
>KOG0579|consensus Back     alignment and domain information
>KOG4569|consensus Back     alignment and domain information
>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH Back     alignment and domain information
>COG3150 Predicted esterase [General function prediction only] Back     alignment and domain information
>KOG2183|consensus Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>KOG1025|consensus Back     alignment and domain information
>KOG1163|consensus Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG2281|consensus Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>KOG4540|consensus Back     alignment and domain information
>COG5153 CVT17 Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking and secretion / Lipid metabolism] Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>PF02273 Acyl_transf_2: Acyl transferase; InterPro: IPR003157 LuxD proteins are bacterial acyl transferases Back     alignment and domain information
>KOG4645|consensus Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>COG0627 Predicted esterase [General function prediction only] Back     alignment and domain information
>KOG3967|consensus Back     alignment and domain information
>KOG2931|consensus Back     alignment and domain information
>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3 Back     alignment and domain information
>KOG4721|consensus Back     alignment and domain information
>KOG1515|consensus Back     alignment and domain information
>KOG2237|consensus Back     alignment and domain information
>KOG3101|consensus Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>COG2936 Predicted acyl esterases [General function prediction only] Back     alignment and domain information
>KOG0669|consensus Back     alignment and domain information
>COG2272 PnbA Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>KOG1165|consensus Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>PF04083 Abhydro_lipase: Partial alpha/beta-hydrolase lipase region; InterPro: IPR006693 The alpha/beta hydrolase fold is common to several hydrolytic enzymes of widely differing phylogenetic origin and catalytic function Back     alignment and domain information
>KOG2385|consensus Back     alignment and domain information
>KOG2182|consensus Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>PF08237 PE-PPE: PE-PPE domain; InterPro: IPR013228 The human pathogen Mycobacterium tuberculosis harbours a large number of genes that encode proteins whose N-termini contain the characteristic motifs Pro-Glu (PE) or Pro-Pro-Glu (PPE) Back     alignment and domain information
>KOG0670|consensus Back     alignment and domain information
>KOG1167|consensus Back     alignment and domain information
>KOG2112|consensus Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>COG2382 Fes Enterochelin esterase and related enzymes [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query283
2bmc_A 306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 2e-11
2j4z_A 306 Structure Of Aurora-2 In Complex With Pha-680626 Le 2e-11
1muo_A 297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 2e-11
3r21_A 271 Design, Synthesis, And Biological Evaluation Of Pyr 3e-11
2wtv_A 285 Aurora-A Inhibitor Structure Length = 285 4e-11
2wtw_A 285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 5e-11
1ol6_A 282 Structure Of Unphosphorylated D274n Mutant Of Auror 5e-11
2xng_A 283 Structure Of Aurora-A Bound To A Selective Imidazop 5e-11
2dwb_A 285 Aurora-A Kinase Complexed With Amppnp Length = 285 5e-11
3unz_A 279 Aurora A In Complex With Rpm1679 Length = 279 5e-11
2x6d_A 285 Aurora-A Bound To An Inhibitor Length = 285 5e-11
3fdn_A 279 Structure-Based Drug Design Of Novel Aurora Kinase 5e-11
1ol5_A 282 Structure Of Aurora-A 122-403, Phosphorylated On Th 5e-11
2c6e_A 283 Aurora A Kinase Activated Mutant (T287d) In Complex 5e-11
2xne_A 272 Structure Of Aurora-A Bound To An Imidazopyrazine I 5e-11
3qbn_A 281 Structure Of Human Aurora A In Complex With A Diami 5e-11
2w1d_A 275 Structure Determination Of Aurora Kinase In Complex 5e-11
2w1c_A 275 Structure Determination Of Aurora Kinase In Complex 5e-11
3nrm_A 283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 6e-11
2c6d_A 275 Aurora A Kinase Activated Mutant (T287d) In Complex 7e-11
3coh_A 268 Crystal Structure Of Aurora-A In Complex With A Pen 1e-10
2xru_A 280 Aurora-A T288e Complexed With Pha-828300 Length = 2 1e-10
3lau_A 287 Crystal Structure Of Aurora2 Kinase In Complex With 1e-10
2j50_A 280 Structure Of Aurora-2 In Complex With Pha-739358 Le 1e-10
3h0y_A 268 Aurora A In Complex With A Bisanilinopyrimidine Len 1e-10
1mq4_A 272 Crystal Structure Of Aurora-A Protein Kinase Length 1e-10
3ha6_A 268 Crystal Structure Of Aurora A In Complex With Tpx2 1e-10
3e5a_A 268 Crystal Structure Of Aurora A In Complex With Vx-68 1e-10
3o50_A 267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 1e-10
2wqe_A 262 Structure Of S155r Aurora-A Somatic Mutant Length = 3e-10
4af3_A 292 Human Aurora B Kinase In Complex With Incenp And Vx 3e-10
3d14_A 272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 6e-10
3daj_A 272 Crystal Structure Of Aurora A Complexed With An Inh 6e-10
2vrx_A 285 Structure Of Aurora B Kinase In Complex With Zm4474 2e-09
2bfx_B 284 Mechanism Of Aurora-B Activation By Incenp And Inhi 2e-09
2bfy_A 284 Complex Of Aurora-B With Incenp And Hesperidin. Len 2e-08
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure

Iteration: 1

Score = 66.2 bits (160), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 35/80 (43%), Positives = 51/80 (63%), Gaps = 7/80 (8%) Query: 191 AVENKENVEEYLKKMQTHYDAREAPNKSYRWQMSDFEVGCPLGTGKFGHVYLAKEKTTQI 250 A EN N EE L Q + ++ K +W + DFE+G PLG GKFG+VYLA+EK ++ Sbjct: 8 APEN--NPEEELASKQKNEES-----KKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKF 60 Query: 251 MIALKVLYKVEIINERMTHQ 270 ++ALKVL+K ++ + HQ Sbjct: 61 ILALKVLFKAQLEKAGVEHQ 80
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|4AF3|A Chain A, Human Aurora B Kinase In Complex With Incenp And Vx-680 Length = 292 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|2VRX|A Chain A, Structure Of Aurora B Kinase In Complex With Zm447439 Length = 285 Back     alignment and structure
>pdb|2BFY|A Chain A, Complex Of Aurora-B With Incenp And Hesperidin. Length = 284 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query283
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 3e-17
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 8e-17
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 2e-14
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 5e-13
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 5e-11
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 1e-10
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 2e-10
1uu3_A 310 HPDK1, 3-phosphoinositide dependent protein kinase 5e-10
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 9e-10
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 2e-09
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 5e-09
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 5e-09
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 8e-09
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 9e-09
1ys1_X 320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 1e-08
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 3e-08
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 4e-08
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 1e-07
3pvu_A 695 Beta-adrenergic receptor kinase 1; transferase, se 4e-07
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 9e-07
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 1e-06
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 1e-06
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 1e-06
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 1e-06
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 1e-06
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 2e-06
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 2e-06
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 2e-06
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 3e-06
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 3e-06
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 5e-06
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 6e-06
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 6e-06
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 9e-06
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 1e-05
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 1e-05
3aln_A 327 Dual specificity mitogen-activated protein kinase; 1e-05
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 1e-05
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 1e-05
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 2e-05
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 2e-05
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 2e-05
2a19_B 284 Interferon-induced, double-stranded RNA-activated 2e-05
3lp5_A250 Putative cell surface hydrolase; structural genom 3e-05
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 3e-05
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 3e-05
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 3e-05
3an0_A 340 Dual specificity mitogen-activated protein kinase; 4e-05
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 4e-05
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 4e-05
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 5e-05
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 5e-05
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 5e-05
3fme_A 290 Dual specificity mitogen-activated protein kinase; 5e-05
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 6e-05
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 7e-05
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 7e-05
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 7e-05
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 7e-05
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 7e-05
3is5_A 285 Calcium-dependent protein kinase; CDPK, structural 8e-05
3bhy_A 283 Death-associated protein kinase 3; death associate 1e-04
2dyl_A 318 Dual specificity mitogen-activated protein kinase 1e-04
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 1e-04
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 1e-04
4apc_A 350 Serine/threonine-protein kinase NEK1; transferase; 2e-04
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 2e-04
3g51_A 325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 2e-04
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 2e-04
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 2e-04
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 2e-04
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 2e-04
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 2e-04
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 2e-04
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 2e-04
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 2e-04
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 2e-04
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 3e-04
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 3e-04
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 3e-04
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 3e-04
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 3e-04
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 3e-04
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 3e-04
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 3e-04
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 3e-04
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 4e-04
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 4e-04
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 4e-04
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 5e-04
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 5e-04
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 5e-04
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 5e-04
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 7e-04
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 8e-04
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 9e-04
3niz_A 311 Rhodanese family protein; structural genomics, str 9e-04
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
 Score = 78.8 bits (195), Expect = 3e-17
 Identities = 27/55 (49%), Positives = 41/55 (74%)

Query: 216 NKSYRWQMSDFEVGCPLGTGKFGHVYLAKEKTTQIMIALKVLYKVEIINERMTHQ 270
           +K  +W + DFE+G PLG GKFG+VYLA+EK ++ ++ALKVL+K ++    + HQ
Sbjct: 1   SKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQ 55


>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Length = 181 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Length = 342 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Length = 316 Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Length = 320 Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Length = 317 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Length = 249 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Length = 484 Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Length = 285 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Length = 254 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Length = 250 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Length = 303 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Length = 342 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Length = 354 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query283
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 99.68
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 99.66
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 99.66
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 99.65
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 99.64
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 99.64
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 99.64
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 99.63
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 99.63
1r3d_A264 Conserved hypothetical protein VC1974; structural 99.63
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 99.63
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 99.63
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 99.63
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 99.63
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 99.62
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 99.62
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 99.62
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 99.61
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 99.61
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 99.6
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 99.6
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 99.6
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 99.6
3lp5_A250 Putative cell surface hydrolase; structural genom 99.6
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 99.59
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 99.59
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 99.59
1iup_A282 META-cleavage product hydrolase; aromatic compound 99.59
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 99.58
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 99.58
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 99.58
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 99.57
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 99.57
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 99.57
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 99.57
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 99.57
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 99.57
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 99.56
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 99.56
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 99.56
1ys1_X 320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 99.56
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 99.56
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 99.55
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 99.55
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 99.55
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 99.55
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 99.55
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 99.54
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 99.54
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 99.54
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 99.54
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 99.54
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 99.54
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 99.53
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 99.53
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 99.53
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 99.53
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 99.52
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 99.52
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 99.52
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 99.52
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 99.52
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 99.51
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 99.51
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 99.5
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 99.5
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 99.49
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 99.49
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 99.49
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 99.49
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 99.48
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 99.48
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 99.47
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 99.47
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 99.47
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 99.47
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 99.46
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 99.46
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 99.46
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 99.45
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 99.45
2dsn_A 387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 99.45
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 99.44
3llc_A270 Putative hydrolase; structural genomics, joint cen 99.43
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 99.43
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 99.42
2e3j_A 356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 99.42
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 99.14
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 99.42
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 99.42
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 99.41
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 99.41
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 99.41
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 99.4
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 99.4
2hih_A 431 Lipase 46 kDa form; A1 phospholipase, phospholipid 99.4
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 99.39
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 99.39
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 99.39
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 99.38
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 99.38
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 99.38
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 99.38
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 99.38
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 99.38
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 99.35
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 99.35
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 99.32
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 99.31
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 99.31
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 99.3
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 99.3
2vat_A 444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 99.3
2y6u_A 398 Peroxisomal membrane protein LPX1; hydrolase, puta 99.29
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 99.29
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 99.29
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 99.29
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 99.29
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 99.29
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 99.29
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 99.28
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 99.26
1gpl_A 432 RP2 lipase; serine esterase, hydrolase, lipid degr 99.26
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 99.26
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 99.24
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 99.24
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 99.23
3h04_A275 Uncharacterized protein; protein with unknown func 99.22
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 99.21
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 99.21
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 99.21
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 99.21
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 99.2
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 99.19
4aw0_A 311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.18
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 99.18
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 99.18
1kez_A300 Erythronolide synthase; polyketide synthase, modul 99.17
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 99.16
4fle_A202 Esterase; structural genomics, PSI-biology, northe 99.16
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 99.15
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 99.12
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 99.12
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 99.12
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 99.12
1vkh_A273 Putative serine hydrolase; structural genomics, jo 99.11
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 99.11
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 99.09
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 99.09
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 99.07
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 99.05
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 99.02
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 99.02
3bjr_A283 Putative carboxylesterase; structural genomics, jo 99.01
3tej_A329 Enterobactin synthase component F; nonribosomal pe 99.01
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 99.01
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 98.98
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.97
3hyh_A 275 Carbon catabolite-derepressing protein kinase; kin 98.97
4b9d_A 350 Serine/threonine-protein kinase NEK1; transferase, 98.97
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 98.97
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 98.97
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 98.96
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 98.96
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 98.96
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 98.95
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 98.94
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 98.94
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 98.94
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 98.93
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 98.91
3ain_A323 303AA long hypothetical esterase; carboxylesterase 98.91
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 98.9
4fih_A 346 Serine/threonine-protein kinase PAK 4; kinase doma 98.9
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 98.9
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 98.88
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 98.88
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 98.88
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 98.88
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 98.87
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 98.85
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.85
3ubd_A 304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 98.83
3d59_A383 Platelet-activating factor acetylhydrolase; secret 98.82
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 98.82
4fie_A 423 Serine/threonine-protein kinase PAK 4; kinase doma 98.81
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 98.8
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 98.8
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 98.8
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 98.79
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 98.79
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 98.78
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.77
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 98.77
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.76
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 98.76
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 98.75
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 98.73
4b99_A 398 Mitogen-activated protein kinase 7; transferase, i 98.72
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 98.72
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 98.72
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 98.71
3fpq_A 290 Serine/threonine-protein kinase WNK1; protein seri 98.69
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 98.68
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 98.68
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 98.68
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 98.66
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 98.66
4asz_A 299 BDNF/NT-3 growth factors receptor; transferase, TR 98.64
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 98.62
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 98.62
4aoj_A 329 High affinity nerve growth factor receptor; transf 98.62
3nuz_A398 Putative acetyl xylan esterase; structural genomic 98.61
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 98.61
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.6
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 98.59
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 98.59
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 98.57
4gt4_A 308 Tyrosine-protein kinase transmembrane receptor RO; 98.57
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 98.56
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 98.56
3hmm_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 98.55
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 98.54
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 98.54
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 98.53
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 98.52
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.52
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 98.52
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 98.52
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 98.52
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 98.5
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.5
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 98.49
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 98.49
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 98.48
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 98.47
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.46
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 98.45
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 98.44
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 98.44
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 98.43
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 98.42
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 98.41
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 98.41
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 98.41
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 98.4
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 98.39
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 98.37
2px6_A316 Thioesterase domain; thioesaterse domain, orlistat 98.37
3o0g_A 292 Cell division protein kinase 5; kinase activator c 98.36
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 98.36
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 98.36
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 98.36
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 98.35
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 98.35
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 98.33
4f9c_A 361 Cell division cycle 7-related protein kinase; Ser/ 98.33
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 98.32
3zgw_A 347 Maternal embryonic leucine zipper kinase; transfer 98.31
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 98.31
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 98.3
2zv2_A 298 Calcium/calmodulin-dependent protein kinase kinas; 98.29
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 98.27
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 98.27
3uqc_A 286 Probable conserved transmembrane protein; structur 98.26
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 98.26
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 98.25
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 98.25
3omv_A 307 RAF proto-oncogene serine/threonine-protein kinas; 98.24
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 98.23
3fme_A 290 Dual specificity mitogen-activated protein kinase; 98.23
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 98.22
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 98.22
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 98.21
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 98.21
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 98.21
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 98.21
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 98.2
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 98.2
3ork_A 311 Serine/threonine protein kinase; structural genomi 98.19
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 98.18
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 98.18
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 98.18
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 98.18
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 98.17
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 98.17
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 98.16
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 98.16
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 98.16
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 98.15
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 98.15
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 98.15
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 98.15
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 98.15
3aln_A 327 Dual specificity mitogen-activated protein kinase; 98.15
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 98.14
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 98.14
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 98.14
4ase_A 353 Vascular endothelial growth factor receptor 2; tra 98.14
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 98.13
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 98.13
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 98.12
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 98.12
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 98.12
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 98.11
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 98.11
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 98.11
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 98.11
3rp9_A 458 Mitogen-activated protein kinase; structural genom 98.11
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 98.1
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 98.1
3niz_A 311 Rhodanese family protein; structural genomics, str 98.1
3soc_A 322 Activin receptor type-2A; structural genomics cons 98.1
2h34_A 309 Serine/threonine-protein kinase PKNE; apoenzyme, t 98.09
3an0_A 340 Dual specificity mitogen-activated protein kinase; 98.09
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 98.08
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 98.08
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 98.08
2dyl_A 318 Dual specificity mitogen-activated protein kinase 98.07
3is5_A 285 Calcium-dependent protein kinase; CDPK, structural 98.07
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 98.06
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 98.06
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 98.06
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 98.05
4exu_A 371 Mitogen-activated protein kinase 13; P38 kinase, t 98.05
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 98.05
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 98.04
3bhy_A 283 Death-associated protein kinase 3; death associate 98.04
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 98.04
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 98.03
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 98.03
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 98.02
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 98.02
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 98.01
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 98.01
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 98.01
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 98.01
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 98.01
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 98.01
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 98.01
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 98.0
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 98.0
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 97.99
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 97.99
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 97.98
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 97.98
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 97.98
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 97.98
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 97.98
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 97.97
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 97.97
4f21_A246 Carboxylesterase/phospholipase family protein; str 97.97
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 97.97
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 97.96
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 97.96
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 97.96
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 97.96
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 97.96
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 97.95
3kmu_A 271 ILK, integrin-linked kinase; cell adhesion, ANK re 97.95
4hcu_A 269 Tyrosine-protein kinase ITK/TSK; transferase-trans 97.95
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 97.95
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 97.94
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 97.94
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 97.93
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 97.93
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 97.93
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 97.92
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 97.92
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 97.92
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 97.92
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 97.91
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 97.91
3guu_A 462 Lipase A; protein structure, hydrolase; HET: 1PE; 97.9
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 97.9
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 97.9
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 97.89
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 97.89
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 97.89
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 97.88
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 97.88
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 97.88
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 97.87
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 97.87
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 97.87
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 97.86
3q4u_A 301 Activin receptor type-1; structural genomics conso 97.86
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 97.85
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 97.84
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 97.84
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 97.84
1t4h_A 290 Serine/threonine-protein kinase WNK1; protein seri 97.84
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 97.83
2a19_B 284 Interferon-induced, double-stranded RNA-activated 97.81
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 97.8
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 97.8
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 97.8
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 97.8
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 97.79
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 97.79
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 97.79
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 97.79
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 97.78
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 97.78
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 97.78
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 97.77
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 97.77
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 97.77
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 97.76
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 97.75
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 97.75
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 97.74
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 97.74
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 97.74
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 97.72
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 97.72
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 97.72
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 97.72
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 97.72
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 97.71
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 97.71
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 97.71
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 97.7
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 97.7
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 97.7
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 97.69
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 97.69
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 97.69
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 97.68
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 97.67
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 97.67
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 97.67
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 97.67
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 97.66
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 97.66
3pls_A 298 Macrophage-stimulating protein receptor; protein k 97.64
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 97.63
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 97.62
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 97.61
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 97.61
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 97.61
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 97.61
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 97.6
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 97.6
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 97.59
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 97.56
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 97.54
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 97.54
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 97.54
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 97.54
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 97.54
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 97.53
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 97.52
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 97.51
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 97.48
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 97.48
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 97.47
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 97.46
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 97.45
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 97.44
2v62_A 345 Serine/threonine-protein kinase VRK2; transferase, 97.43
1csn_A 298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 97.43
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 97.41
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 97.39
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 97.38
3ngm_A319 Extracellular lipase; secret lipase, hydrolase; 2. 97.38
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 97.31
3o0d_A301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 97.29
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 97.28
2vuw_A 336 Serine/threonine-protein kinase haspin; cell cycle 97.28
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 97.27
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 97.24
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 97.2
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 97.19
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 97.19
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 97.16
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 97.11
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 97.11
2jii_A 352 Serine/threonine-protein kinase VRK3 molecule: VA 97.09
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 97.08
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 96.96
4hgt_A 296 Casein kinase I isoform delta; CK1D, inhibitor, tr 96.92
3uzp_A 296 CKI-delta, CKID, casein kinase I isoform delta; CK 96.9
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 96.81
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 96.74
3qpa_A197 Cutinase; alpha-beta hydrolase fold, esterase, hyd 96.72
3qpd_A187 Cutinase 1; alpha-beta hydrolase fold, esterase, h 96.55
3dcn_A201 Cutinase, cutin hydrolase; catalytic triad, secret 96.5
4fol_A299 FGH, S-formylglutathione hydrolase; D-type esteras 96.48
1qoz_A207 AXE, acetyl xylan esterase; hydrolase, xylan degra 96.44
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 96.42
1g66_A207 Acetyl xylan esterase II; serine hydrolase, acetyl 96.39
3gff_A331 IROE-like serine hydrolase; NP_718593.1, structura 96.38
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 96.26
2ory_A346 Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph 96.01
3hc7_A254 Gene 12 protein, GP12; alpha/beta sandwich, cell a 95.98
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 95.74
2yij_A419 Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid 94.64
2czq_A205 Cutinase-like protein; alpha/beta hydrolase fold, 95.65
4ebb_A 472 Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2 95.63
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
Probab=99.68  E-value=5.8e-17  Score=137.16  Aligned_cols=88  Identities=13%  Similarity=0.209  Sum_probs=73.8

Q ss_pred             HHHHHHHHHhCCc-ccCCCcCcCCCCCCC-CCCcchHHHHHHHHHHHHHHHHcCCCCEEEEEeCcccHHHHHHHHcCChh
Q psy4395          87 FSYIAAALVGLGY-QRDLSMRGAPYDFRK-APNENQEYFANFKALIEETYDLNGGTPVVLVAHSMGSLMCLYFLQRQSSA  164 (283)
Q Consensus        87 ~~~l~~~L~~~g~-~~~~d~~g~g~~~r~-~~~~~~~~~~~l~~~i~~~~~~~~~~~v~lvgHSmGg~va~~~~~~~~~~  164 (283)
                      |..+++.|+++|| |+++|+||||.+... ......++.+|+.++++.+.+..  .+++|+||||||.+++.++..+|+.
T Consensus        67 ~~~la~~La~~Gy~Via~Dl~GhG~S~~~~~~~~~~~~~~d~~~~~~~l~~~~--~~v~lvG~S~GG~ia~~~a~~~p~~  144 (281)
T 4fbl_A           67 MRFLAEGFARAGYTVATPRLTGHGTTPAEMAASTASDWTADIVAAMRWLEERC--DVLFMTGLSMGGALTVWAAGQFPER  144 (281)
T ss_dssp             GHHHHHHHHHTTCEEEECCCTTSSSCHHHHHTCCHHHHHHHHHHHHHHHHHHC--SEEEEEEETHHHHHHHHHHHHSTTT
T ss_pred             HHHHHHHHHHCCCEEEEECCCCCCCCCccccCCCHHHHHHHHHHHHHHHHhCC--CeEEEEEECcchHHHHHHHHhCchh
Confidence            4578999999999 999999999977431 22356778899999999887653  4899999999999999999999987


Q ss_pred             HHhhhhcceEEecCCCC
Q psy4395         165 WKSKFVRSLVSLAAPWG  181 (283)
Q Consensus       165 ~~~~~v~~~i~i~~p~~  181 (283)
                           |+++|+++++..
T Consensus       145 -----v~~lvl~~~~~~  156 (281)
T 4fbl_A          145 -----FAGIMPINAALR  156 (281)
T ss_dssp             -----CSEEEEESCCSC
T ss_pred             -----hhhhhcccchhc
Confidence                 999999988754



>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>3qpa_A Cutinase; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted; HET: MIR; 0.85A {Nectria haematococca} PDB: 3qpc_A* 1cex_A 1oxm_A* 1cui_A 1cus_A 2cut_A 1cuj_A 1cuy_A 1xzl_A* 1xzk_A* 1xzm_A* 1cuh_A 1cuu_A 3esc_A* 1cua_A* 3esa_A* 3esb_A* 3ef3_A* 3esd_A* 1cux_A ... Back     alignment and structure
>3qpd_A Cutinase 1; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted, phosphorylated Ser residue; HET: SEP; 1.57A {Aspergillus oryzae} PDB: 3gbs_A Back     alignment and structure
>3dcn_A Cutinase, cutin hydrolase; catalytic triad, secreted, serine esterase; 1.90A {Glomerella cingulata} SCOP: c.69.1.0 PDB: 3dd5_A 3dea_A* Back     alignment and structure
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
>1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30 Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A* Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} Back     alignment and structure
>3hc7_A Gene 12 protein, GP12; alpha/beta sandwich, cell adhesion; 2.00A {Mycobacterium phage D29} Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2czq_A Cutinase-like protein; alpha/beta hydrolase fold, hydrolase; HET: CIT; 1.05A {Cryptococcus SP} Back     alignment and structure
>4ebb_A Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2.00A {Homo sapiens} PDB: 3jyh_A* 3n0t_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 283
d1rdqe_ 350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 1e-10
d2j4za1 263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 4e-10
d1tcaa_317 c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Cand 3e-09
d1fota_ 316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 3e-08
d1o6la_ 337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 3e-07
d1omwa3 364 d.144.1.7 (A:186-549) G-protein coupled receptor k 5e-07
d1xjda_ 320 d.144.1.7 (A:) Protein kinase C, theta type {Human 6e-07
d1uu3a_ 288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 1e-06
d1opja_ 287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 3e-06
d3bqca1 328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 3e-06
d1q8ya_ 362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 4e-06
d1gz8a_ 298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 4e-06
d1k2pa_ 258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 4e-06
d3blha1 318 d.144.1.7 (A:8-325) Cell division protein kinase 9 4e-06
d1nvra_ 271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 5e-06
d1xwsa_ 273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 6e-06
d1koba_ 352 d.144.1.7 (A:) Twitchin, kinase domain {California 6e-06
d1fmka3 285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 6e-06
d1o6ya_ 277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 8e-06
d1ispa_179 c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 8e-06
d1sm2a_ 263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 8e-06
d1ex9a_285 c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [Tax 9e-06
d1koaa2 350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 1e-05
d2java1 269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 1e-05
d1jksa_ 293 d.144.1.7 (A:) Death-associated protein kinase, Da 1e-05
d1unla_ 292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 1e-05
d1s9ja_ 322 d.144.1.7 (A:) Dual specificity mitogen-activated 1e-05
d1vzoa_ 322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 2e-05
d1q5ka_ 350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 2e-05
d1a06a_ 307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 3e-05
d2jfla1 288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 3e-05
d1qpca_ 272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 3e-05
d2gfsa1 348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 3e-05
d2b1pa1 355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 4e-05
d1phka_ 277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 4e-05
d1tkia_ 321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 5e-05
d1cm8a_ 346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 7e-05
d2ozaa1 335 d.144.1.7 (A:51-385) MAP kinase activated protein 7e-05
d1yhwa1 293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 7e-05
d1pmea_ 345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 7e-05
d1byga_ 262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 1e-04
d1u5ra_ 309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 1e-04
d1csna_ 293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 2e-04
d1xkka_ 317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 2e-04
d1ckia_ 299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 2e-04
d1ywna1 299 d.144.1.7 (A:818-1166) Vascular endothelial growth 3e-04
d1blxa_ 305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 3e-04
d1ob3a_ 286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 3e-04
d1t46a_ 311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 5e-04
d1ua2a_ 299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 5e-04
d1rjba_ 325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 6e-04
d1jpaa_ 299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 6e-04
d1u46a_ 273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 7e-04
d1mp8a_ 273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 9e-04
d1fvra_ 309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 0.001
d1t4ha_ 270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 0.001
d1lufa_ 301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 0.001
d1p4oa_ 308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 0.001
d1uwha_ 276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 0.002
d1mo2a_255 c.69.1.22 (A:) Erythromycin polyketide synthase {S 0.002
d1mqba_ 283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 0.002
d1fgka_ 299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 0.003
d1zara2 191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 0.003
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: cAMP-dependent PK, catalytic subunit
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 59.0 bits (142), Expect = 1e-10
 Identities = 21/78 (26%), Positives = 37/78 (47%)

Query: 193 ENKENVEEYLKKMQTHYDAREAPNKSYRWQMSDFEVGCPLGTGKFGHVYLAKEKTTQIMI 252
             +E+V+E+L K +  +  +         Q+  F+    LGTG FG V L K K +    
Sbjct: 10  SEQESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHY 69

Query: 253 ALKVLYKVEIINERMTHQ 270
           A+K+L K +++  +    
Sbjct: 70  AMKILDKQKVVKLKQIEH 87


>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Length = 317 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Length = 179 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Length = 285 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Length = 255 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query283
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 99.76
d1cvla_ 319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 99.76
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 99.72
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 99.7
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 99.66
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 99.61
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 99.61
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.6
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 99.59
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 99.58
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 99.57
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 99.57
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 99.57
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 99.57
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 99.56
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 99.56
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 99.54
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 99.53
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 99.52
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 99.52
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 99.51
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 99.51
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.49
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 99.49
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 99.48
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 99.48
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 99.45
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 99.42
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 99.41
d1ku0a_ 388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 99.41
d1ei9a_279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 99.4
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 99.39
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 99.38
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 99.33
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 99.28
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 99.27
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 99.17
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 99.17
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 99.15
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 99.12
d2j4za1 263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.09
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 99.08
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 99.05
d1o6la_ 337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.04
d1fota_ 316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.04
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 99.01
d1uu3a_ 288 3-phosphoinositide dependent protein kinase-1 Pdk1 98.99
d1rdqe_ 350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 98.97
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 98.95
d1xjda_ 320 Protein kinase C, theta type {Human (Homo sapiens) 98.95
d1omwa3 364 G-protein coupled receptor kinase 2 {Cow (Bos taur 98.94
d1nvra_ 271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 98.93
d1gz8a_ 298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 98.89
d1jksa_ 293 Death-associated protein kinase, Dap {Human (Homo 98.87
d1a06a_ 307 Calmodulin-dependent protein kinase {Rat (Rattus n 98.84
d2java1 269 Serine/threonine-protein kinase Nek2 {Human (Homo 98.83
d1tkia_ 321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 98.83
d1s9ja_ 322 Dual specificity mitogen-activated protein kinase 98.82
d1koaa2 350 Twitchin, kinase domain {Caenorhabditis elegans, p 98.81
d1koba_ 352 Twitchin, kinase domain {California sea hare (Aply 98.8
d1opja_ 287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 98.77
d1phka_ 277 gamma-subunit of glycogen phosphorylase kinase (Ph 98.77
d1u5ra_ 309 Serine/threonine protein kinase TAO2 {Rat (Rattus 98.76
d1yhwa1 293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 98.76
d2jfla1 288 STE20-like serine/threonine-protein kinase, SLK {H 98.75
d1ob3a_ 286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 98.7
d1unla_ 292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 98.69
d1o6ya_ 277 Mycobacterial protein kinase PknB, catalytic domai 98.68
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 98.67
d1k2pa_ 258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 98.66
d1xwsa_ 273 Proto-oncogene serine/threonine-protein kinase Pim 98.65
d2ozaa1 335 MAP kinase activated protein kinase 2, mapkap2 {Hu 98.64
d3bqca1 328 Protein kinase CK2, alpha subunit {Rattus norvegic 98.62
d1cm8a_ 346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 98.6
d1t4ha_ 270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 98.59
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 98.58
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 98.57
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 98.57
d1sm2a_ 263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 98.56
d1q5ka_ 350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 98.55
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 98.54
d1qpca_ 272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 98.54
d3blha1 318 Cell division protein kinase 9, CDK9 {Human (Homo 98.53
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 98.53
d2gfsa1 348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 98.53
d1fmka3 285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 98.5
d1xkka_ 317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 98.48
d1byga_ 262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 98.48
d1vzoa_ 322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 98.47
d1pmea_ 345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 98.45
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 98.44
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 98.44
d1blxa_ 305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 98.41
d1fvra_ 309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 98.4
d1jpaa_ 299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 98.4
d1u46a_ 273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 98.39
d2vata1 376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 98.39
d1mqba_ 283 epha2 receptor tyrosine kinase {Human (Homo sapien 98.39
d1lufa_ 301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 98.37
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 98.37
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 98.35
d1vjya_ 303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 98.35
d1rjba_ 325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 98.34
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 98.34
d1mp8a_ 273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 98.33
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 98.32
d1t46a_ 311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 98.31
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 98.3
d1fgka_ 299 Fibroblast growth factor receptor 1 {Human (Homo s 98.29
d1p4oa_ 308 Insulin-like growth factor 1 receptor {Human (Homo 98.29
d1xbba_ 277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 98.29
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 98.29
d1u59a_ 285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 98.27
d1q8ya_ 362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 98.21
d1rp1a2337 Pancreatic lipase, N-terminal domain {Dog (Canis f 98.13
d1uwha_ 276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 98.11
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 98.01
d1csna_ 293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 97.98
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 97.98
d1r88a_267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 97.98
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 97.97
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 97.92
d1ckia_ 299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 97.91
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 97.9
d1ywna1 299 Vascular endothelial growth factor receptor 2 (kdr 97.85
d1r0pa_ 311 Hepatocyte growth factor receptor, c-MET {Human (H 97.84
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 97.8
d1lnsa3405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 97.64
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 97.63
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 97.62
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 97.61
d1ju3a2 347 Bacterial cocaine esterase N-terminal domain {Rhod 97.57
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 97.57
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 97.54
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 97.54
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 97.47
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 97.44
d2b9va2385 Alpha-amino acid ester hydrolase {Acetobacter past 97.44
d1pv1a_299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 97.41
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 97.4
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 97.4
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 96.87
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 96.76
d1cexa_197 Cutinase {Fungus (Fusarium solani), subsp. pisi [T 96.17
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 96.09
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 94.49
d1qoza_207 Acetylxylan esterase {Trichoderma reesei [TaxId: 5 94.32
d1g66a_207 Acetylxylan esterase {Penicillium purpurogenum [Ta 93.91
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 93.61
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 90.75
d2d81a1 318 Polyhydroxybutyrate depolymerase {Penicillium funi 89.81
d1ivya_ 452 Human 'protective protein', HPP {Human (Homo sapie 88.9
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Bacterial lipase
domain: Lipase
species: Pseudomonas aeruginosa [TaxId: 287]
Probab=99.76  E-value=6.3e-19  Score=147.59  Aligned_cols=88  Identities=25%  Similarity=0.230  Sum_probs=76.0

Q ss_pred             hHHHHHHHHHhCCc-ccCCCcCcCCCCCCCCCCcchHHHHHHHHHHHHHHHHcCCCCEEEEEeCcccHHHHHHHHcCChh
Q psy4395          86 YFSYIAAALVGLGY-QRDLSMRGAPYDFRKAPNENQEYFANFKALIEETYDLNGGTPVVLVAHSMGSLMCLYFLQRQSSA  164 (283)
Q Consensus        86 ~~~~l~~~L~~~g~-~~~~d~~g~g~~~r~~~~~~~~~~~~l~~~i~~~~~~~~~~~v~lvgHSmGg~va~~~~~~~~~~  164 (283)
                      ||..+.+.|++.|| |++.|+++++.+        ....+++.+.|+.+.+..+..||++|||||||+++++++..+|+.
T Consensus        27 yw~~i~~~L~~~G~~v~~~~~~~~~~~--------~~~a~~l~~~i~~~~~~~g~~~v~ligHS~GG~~~r~~~~~~p~~   98 (285)
T d1ex9a_          27 YWFGIPSALRRDGAQVYVTEVSQLDTS--------EVRGEQLLQQVEEIVALSGQPKVNLIGHSHGGPTIRYVAAVRPDL   98 (285)
T ss_dssp             SSTTHHHHHHHTTCCEEEECCCSSSCH--------HHHHHHHHHHHHHHHHHHCCSCEEEEEETTHHHHHHHHHHHCGGG
T ss_pred             hHHHHHHHHHhCCCEEEEeCCCCCCCc--------HHHHHHHHHHHHHHHHHcCCCeEEEEEECccHHHHHHHHHHCCcc
Confidence            46678999999999 899999988743        345577788888888778888999999999999999999999987


Q ss_pred             HHhhhhcceEEecCCCCcchhh
Q psy4395         165 WKSKFVRSLVSLAAPWGGSVKA  186 (283)
Q Consensus       165 ~~~~~v~~~i~i~~p~~g~~~~  186 (283)
                           |+++|++++|+.|++.+
T Consensus        99 -----v~~lv~i~tPh~Gs~~a  115 (285)
T d1ex9a_          99 -----IASATSVGAPHKGSDTA  115 (285)
T ss_dssp             -----EEEEEEESCCTTCCHHH
T ss_pred             -----ceeEEEECCCCCCCHHH
Confidence                 99999999999998764



>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1qoza_ c.69.1.30 (A:) Acetylxylan esterase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1g66a_ c.69.1.30 (A:) Acetylxylan esterase {Penicillium purpurogenum [TaxId: 28575]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure