Psyllid ID: psy4821

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520
MFLNKLVMGALTNVRCLILFISVLVLYKIMLYIKKVRSLPPGPWGLPIIGYLPFLKGDAHISFKNLSAKYGSIFSTKLGDQLIVVLSDYRHIREAFRKEEFSGRPHTELSSILGGYEVNVFLKSLQAQAELCGATGVDVNPLLATSISNVICSIVMSVRFSNEDPQFKRFMHLIDEGFKLFETMAVVNFLPFVKYLPGLRETRKTLSKVSETLKKCSQPNEGFKLFETMAVVNFLPFVKYLPGLRETRKTLSKLFETMAVVNFLPFVKYLPGLRETRKTLSKNRVEMGAYFQEKINEHRTTFDASNIRDMLDSYLFEIEKAKMENRSDQLFNGKNHDRQMQQIIGDLFSTGMETIKNTLQWSLVYMMHYPAVAKAVQDELDTVATILETLRRSSVVALGTIHAVTRDVKFNGFTIPKNTQIVPLLHAVHMDPELWESPEDFRPTRFLTPEGKVTKPEFFLPFGVGRRMCLGDVLARMELFLFFSTLMHTFGIESPPGQPLPSLKGNAGVTITPDSHKDET
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHcccccEEEEEEccccEEEEEccHHHHHHHHccccccccccHHHHHHccccEEEEEccHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccEEccccccccHHHccccccHHHHHHccccccccccccccccccccHHHHHHcccHHHHHHHHHHHHHHHHHHccccHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccc
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEcHHHccccHHHHHHHHHHHcccEEEEEEccccEEEEccHHHHHHHHHcccccccccccHHHHHccccccEEcccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHEHHHHHHHccccccccHHHHcccccccHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccccHHcHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEccccEEEccEEEccccEEEEcHHHHHcccccccccccccHHHHEcccccEccccccccccccccccccHHHHHHHHHHHHHHHHHHEEEEccccccccccccccccccccccccccc
MFLNKLVMGALTNVRCLILFISVLVLYKIMLYIKKVrslppgpwglpiigylpflkgdahisFKNLSakygsifstklgdQLIVVLSDYRHIREAFRkeefsgrphtelssilggYEVNVFLKSLQAQAELcgatgvdvnpllaTSISNVICSIVMSvrfsnedpqfKRFMHLIDEGFKLFETMAVVNFlpfvkylpglreTRKTLSKVSETLKkcsqpnegfKLFETMAVVNFlpfvkylpglrETRKTLSKLFETMAVVNFlpfvkylpglrETRKTLSKNRVEMGAYFQEKINEhrttfdasnIRDMLDSYLFEIEKAKmenrsdqlfngknhdrQMQQIIGDLFSTGMETIKNTLQWSLVYMMHYPAVAKAVQDELDTVATILETLRRSSVVALGTIHAvtrdvkfngftipkntqivpllhavhmdpelwespedfrptrfltpegkvtkpefflpfgvgrrMCLGDVLARMELFLFFSTLMhtfgiesppgqplpslkgnagvtitpdshkdet
MFLNKLVMGALTNVRCLILFISVLVLYKIMLYIKKVRSLPPGPWGLPIIGYLPFLKGDAHISFKNLSAKYGSIFSTKLGDQLIVVLSDYRHIREafrkeefsgrphTELSSILGGYEVNVFLKSLQAQAELCGATGVDVNPLLATSISNVICSIVMSVRFSNEDPQFKRFMHLIDEGFKLFETMAVVNFLPFVKYLPGLRETRKTLSKVSETLKKCSQPNEGFKLFETMAVVNFLPFVKYLPGLRETRKTLSKLFETMAVVNflpfvkylpglrETRKTLSKNRVEMGAYFQEKinehrttfdasniRDMLDSYLFEIEKAKMENRSDQlfngknhdrqMQQIIGDLFSTGMETIKNTLQWSLVYMMHYPAVAKAVQDELDTVATILETLRRSSVVALGTIHAvtrdvkfngftipKNTQIVPLLHAVHMDPELWESPEDFRPTrfltpegkvtkpefflpfgvGRRMCLGDVLARMELFLFFSTLMHTFGIESPpgqplpslkgnagvtitpdshkdet
MFLNKLVMGALTNVRCLILFISVLVLYKIMLYIKKVRSlppgpwglpiigylpFLKGDAHISFKNLSAKYGSIFSTKLGDQLIVVLSDYRHIREAFRKEEFSGRPHTELSSILGGYEVNVFLKSLQAQAELCGATGVDVNPLLATSISNVICSIVMSVRFSNEDPQFKRFMHLIDEGFKLFETMAVVNFLPFVKYLPGLRETRKTLSKVSETLKKCSQPNEGFKLFETMAVVNFLPFVKYLPGLRETRKTLSKLFETMAVVNFLPFVKYLPGLRETRKTLSKNRVEMGAYFQEKINEHRTTFDASNIRDMLDSYLFEIEKAKMENRSDQLFNGKNHDRQMQQIIGDLFSTGMETIKNTLQWSLVYMMHYPAVAKAVQDELDTVATILETLRRSSVVALGTIHAVTRDVKFNGFTIPKNTQIVPLLHAVHMDPELWESPEDFRPTRFLTPEGKVTKPEFFLPFGVGRRMCLGDVLARMELFLFFSTLMHTFGIESPPGQPLPSLKGNAGVTITPDSHKDET
**LNKLVMGALTNVRCLILFISVLVLYKIMLYIKKVRSLPPGPWGLPIIGYLPFLKGDAHISFKNLSAKYGSIFSTKLGDQLIVVLSDYRHIREAFRKEEFSGRPHTELSSILGGYEVNVFLKSLQAQAELCGATGVDVNPLLATSISNVICSIVMSVRFSNEDPQFKRFMHLIDEGFKLFETMAVVNFLPFVKYLPGLRETRKTL******L*KC*QPNEGFKLFETMAVVNFLPFVKYLPGLRETRKTLSKLFETMAVVNFLPFVKYLPGLRETRKTLSKNRVEMGAYFQEKINEHRTTFDASNIRDMLDSYLFEIE********************MQQIIGDLFSTGMETIKNTLQWSLVYMMHYPAVAKAVQDELDTVATILETLRRSSVVALGTIHAVTRDVKFNGFTIPKNTQIVPLLHAVHMDPELWESPEDFRPTRFLTPEGKVTKPEFFLPFGVGRRMCLGDVLARMELFLFFSTLMHTFGI****************************
*FLNK*VMGALTNVRCLILFISVLVLYKIMLYIKKVRSLPPGPWGLPIIGYLPFLKGDAHISFKNLSAKYGSIFSTKLGDQLIVVLSDYRHIREAFRKEEFSGRPHTELSSILGGYEVNVFLKSLQAQAELCGATGVDVNPLLATSISNVICSIVMSVRFSNEDPQFKRFMHLIDEGFKLFETMAVVNFLPFVKYLPGLRETRKTLSKVSETLKKCSQPNEGFKLFETMAVVNFLPFVKYLPGLRETRKTLSKLFETMAVVNFLPFVKYLPGLRETRKTLSKNRVEMGAYFQEKINEHRTTFDASNIRDMLDSYLF*****************KNHDRQMQQIIGDLFSTGMETIKNTLQWSLVYMMHYPAVAKAVQDELDTVATILETLRRSSVVALGTIHAVTRDVKFNGFTIPKNTQIVPLLHAVHMDPELWESPEDFRPTRFLTPEGKVTKPEFFLPFGVGRRMCLGDVLARMELFLFFSTLMHTFGIESPPGQPLPSLKGNAGVTITPDSHK***
MFLNKLVMGALTNVRCLILFISVLVLYKIMLYIKKVRSLPPGPWGLPIIGYLPFLKGDAHISFKNLSAKYGSIFSTKLGDQLIVVLSDYRHIREAFRKEEFSGRPHTELSSILGGYEVNVFLKSLQAQAELCGATGVDVNPLLATSISNVICSIVMSVRFSNEDPQFKRFMHLIDEGFKLFETMAVVNFLPFVKYLPGLRETRKTLSKVSETLKKCSQPNEGFKLFETMAVVNFLPFVKYLPGLRETRKTLSKLFETMAVVNFLPFVKYLPGLRETRKTLSKNRVEMGAYFQEKINEHRTTFDASNIRDMLDSYLFEIEKAKMENRSDQLFNGKNHDRQMQQIIGDLFSTGMETIKNTLQWSLVYMMHYPAVAKAVQDELDTVATILETLRRSSVVALGTIHAVTRDVKFNGFTIPKNTQIVPLLHAVHMDPELWESPEDFRPTRFLTPEGKVTKPEFFLPFGVGRRMCLGDVLARMELFLFFSTLMHTFGIESPPGQPLPSLKGNAGVTI*********
MFLNKLVMGALTNVRCLILFISVLVLYKIMLYIKKVRSLPPGPWGLPIIGYLPFLKGDAHISFKNLSAKYGSIFSTKLGDQLIVVLSDYRHIREAFRKEEFSGRPHTELSSILGGYEVNVFLKSLQAQAELCGATGVDVNPLLATSISNVICSIVMSVRFSNEDPQFKRFMHLIDEGFKLFETMAVVNFLPFVKYLPGLRETRKTLSKVSETLKKCSQPNEGFKLFETMAVVNFLPFVKYLPGLRETRKTLSKLFETMAVVNFLPFVKYLPGLRETRKTLSKNRVEMGAYFQEKINEHRTTFDASNIRDMLDSYLFEIEKAKMEN*****FNGKNHDRQMQQIIGDLFSTGMETIKNTLQWSLVYMMHYPAVAKAVQDELDTVATILETLRRSSVVALGTIHAVTRDVKFNGFTIPKNTQIVPLLHAVHMDPELWESPEDFRPTRFLTPEGKVTKPEFFLPFGVGRRMCLGDVLARMELFLFFSTLMHTFGIESPPGQPLPSLKGNAGVTITPD******
iiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFLNKLVMGALTNVRCLILFISVLVLYKIMLYIKKVRSLPPGPWGLPIIGYLPFLKGDAHISFKNLSAKYGSIFSTKLGDQLIVVLSDYRHIREAFRKEEFSGRPHTELSSILGGYEVNVFLKSLQAQAELCGATGVDVNPLLATSISNVICSIVMSVRFSNEDPQFKRFMHLIDEGFKLFETMAVVNFLPFVKYLPGLRETRKTLSKVSETLKKCSQPNEGFKLFETMAVVNFLPFVKYLPGLRETRKTLSKLFETMAVVNFLPFVKYLPGLRETRKTLSKNRVEMGAYFQEKINEHRTTFDASNIRDMLDSYLFEIEKAKMENRSDQLFNGKNHDRQMQQIIGDLFSTGMETIKNTLQWSLVYMMHYPAVAKAVQDELDTVATILETLRRSSVVALGTIHAVTRDVKFNGFTIPKNTQIVPLLHAVHMDPELWESPEDFRPTRFLTPEGKVTKPEFFLPFGVGRRMCLGDVLARMELFLFFSTLMHTFGIESPPGQPLPSLKGNAGVTITPDSHKDET
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query520 2.2.26 [Sep-21-2011]
Q95078538 Cytochrome P450 18a1 OS=D yes N/A 0.509 0.492 0.531 8e-88
Q7Z449544 Cytochrome P450 2U1 OS=Ho yes N/A 0.771 0.737 0.285 4e-54
Q4V8D1530 Cytochrome P450 2U1 OS=Ra yes N/A 0.778 0.764 0.281 8e-54
Q9CX98530 Cytochrome P450 2U1 OS=Mu yes N/A 0.780 0.766 0.282 1e-52
Q0IIF9543 Cytochrome P450 2U1 OS=Bo yes N/A 0.763 0.731 0.281 5e-51
O73853514 Steroid 17-alpha-hydroxyl N/A N/A 0.85 0.859 0.279 7e-50
Q8CIM7500 Cytochrome P450 2D26 OS=M no N/A 0.821 0.854 0.287 2e-48
P70085517 Steroid 17-alpha-hydroxyl N/A N/A 0.751 0.756 0.277 8e-48
O57525519 Steroid 17-alpha-hydroxyl N/A N/A 0.792 0.793 0.283 9e-48
P05176518 Cytochrome P450 1A1 OS=Or no N/A 0.844 0.847 0.270 3e-46
>sp|Q95078|CP18A_DROME Cytochrome P450 18a1 OS=Drosophila melanogaster GN=Cyp18a1 PE=2 SV=2 Back     alignment and function desciption
 Score =  324 bits (831), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 151/284 (53%), Positives = 202/284 (71%), Gaps = 19/284 (6%)

Query: 253 KLFETMAVVNFLPFVKYLPGLRETRKTLSKNRVEMGAYFQEKINEHRTTFDASNIRDMLD 312
           +LF  +  V+++P ++  P +   +  +++NR EM  ++Q+ I++H+ +FD +NIRD++D
Sbjct: 231 RLFGEIHTVDYIPTMQCFPSISTAKNKIAQNRAEMQRFYQDVIDDHKRSFDPNNIRDLVD 290

Query: 313 SYLFEIEKAKMENRSDQLFNGKNHDRQMQQIIGDLFSTGMETIKNTLQWSLVYMMHYPAV 372
            YL EIEKAK E    +LF+GKNH+ Q+ Q+I DLFS GMETIK TL W  V+M+  P  
Sbjct: 291 FYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFSAGMETIKTTLLWINVFMLRNPKE 350

Query: 373 AKAVQDELDTV-------------------ATILETLRRSSVVALGTIHAVTRDVKFNGF 413
            + VQDELD V                   +TILE++RRSS+V L T H+ TRDV+ NG+
Sbjct: 351 MRRVQDELDQVVGRHRLPTIEDLQYLPITESTILESMRRSSIVPLATTHSPTRDVELNGY 410

Query: 414 TIPKNTQIVPLLHAVHMDPELWESPEDFRPTRFLTPEGKVTKPEFFLPFGVGRRMCLGDV 473
           TIP  + ++PL+++VHMDP LWE PE+FRP+RF+  EGKV KPE+F+PFGVGRRMCLGDV
Sbjct: 411 TIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDTEGKVRKPEYFIPFGVGRRMCLGDV 470

Query: 474 LARMELFLFFSTLMHTFGIESPPGQPLPSLKGNAGVTITPDSHK 517
           LARMELFLFF++ MH F I  P GQPLPSLKGN G TITP+S K
Sbjct: 471 LARMELFLFFASFMHCFDIALPEGQPLPSLKGNVGATITPESFK 514
Probably involved in steroid hormones biosynthesis.
Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|Q7Z449|CP2U1_HUMAN Cytochrome P450 2U1 OS=Homo sapiens GN=CYP2U1 PE=1 SV=1 Back     alignment and function description
>sp|Q4V8D1|CP2U1_RAT Cytochrome P450 2U1 OS=Rattus norvegicus GN=Cyp2u1 PE=1 SV=1 Back     alignment and function description
>sp|Q9CX98|CP2U1_MOUSE Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 Back     alignment and function description
>sp|Q0IIF9|CP2U1_BOVIN Cytochrome P450 2U1 OS=Bos taurus GN=CYP2U1 PE=2 SV=1 Back     alignment and function description
>sp|O73853|CP17A_ICTPU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalurus punctatus GN=cyp17a1 PE=2 SV=1 Back     alignment and function description
>sp|Q8CIM7|CP2DQ_MOUSE Cytochrome P450 2D26 OS=Mus musculus GN=Cyp2d26 PE=1 SV=1 Back     alignment and function description
>sp|P70085|CP17A_ORYLA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oryzias latipes GN=cyp17a1 PE=2 SV=1 Back     alignment and function description
>sp|O57525|CP17A_RANDY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rana dybowskii GN=CYP17A1 PE=2 SV=1 Back     alignment and function description
>sp|P05176|CP1A1_RABIT Cytochrome P450 1A1 OS=Oryctolagus cuniculus GN=CYP1A1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query520
242013517523 cytochrome P-450, putative [Pediculus hu 0.784 0.780 0.510 1e-145
48097776537 PREDICTED: cytochrome P450 18a1 [Apis me 0.892 0.864 0.486 1e-140
380022639539 PREDICTED: LOW QUALITY PROTEIN: cytochro 0.875 0.844 0.490 1e-139
340723594539 PREDICTED: cytochrome P450 18a1-like [Bo 0.855 0.825 0.494 1e-138
350426737539 PREDICTED: cytochrome P450 18a1-like [Bo 0.855 0.825 0.492 1e-137
383857455538 PREDICTED: cytochrome P450 18a1-like [Me 0.855 0.827 0.490 1e-136
307190603542 Cytochrome P450 18a1 [Camponotus florida 0.838 0.804 0.449 1e-132
194363749527 cytochrome P450 CYP18A1 [Tribolium casta 0.880 0.869 0.463 1e-129
345497696527 PREDICTED: cytochrome P450 18a1 [Nasonia 0.871 0.859 0.449 1e-117
307212561531 Cytochrome P450 18a1 [Harpegnathos salta 0.844 0.826 0.453 1e-114
>gi|242013517|ref|XP_002427451.1| cytochrome P-450, putative [Pediculus humanus corporis] gi|212511837|gb|EEB14713.1| cytochrome P-450, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  522 bits (1344), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 276/541 (51%), Positives = 341/541 (63%), Gaps = 133/541 (24%)

Query: 34  KKVRSLPPGPWGLPIIGYLPFLKGDAHISFKNLSAKYGSIFSTKLGDQLIVVLSDYRHIR 93
           ++++SLPPGPWGLPI GYLPFLK +AHI F  L+ KYGS+FST+LG+QLIVV+SD++ IR
Sbjct: 45  RELKSLPPGPWGLPIFGYLPFLKTEAHIHFGELAKKYGSLFSTRLGNQLIVVVSDHKAIR 104

Query: 94  EAFRKEEFSGRPHTELSSILGGYEV-----------NVFL-------------------- 122
           EAFR+EEF+GRPHTE S+ILGGY +             FL                    
Sbjct: 105 EAFRREEFTGRPHTEFSNILGGYGIINSEGKLWKDQRRFLHERLRHFGMTYFGSGKENME 164

Query: 123 KSLQAQAELCGAT-------GVDVNPLLATSISNVICSIVMSVRFSNEDPQFKRFMHLID 175
           K ++ + E C  T        VD+NPLLA  ISN++CSI+M+V+F   D +FKRFM LID
Sbjct: 165 KRIKVELESCLRTISKQEGAEVDLNPLLAMPISNIVCSILMNVKFKPNDDRFKRFMDLID 224

Query: 176 EGFKLFETMAVVNFLPFVKYLPGLRETRKTLSKVSETLKKCSQPNEGFKLFETMAVVNFL 235
           E                                             GF+LF  +  VNF+
Sbjct: 225 E---------------------------------------------GFRLFGILTYVNFI 239

Query: 236 PFVKYLPGLRETRKTLSKLFETMAVVNFLPFVKYLPGLRETRKTLSKNRVEMGAYFQEKI 295
           P ++YLPG                             L+ TRK L +NR+EM A+FQE I
Sbjct: 240 PAMRYLPG-----------------------------LQATRKLLHRNRIEMAAFFQETI 270

Query: 296 NEHRTTFDASNIRDMLDSYLFEIEKAKMENRSDQLFNGKNHDRQMQQIIGDLFSTGMETI 355
           +EH+ TFD S +RD++D+YL EIE A  + ++  LF GK+HDRQ+QQIIGDLF+ GMET+
Sbjct: 271 DEHKKTFDPSVMRDVVDAYLMEIENAGEKGKT--LFEGKDHDRQVQQIIGDLFTAGMETV 328

Query: 356 KNTLQWSLVYMMHYPAVAKAVQDELDTV-------------------ATILETLRRSSVV 396
           K TLQW++VYM+H+P VAKAVQ+ELD V                   +T+LE LRRSS+V
Sbjct: 329 KTTLQWAVVYMLHHPEVAKAVQEELDQVVGRNRLPNLEDMPFLPYTESTLLEILRRSSIV 388

Query: 397 ALGTIHAVTRDVKFNGFTIPKNTQIVPLLHAVHMDPELWESPEDFRPTRFLTPEGKVTKP 456
            LGT HA TRD+ FNG+ IPK+  IVPLLHAVHMDP LW+ PEDFRP+RFL  EGKVTKP
Sbjct: 389 PLGTTHATTRDINFNGYKIPKHAHIVPLLHAVHMDPNLWDQPEDFRPSRFLNSEGKVTKP 448

Query: 457 EFFLPFGVGRRMCLGDVLARMELFLFFSTLMHTFGIESPPGQPLPSLKGNAGVTITPDSH 516
           E+FLPFGVGRRMCLGDVLARMELFLFFS+L+H F I+ P GQ LPSLKGN GVTITPDS 
Sbjct: 449 EYFLPFGVGRRMCLGDVLARMELFLFFSSLLHVFHIKLPEGQSLPSLKGNTGVTITPDSF 508

Query: 517 K 517
           K
Sbjct: 509 K 509

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|48097776|ref|XP_393885.1| PREDICTED: cytochrome P450 18a1 [Apis mellifera] Back     alignment and taxonomy information
>gi|380022639|ref|XP_003695147.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 18a1-like [Apis florea] Back     alignment and taxonomy information
>gi|340723594|ref|XP_003400174.1| PREDICTED: cytochrome P450 18a1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350426737|ref|XP_003494528.1| PREDICTED: cytochrome P450 18a1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383857455|ref|XP_003704220.1| PREDICTED: cytochrome P450 18a1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307190603|gb|EFN74585.1| Cytochrome P450 18a1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|194363749|ref|NP_001123908.1| cytochrome P450 CYP18A1 [Tribolium castaneum] gi|270014221|gb|EFA10669.1| cytochrome P450 18A1 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|345497696|ref|XP_001600798.2| PREDICTED: cytochrome P450 18a1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307212561|gb|EFN88284.1| Cytochrome P450 18a1 [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query520
FB|FBgn0010383538 Cyp18a1 "Cytochrome P450-18a1" 0.536 0.518 0.4 8.4e-85
ZFIN|ZDB-GENE-070730-1533 cyp2u1 "cytochrome P450, famil 0.488 0.476 0.364 8.6e-61
ZFIN|ZDB-GENE-040801-101416 zgc:101048 "zgc:101048" [Danio 0.469 0.586 0.321 8.4e-52
RGD|1309433530 Cyp2u1 "cytochrome P450, famil 0.253 0.249 0.446 1.3e-48
UNIPROTKB|Q4V8D1530 Cyp2u1 "Cytochrome P450 2U1" [ 0.253 0.249 0.446 1.3e-48
MGI|MGI:1918769530 Cyp2u1 "cytochrome P450, famil 0.253 0.249 0.469 1.5e-48
MGI|MGI:107303492 Cyp2b19 "cytochrome P450, fami 0.521 0.550 0.335 1.4e-46
UNIPROTKB|P24460494 CYP2B11 "Cytochrome P450 2B11" 0.436 0.459 0.341 8e-46
UNIPROTKB|F1S123543 CYP2U1 "Uncharacterized protei 0.251 0.241 0.454 1e-45
UNIPROTKB|F1MN98442 CYP2B6 "Uncharacterized protei 0.484 0.570 0.314 2e-45
FB|FBgn0010383 Cyp18a1 "Cytochrome P450-18a1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 523 (189.2 bits), Expect = 8.4e-85, Sum P(3) = 8.4e-85
 Identities = 122/305 (40%), Positives = 181/305 (59%)

Query:   221 EGFKLFETMAVVNFLPFVKYLPGLRETRKTLSKLFETMAVVNFLPFVKYLPGLRETRKTL 280
             EG +LF  +  V+++P ++  P +  T K  +K+ +  A +       Y   + + +++ 
Sbjct:   228 EGMRLFGEIHTVDYIPTMQCFPSI-STAK--NKIAQNRAEMQRF----YQDVIDDHKRSF 280

Query:   281 SKNRV-EMGAYFQ---EKINEHRTT---FDASNIRDMLDSYLFEIEKAKMEN-RSDQLFN 332
               N + ++  ++    EK     T    FD  N  + L   + ++  A ME  ++  L+ 
Sbjct:   281 DPNNIRDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFSAGMETIKTTLLWI 340

Query:   333 GKNHDRQMQQIIGDLFSTGMETIKNTLQWSLVYMMHYPAVAKAVQDELDTVATILETLRR 392
                  R  ++         M  +++ L   +V     P + + +Q    T +TILE++RR
Sbjct:   341 NVFMLRNPKE---------MRRVQDELD-QVVGRHRLPTI-EDLQYLPITESTILESMRR 389

Query:   393 SSVVALGTIHAVTRDVKFNGFTIPKNTQIVPLLHAVHMDPELWESPEDFRPTRFLTPEGK 452
             SS+V L T H+ TRDV+ NG+TIP  + ++PL+++VHMDP LWE PE+FRP+RF+  EGK
Sbjct:   390 SSIVPLATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDTEGK 449

Query:   453 VTKPEFFLPFGVGRRMCLGDVLARMELFLFFSTLMHTFGIESPPGQPLPSLKGNAGVTIT 512
             V KPE+F+PFGVGRRMCLGDVLARMELFLFF++ MH F I  P GQPLPSLKGN G TIT
Sbjct:   450 VRKPEYFIPFGVGRRMCLGDVLARMELFLFFASFMHCFDIALPEGQPLPSLKGNVGATIT 509

Query:   513 PDSHK 517
             P+S K
Sbjct:   510 PESFK 514
GO:0043231 "intracellular membrane-bounded organelle" evidence=NAS
GO:0009055 "electron carrier activity" evidence=IEA;ISS;NAS
GO:0006694 "steroid biosynthetic process" evidence=NAS
GO:0016020 "membrane" evidence=NAS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005506 "iron ion binding" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0046344 "ecdysteroid catabolic process" evidence=IMP
GO:0008395 "steroid hydroxylase activity" evidence=IDA
GO:0035074 "pupation" evidence=IMP
GO:0007552 "metamorphosis" evidence=IMP
GO:0035210 "prepupal development" evidence=IMP
GO:0007480 "imaginal disc-derived leg morphogenesis" evidence=IMP
GO:0007304 "chorion-containing eggshell formation" evidence=IMP
ZFIN|ZDB-GENE-070730-1 cyp2u1 "cytochrome P450, family 2, subfamily U, polypeptide 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040801-101 zgc:101048 "zgc:101048" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1309433 Cyp2u1 "cytochrome P450, family 2, subfamily u, polypeptide 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q4V8D1 Cyp2u1 "Cytochrome P450 2U1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1918769 Cyp2u1 "cytochrome P450, family 2, subfamily u, polypeptide 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
MGI|MGI:107303 Cyp2b19 "cytochrome P450, family 2, subfamily b, polypeptide 19" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P24460 CYP2B11 "Cytochrome P450 2B11" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1S123 CYP2U1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MN98 CYP2B6 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q95078CP18A_DROME1, ., 1, 4, ., -, ., -0.53160.50960.4925yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query520
pfam00067461 pfam00067, p450, Cytochrome P450 6e-57
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 8e-30
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 7e-28
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 2e-25
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 4e-24
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 2e-23
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 9e-23
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 1e-22
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 1e-22
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 2e-19
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 1e-18
pfam00067461 pfam00067, p450, Cytochrome P450 3e-18
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 3e-18
PLN02196463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 1e-16
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 2e-16
PLN02774463 PLN02774, PLN02774, brassinosteroid-6-oxidase 1e-14
PLN02500490 PLN02500, PLN02500, cytochrome P450 90B1 2e-14
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 2e-13
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 8e-13
PLN03141452 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m 1e-11
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 5e-11
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 3e-10
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 8e-10
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 4e-09
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 7e-09
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 9e-09
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 1e-07
PLN03018534 PLN03018, PLN03018, homomethionine N-hydroxylase 4e-07
PLN02169500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 1e-06
PLN03195516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 4e-06
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 7e-06
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 1e-05
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 4e-05
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information 
 Score =  196 bits (500), Expect = 6e-57
 Identities = 94/289 (32%), Positives = 140/289 (48%), Gaps = 35/289 (12%)

Query: 249 KTLSKLFETM--AVVNFLPFVKYLPGLRETRKTLSKNRVEMGAYFQEKINEHRTTFD--A 304
           + LS L  +    +++  P +KY PG     + L + R ++     + I E R T D   
Sbjct: 178 QELSSLLSSPSPQLLDLFPILKYFPG--PHGRKLKRARKKIKDLLDKLIEERRETLDSAK 235

Query: 305 SNIRDMLDSYLFEIEKAKMENRSDQLFNGKNHDRQMQQIIGDLFSTGMETIKNTLQWSLV 364
            + RD LD+ L   E+             K  D +++  + +LF  G +T  +TL W+L 
Sbjct: 236 KSPRDFLDALLLAKEEED---------GSKLTDEELRATVLELFFAGTDTTSSTLSWALY 286

Query: 365 YMMHYPAVAKAVQDELDTV-------------------ATILETLRRSSVVALGTIHAVT 405
            +  +P V + +++E+D V                   A I ETLR   VV L     VT
Sbjct: 287 ELAKHPEVQEKLREEIDEVIGDKRSPTYDDLQNMPYLDAVIKETLRLHPVVPLLLPREVT 346

Query: 406 RDVKFNGFTIPKNTQIVPLLHAVHMDPELWESPEDFRPTRFLTPEGKVTKPEFFLPFGVG 465
           +D    G+ IPK T ++  L+A+H DPE++ +PE+F P RFL   GK  K   FLPFG G
Sbjct: 347 KDTVIPGYLIPKGTLVIVNLYALHRDPEVFPNPEEFDPERFLDENGKFRKSFAFLPFGAG 406

Query: 466 RRMCLGDVLARMELFLFFSTLMHTFGIESPPG-QPLPSLKGNAGVTITP 513
            R CLG+ LARME+ LF +TL+  F +E PPG  P    +    +    
Sbjct: 407 PRNCLGERLARMEMKLFLATLLQNFEVELPPGTDPPDIDETPGLLLPPK 455

Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures. Length = 461
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 520
KOG0156|consensus489 100.0
KOG0158|consensus499 100.0
PLN02971543 tryptophan N-hydroxylase 100.0
PLN03234499 cytochrome P450 83B1; Provisional 100.0
PTZ00404482 cytochrome P450; Provisional 100.0
PLN02183516 ferulate 5-hydroxylase 100.0
PLN02966502 cytochrome P450 83A1 100.0
PLN02394503 trans-cinnamate 4-monooxygenase 100.0
PLN02687517 flavonoid 3'-monooxygenase 100.0
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 100.0
PLN02500490 cytochrome P450 90B1 100.0
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 100.0
PLN03112514 cytochrome P450 family protein; Provisional 100.0
KOG0157|consensus497 100.0
PLN02655466 ent-kaurene oxidase 100.0
PLN00168519 Cytochrome P450; Provisional 100.0
PLN02290516 cytokinin trans-hydroxylase 100.0
KOG0159|consensus519 100.0
PLN02774463 brassinosteroid-6-oxidase 100.0
PLN03018534 homomethionine N-hydroxylase 100.0
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 100.0
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 100.0
PLN02196463 abscisic acid 8'-hydroxylase 100.0
PLN02987472 Cytochrome P450, family 90, subfamily A 100.0
PLN02302490 ent-kaurenoic acid oxidase 100.0
PLN03195516 fatty acid omega-hydroxylase; Provisional 100.0
KOG0684|consensus486 100.0
PLN02738633 carotene beta-ring hydroxylase 100.0
PLN02936489 epsilon-ring hydroxylase 100.0
PLN02426502 cytochrome P450, family 94, subfamily C protein 100.0
PLN02648480 allene oxide synthase 100.0
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 100.0
>KOG0156|consensus Back     alignment and domain information 
Probab=100.00  E-value=5.3e-71  Score=566.67  Aligned_cols=405  Identities=36%  Similarity=0.647  Sum_probs=329.0

Q ss_pred             HHHHHHHhcCCCCCCCCCcccccccccccCCch-HHHHHHHHHhhcCCeeEEEecCeeEEEecCHHHHHHHHhhc--ccc
Q psy4821          26 LYKIMLYIKKVRSLPPGPWGLPIIGYLPFLKGD-AHISFKNLSAKYGSIFSTKLGDQLIVVLSDYRHIREAFRKE--EFS  102 (520)
Q Consensus        26 ~~~~~~~~~~~~~~ppgP~~~p~lG~~~~l~~~-~~~~~~~~~~kyG~i~~~~~g~~~~vvi~dp~~i~~i~~~~--~~~  102 (520)
                      ++.++.+.+++.+.||||++||++||++++... +|..+++|.++|||||++|+|..++|||+|++.++|++.++  .|+
T Consensus        14 ~~~~~~~~~~~~~lPPGP~~lPiIGnl~~l~~~~~h~~~~~ls~~yGpi~tl~lG~~~~Vviss~~~akE~l~~~d~~fa   93 (489)
T KOG0156|consen   14 LSLFFKKYRKRRNLPPGPPPLPIIGNLHQLGSLPPHRSFRKLSKKYGPVFTLRLGSVPVVVISSYEAAKEVLVKQDLEFA   93 (489)
T ss_pred             HHHHHHhccCCCCCCcCCCCCCccccHHHcCCCchhHHHHHHHHHhCCeEEEEecCceEEEECCHHHHHHHHHhCCcccc
Confidence            333344445558999999999999999999765 99999999999999999999999999999999999999997  899


Q ss_pred             CCCc-chhhhhh--CCchHH------------HHH----------HHH----HHH----H-HHh--C-CCCCChhHHHHH
Q psy4821         103 GRPH-TELSSIL--GGYEVN------------VFL----------KSL----QAQ----A-ELC--G-ATGVDVNPLLAT  145 (520)
Q Consensus       103 ~r~~-~~~~~~~--~g~~~~------------~~~----------~~~----~~~----~-~l~--~-~~~~~l~~~~~~  145 (520)
                      +||. ......+  ++.++.            |++          +..    ++.    + ++.  . ++.+|+...+..
T Consensus        94 ~Rp~~~~~~~~~~~~~~~i~~a~yG~~Wr~~Rr~~~~~L~~~~~~~~~~~~R~~E~~~l~~~l~~~~~~~~vdl~~~l~~  173 (489)
T KOG0156|consen   94 DRPDPTATLKYLSYGGKGIVFAPYGDYWREMRRFALTELRSFGRGKSFMEIREEEVDELVKKLSKSKKGEPVDLSELLDL  173 (489)
T ss_pred             CCCCchhhHHHhcCCCCceEeCCCcHHHHHHHHHHHHHhcChhhhhhhHHHHHHHHHHHHHHHHhcCCCceeeHHHHHHH
Confidence            9997 2233333  223333            111          000    111    1 122  1 278999999999


Q ss_pred             HHHHHHHHHHhcccCCCCC-hHHHHHHHHHHHHhhhhhhchhhcccccccccccchhhhhhhhhhhhhhhccCCCCCchh
Q psy4821         146 SISNVICSIVMSVRFSNED-PQFKRFMHLIDEGFKLFETMAVVNFLPFVKYLPGLRETRKTLSKVSETLKKCSQPNEGFK  224 (520)
Q Consensus       146 ~~~~~i~~~~fg~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  224 (520)
                      .+.++|+.++||.++...+ +...++.+.+.+..+......+.                                     
T Consensus       174 ~~~nvI~~~~fG~rf~~~~~~~~~~~~~l~~~~~~~~~~~~~~-------------------------------------  216 (489)
T KOG0156|consen  174 LVGNVICRMLFGRRFEEEDEEEFLELKELVEESLELLGSFNLS-------------------------------------  216 (489)
T ss_pred             HHHHHHHHHHhCCccccCCchHHHHHHHHHHHHHHHhCCccHH-------------------------------------
Confidence            9999999999999998854 55566777777776655544332                                     


Q ss_pred             hhhhhhhhccccccccccchhHHHHHHHHHHhhhhhhcccc-cccccCCchHHHHHHHHHHHHHHHHHHHHHHHhhhhcC
Q psy4821         225 LFETMAVVNFLPFVKYLPGLRETRKTLSKLFETMAVVNFLP-FVKYLPGLRETRKTLSKNRVEMGAYFQEKINEHRTTFD  303 (520)
Q Consensus       225 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P-~l~~l~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~  303 (520)
                                                           +++| ++.+++......++......++..++++.|+++++...
T Consensus       217 -------------------------------------d~~p~~l~~~~~~~g~~~~~~~~~~~~~~~~~~~i~eh~~~~~  259 (489)
T KOG0156|consen  217 -------------------------------------DYFPFLLRWLDGISGLEKRLKKVSKRLDEFLERIIDEHREKIG  259 (489)
T ss_pred             -------------------------------------HHhhHHHHhcccccHHHHHHHHHHHHHHHHHHHHHHHHHhhhc
Confidence                                                 7777 67777632235666666767799999999999877541


Q ss_pred             CCCcchhHHHHHHHHHHHhhcccccccccCCCcHHHHHHHHHHHhhhhhhhHHHHHHHHHHHHHhChhHHHHHHHHHHhH
Q psy4821         304 ASNIRDMLDSYLFEIEKAKMENRSDQLFNGKNHDRQMQQIIGDLFSTGMETIKNTLQWSLVYMMHYPAVAKAVQDELDTV  383 (520)
Q Consensus       304 ~~~~~d~l~~ll~~~~~~~~~~~~~~~l~~~~~~~ei~~~~~~~l~Ag~dtta~tl~~~l~~L~~~P~v~~klr~Ei~~~  383 (520)
                      .++..|++|.++...++++.+     .+    ++++|++.|.++++||+|||++|+.|+|.+|++||++|+|+|+||+++
T Consensus       260 ~~~~~D~vD~lL~~~~~~~~~-----~~----t~~~i~~~~~dl~~AGtdTta~Tl~Wa~a~Ll~~Pev~~K~qeEId~v  330 (489)
T KOG0156|consen  260 DEEGRDFVDALLKLMKEEKAE-----GL----TDDHLKALILDLFLAGTDTTATTLEWAMAELLNNPEVQKKLQEEIDEV  330 (489)
T ss_pred             cCCCCcHHHHHHHhhcccccC-----CC----CHHHHHHHHHHHHhcccchHHHHHHHHHHHHHhCHHHHHHHHHHHHHH
Confidence            122389999999887653321     15    999999999999999999999999999999999999999999999997


Q ss_pred             -------------------hHHHhhhccccCccccceeeccccceecCeeeCCCCEEEecccccccCCCCCCCCCCccCC
Q psy4821         384 -------------------ATILETLRRSSVVALGTIHAVTRDVKFNGFTIPKNTQIVPLLHAVHMDPELWESPEDFRPT  444 (520)
Q Consensus       384 -------------------a~i~E~lRl~p~~~~~~~R~~~~d~~l~g~~iP~G~~v~~~~~~~~~d~~~~~~p~~F~Pe  444 (520)
                                         |||+|++|+||++|+.++|.+.+|++++||.|||||.|+++.|++||||++|+||++|+||
T Consensus       331 vG~~r~v~e~D~~~lpYL~Avi~E~~Rl~p~~Pl~~ph~~~~d~~i~Gy~IPkgT~v~vn~~ai~rDp~vw~dP~eF~PE  410 (489)
T KOG0156|consen  331 VGKGRLVSESDLPKLPYLKAVIKETLRLHPPLPLLLPRETTEDTKIGGYDIPKGTTVLVNLWAIHRDPKVWEDPEEFKPE  410 (489)
T ss_pred             hCCCCCCChhhhccCHHHHHHHHHHHhcCCCccccccccccCCeeEcCEEcCCCCEEEEeehhhhcCCccCCCccccChh
Confidence                               9999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCC-CCccCCCcccccCCCCCCCcchHHHHHHHHHHHHHHHhhcceecCCCCCCCCCCCCCcee-ecCCCCC
Q psy4821         445 RFLTPE-GKVTKPEFFLPFGVGRRMCLGDVLARMELFLFFSTLMHTFGIESPPGQPLPSLKGNAGVT-ITPDSHK  517 (520)
Q Consensus       445 Rfl~~~-~~~~~~~~~~~FG~G~r~C~G~~~a~~e~~~~l~~ll~~f~~~~~~~~~~~~~~~~~~~~-~~p~~~~  517 (520)
                      ||++++ .+. ....++|||.|+|.|||..+|.+++.++++.||++|+|+++++  .+++... +.+ ..+.+++
T Consensus       411 RFl~~~d~~~-~~~~~iPFG~GRR~CpG~~La~~~l~l~la~llq~F~w~~~~~--~~d~~e~-~~~~~~~~pl~  481 (489)
T KOG0156|consen  411 RFLDSNDGKG-LDFKLIPFGSGRRICPGEGLARAELFLFLANLLQRFDWKLPGG--KVDMEEA-GLTLKKKKPLK  481 (489)
T ss_pred             hhcCCccccC-CceEecCCCCCcCCCCcHHHHHHHHHHHHHHHHheeeeecCCC--CCCCccc-ccceecCCcce
Confidence            999984 444 6789999999999999999999999999999999999999877  3566554 333 3344544

>KOG0158|consensus Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>KOG0157|consensus Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>KOG0159|consensus Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>KOG0684|consensus Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query520
2f9q_A479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 2e-44
3qm4_A479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 2e-44
4h1n_A479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 5e-43
2q6n_A478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 2e-42
1suo_A476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 2e-42
1po5_A476 Structure Of Mammalian Cytochrome P450 2b4 Length = 7e-42
3tk3_A476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 7e-42
2hi4_A495 Crystal Structure Of Human Microsomal P450 1a2 In C 1e-38
3ibd_A476 Crystal Structure Of A Cytochrome P450 2b6 Genetic 2e-38
3czh_A481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 2e-38
3c6g_A479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 3e-38
3qz1_A496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 3e-36
1pq2_A476 Crystal Structure Of Human Drug Metabolizing Cytoch 4e-36
4i8v_A491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 2e-35
3ruk_A494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 3e-35
3e4e_A476 Human Cytochrome P450 2e1 In Complex With The Inhib 3e-34
1dt6_A473 Structure Of Mammalian Cytochrome P450 2c5 Length = 3e-34
1r9o_A477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 5e-34
2p85_A476 Structure Of Human Lung Cytochrome P450 2a13 With I 1e-33
3ebs_A476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 6e-33
1og2_A475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 2e-32
1z10_A476 Crystal Structure Of Human Microsomal P450 2a6 With 3e-32
2pg7_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 4e-32
2pg5_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 5e-32
4gqs_A477 Structure Of Human Microsomal Cytochrome P450 (cyp) 5e-32
2pg6_A476 Crystal Structure Of Human Microsomal P450 2a6 L240 2e-31
3pm0_A507 Structural Characterization Of The Complex Between 2e-27
2ve3_A444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 3e-13
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 5e-13
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 5e-13
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 6e-13
3mgx_A415 Crystal Structure Of P450 Oxyd That Is Involved In 1e-11
3dbg_A467 Crystal Structure Of Cytochrome P450 170a1 (Cyp170a 4e-11
3e5l_A403 Crystal Structure Of Cyp105p1 H72a Mutant Length = 9e-11
3aba_A403 Crystal Structure Of Cyp105p1 In Complex With Filip 1e-10
3e5j_A403 Crystal Structure Of Cyp105p1 Wild-type Ligand-free 1e-10
3ejb_B404 Crystal Structure Of P450bioi In Complex With Tetra 4e-10
3na0_A471 Crystal Structure Of Human Cyp11a1 In Complex With 8e-10
3n9y_A487 Crystal Structure Of Human Cyp11a1 In Complex With 8e-10
3k9v_A482 Crystal Structure Of Rat Mitochondrial P450 24a1 S5 1e-09
3tyw_A417 Crystal Structure Of Cyp105n1 From Streptomyces Coe 2e-09
3cbd_A455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 7e-09
3mzs_A486 Crystal Structure Of Cytochrome P450 Cyp11a1 In Com 8e-09
1zoa_A473 Crystal Structure Of A328v Mutant Of The Heme Domai 2e-08
3p3o_A416 Crystal Structure Of The Cytochrome P450 Monooxygen 2e-08
3p3l_A406 Crystal Structure Of The Cytochrome P450 Monooxygen 3e-08
3kx5_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 3e-08
2uwh_A458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 6e-08
1jpz_A473 Crystal Structure Of A Complex Of The Heme Domain O 6e-08
2bmh_A455 Modeling Protein-Substrate Interactions In The Heme 6e-08
2ij2_A470 Atomic Structure Of The Heme Domain Of Flavocytochr 6e-08
2x7y_A455 P450 Bm3 F87a In Complex With Dmso Length = 455 6e-08
1bvy_A458 Complex Of The Heme And Fmn-Binding Domains Of The 7e-08
3ekb_A470 Crystal Structure Of The A264c Mutant Heme Domain O 7e-08
2hpd_A471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 7e-08
3npl_A470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 7e-08
3kx3_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 7e-08
3ben_A470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 7e-08
2q9f_A456 Crystal Structure Of Human Cytochrome P450 46a1 In 8e-08
2nnb_A471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 8e-08
3ekf_A470 Crystal Structure Of The A264q Heme Domain Of Cytoc 8e-08
3ekd_A470 Crystal Structure Of The A264m Heme Domain Of Cytoc 9e-08
2ij4_A470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 9e-08
3ofu_A396 Crystal Structure Of Cytochrome P450 Cyp101c1 Lengt 9e-08
1smi_A471 A Single Mutation Of P450 Bm3 Induces The Conformat 1e-07
3psx_A487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 1e-07
3m4v_A482 Crystal Structure Of The A330p Mutant Of Cytochrome 1e-07
1zo4_A473 Crystal Structure Of A328s Mutant Of The Heme Domai 1e-07
2ij3_A470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 1e-07
4duc_A472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 1e-07
4duf_A471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 1e-07
1p0x_A455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 1e-07
4dud_A471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 1e-07
4dub_A472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 1e-07
4dua_A471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 1e-07
1p0w_A455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 2e-07
3eqm_A503 Crystal Structure Of Human Placental Aromatase Cyto 2e-07
1yqo_A455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 2e-07
1yqp_A455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 2e-07
3dgi_A461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 2e-07
1fah_A471 Structure Of Cytochrome P450 Length = 471 2e-07
3hf2_A482 Crystal Structure Of The I401p Mutant Of Cytochrome 2e-07
3kx4_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 2e-07
4dtw_B469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 3e-07
3r9c_A418 Crystal Structure Of Mycobacterium Smegmatis Cyp164 3e-07
2z36_A413 Crystal Structure Of Cytochrome P450 Moxa From Nono 3e-07
4du2_B470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 4e-07
1jme_A455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 4e-07
1p0v_A455 F393a Mutant Heme Domain Of Flavocytochrome P450 Bm 5e-07
1wiy_A389 Crystal Structure Analysis Of A 6-Coordinated Cytoc 1e-06
3sn5_A491 Crystal Structure Of Human Cyp7a1 In Complex With C 1e-06
3dax_A491 Crystal Structure Of Human Cyp7a1 Length = 491 1e-06
1n97_A389 Crystal Stucture Of Cyp175a1 From Thermus Thermophi 2e-06
3qi8_B472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 2e-06
2fr7_A412 Crystal Structure Of Cytochrome P450 Cyp199a2 Lengt 3e-06
1cmn_A402 Crystal Structures Of Ferric-No Complexes Of Fungal 3e-06
1ehg_A403 Crystal Structures Of Cytochrome P450nor And Its Mu 3e-06
1x8v_A455 Estriol-Bound And Ligand-Free Structures Of Sterol 4e-06
2w0a_A455 Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[( 4e-06
1ea1_A455 Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) 4e-06
1u13_A455 Crystal Structure Analysis Of The C37lC151TC442A-Tr 4e-06
1ehf_A403 Crystal Structures Of Cytochrome P450nor And Its Mu 1e-05
1cmj_A402 Crystal Structures Of Ferric-No Complexes Of Fungal 1e-05
4dnz_A410 The Crystal Structures Of Cyp199a4 Length = 410 1e-05
1ulw_A402 Crystal Structure Of P450nor Ser73gly/ser75gly Muta 1e-05
1cl6_A402 Crystal Structures Of Ferric-No Complexes Of Fungal 1e-05
1ehe_A403 Crystal Structures Of Cytochrome P450nor And Its Mu 1e-05
1jfb_A404 X-Ray Structure Of Nitric Oxide Reductase (Cytochro 2e-05
2zuj_A415 Crystal Structure Of Camphor-Soaked Ferric Cytochro 2e-05
2zby_A412 Crystal Structure Of Vitamin D Hydroxylase Cytochro 2e-05
2zbx_A412 Crystal Structure Of Vitamin D Hydroxylase Cytochro 2e-05
3cv9_A412 Crystal Structure Of Vitamin D Hydroxylase Cytochro 2e-05
3cv8_A412 Crystal Structure Of Vitamin D Hydroxylase Cytochro 2e-05
1xqd_A403 Crystal Structure Of P450nor Complexed With 3- Pyri 2e-05
2yoo_A407 Cholest-4-en-3-one Bound Structure Of Cyp142 From M 2e-05
2qbl_A421 Crystal Structure Of Ferric G248t Cytochrome P450ca 3e-05
2rfb_A343 Crystal Structure Of A Cytochrome P450 From The The 4e-05
2h7r_A414 L244a Mutant Of Cytochrome P450cam Complexed With I 4e-05
1f25_A402 Crystal Structure Of No Complex Of Thr243asn Mutant 4e-05
1f24_A402 Crystal Structure Of No Complex Of Thr243ala Mutant 5e-05
1f26_A402 Crystal Structure Of No Complex Of Thr243val Mutant 5e-05
2gqx_A405 Crystal Structure Of Cytochrome P450cam Mutant (F87 6e-05
1cpt_A428 Crystal Structure And Refinement Of Cytochrome P450 6e-05
2zuh_A415 Crystal Structure Of Camphor-Soaked Ferric Cytochro 7e-05
3g1q_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 7e-05
3gw9_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 8e-05
3tik_A454 Sterol 14-Alpha Demethylase (Cyp51) From Trypanosom 8e-05
3p99_A453 Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma 8e-05
2x2n_A475 X-Ray Structure Of Cyp51 From Trypanosoma Brucei In 8e-05
2wv2_A475 X-Ray Structure Of Cyp51 From The Human Pathogen Tr 8e-05
1qmq_A414 Optical Detection Of Cytochrome P450 By Sensitizer- 8e-05
2a1m_A415 Crystal Structure Of Ferrous Dioxygen Complex Of Wi 9e-05
2qbn_A421 Crystal Structure Of Ferric G248v Cytochrome P450ca 1e-04
2x9p_A404 X-Ray Structure Of The Substrate-Free Cytochrome P4 1e-04
1p2y_A420 Crystal Structure Of Cytochrome P450cam In Complex 1e-04
2lqd_A405 Reduced And Co-Bound Cytochrome P450cam (Cyp101a1) 1e-04
2fer_A411 P450cam From Pseudomonas Putida Reconstituted With 1e-04
1re9_A414 Crystal Structure Of Cytochrome P450-cam With A Flu 1e-04
2zui_A415 Crystal Structure Of Camphor-Soaked Ferric Cytochro 1e-04
1q5d_A419 Epothilone B-Bound Cytochrome P450epok Length = 419 1e-04
1iwj_A415 Putidaredoxin-Binding Stablilizes An Active Conform 1e-04
1iwk_A415 Putidaredoxin-Binding Stablilizes An Active Conform 1e-04
1pkf_A419 Crystal Structure Of Epothilone D-Bound Cytochrome 1e-04
1lwl_A417 Crystal Structure Of Cytochrome P450-Cam With A Flu 1e-04
2fe6_A421 P450cam From Pseudomonas Putida Reconstituted With 1e-04
1gek_A415 Structural Characterization Of N-Butyl-Isocyanide C 1e-04
1c8j_A414 Crystal Structure Of Cytochrome P450cam Mutant (F87 1e-04
2a1n_A415 Crystal Structure Of Ferrous Dioxygen Complex Of D2 2e-04
3fwg_A405 Ferric Camphor Bound Cytochrome P450cam, Arg365leu, 2e-04
1dz8_A414 Oxygen Complex Of P450cam From Pseudomonas Putida L 2e-04
1odo_A408 1.85 A Structure Of Cyp154a1 From Streptomyces Coel 2e-04
6cp4_A414 P450cam D251n Mutant Length = 414 2e-04
3rwl_A426 Structure Of P450pyr Hydroxylase Length = 426 2e-04
4ek1_A414 Crystal Structure Of Electron-Spin Labeled Cytochro 3e-04
2a1o_A415 Crystal Structure Of Ferrous Dioxygen Complex Of T2 3e-04
4ep6_A392 Crystal Structure Of The Xpla Heme Domain In Comple 3e-04
3ld6_A461 Crystal Structure Of Human Lanosterol 14alpha-Demet 3e-04
2wiv_A394 Cytochrome-P450 Xpla Heme Domain P21 Length = 394 3e-04
2cp4_A414 Crystal Structure Of The Cytochrome P450-Cam Active 4e-04
3abb_A408 Crystal Structure Of Cyp105d6 Length = 408 4e-04
4apy_A433 Ethylene Glycol-bound Form Of P450 Cyp125a3 From My 4e-04
3a4g_A411 Structure Of Cytochrome P450 Vdh From Pseudonocardi 5e-04
3a4z_A411 Structure Of Cytochrome P450 Vdh Mutant (Vdh-K1) Ob 5e-04
1geb_A415 X-Ray Crystal Structure And Catalytic Properties Of 5e-04
1t85_A414 Crystal Structure Of The Ferrous Co-Bound Cytochrom 5e-04
3nc3_A441 Cyp134a1 Structure With A Closed Substrate Binding 6e-04
2z3t_A425 Crystal Structure Of Substrate Free Cytochrome P450 6e-04
2xkr_A398 Crystal Structure Of Mycobacterium Tuberculosis Cyp 7e-04
3khm_A464 Crystal Structure Of Sterol 14alpha-Demethylase (Cy 8e-04
2wuz_A473 X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In 9e-04
3k1o_A458 Crystal Structure Of Sterol 14-alpha Demethylase (c 9e-04
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure 
Iteration: 1

 Score =  177 bits (448), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 105/278 (37%), Positives = 146/278 (52%), Gaps = 29/278 (10%)
Query: 260 VVNFLPFVKYLPGLRETRKTLSKNRVEMGAYFQEKINEHRTTFD-ASNIRDMLDSYLFEI 318
           V+N +P  +++P L    K L   +  +     E + EHR T+D A   RD+ +++L E+
Sbjct: 201 VLNAVPVDRHIPAL--AGKVLRFQKAFL-TQLDELLTEHRMTWDPAQPPRDLTEAFLAEM 257
Query: 319 EKAKMENRSDQLFNGKNHDRQMQQIIGDLFSTGMETIKNTLQWSLVYMMHYPAVAKAVQD 378
           EKAK    S   FN +N    ++ ++ DLFS GM T   TL W L+ M+ +P V + VQ 
Sbjct: 258 EKAKGNPESS--FNDEN----LRIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQ 311
Query: 379 ELD-------------------TVATILETLRRSSVVALGTIHAVTRDVKFNGFTIPKNT 419
           E+D                   T A I E  R   +V LG  H  +RD++  GF IPK T
Sbjct: 312 EIDDVIGQVRRPEMGDQAHMPYTTAVIHEVQRFGDIVPLGMTHMTSRDIEVQGFRIPKGT 371
Query: 420 QIVPLLHAVHMDPELWESPEDFRPTRFLTPEGKVTKPEFFLPFGVGRRMCLGDVLARMEL 479
            ++  L +V  D  +WE P  F P  FL  +G   KPE FLPF  GRR CLG+ LARMEL
Sbjct: 372 TLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRACLGEPLARMEL 431
Query: 480 FLFFSTLMHTFGIESPPGQPLPSLKGNAGVTITPDSHK 517
           FLFF++L+  F    P GQP PS  G     ++P  ++
Sbjct: 432 FLFFTSLLQHFSFSVPTGQPRPSHHGVFAFLVSPSPYE 469
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|3MGX|A Chain A, Crystal Structure Of P450 Oxyd That Is Involved In The Biosynthesis Of Vancomycin-Type Antibiotics Length = 415 Back     alignment and structure
>pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 Back     alignment and structure
>pdb|3E5L|A Chain A, Crystal Structure Of Cyp105p1 H72a Mutant Length = 403 Back     alignment and structure
>pdb|3ABA|A Chain A, Crystal Structure Of Cyp105p1 In Complex With Filipin I Length = 403 Back     alignment and structure
>pdb|3E5J|A Chain A, Crystal Structure Of Cyp105p1 Wild-type Ligand-free Form Length = 403 Back     alignment and structure
>pdb|3EJB|B Chain B, Crystal Structure Of P450bioi In Complex With Tetradecanoic Acid Ligated Acyl Carrier Protein Length = 404 Back     alignment and structure
>pdb|3NA0|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 471 Back     alignment and structure
>pdb|3N9Y|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 487 Back     alignment and structure
>pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 Back     alignment and structure
>pdb|3TYW|A Chain A, Crystal Structure Of Cyp105n1 From Streptomyces Coelicolor A3(2) Length = 417 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|3P3O|A Chain A, Crystal Structure Of The Cytochrome P450 Monooxygenase Aurh (Ntermii) From Streptomyces Thioluteus Length = 416 Back     alignment and structure
>pdb|3P3L|A Chain A, Crystal Structure Of The Cytochrome P450 Monooxygenase Aurh (Wildtype) From Streptomyces Thioluteus Length = 406 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3OFU|A Chain A, Crystal Structure Of Cytochrome P450 Cyp101c1 Length = 396 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3EQM|A Chain A, Crystal Structure Of Human Placental Aromatase Cytochrome P450 In Complex With Androstenedione Length = 503 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|3R9C|A Chain A, Crystal Structure Of Mycobacterium Smegmatis Cyp164a2 With Econazole Bound Length = 418 Back     alignment and structure
>pdb|2Z36|A Chain A, Crystal Structure Of Cytochrome P450 Moxa From Nonomuraea Recticatena (Cyp105) Length = 413 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1WIY|A Chain A, Crystal Structure Analysis Of A 6-Coordinated Cytochorome P450 From Thermus Thermophilus Hb8 Length = 389 Back     alignment and structure
>pdb|3SN5|A Chain A, Crystal Structure Of Human Cyp7a1 In Complex With Cholest-4-En-3-One Length = 491 Back     alignment and structure
>pdb|3DAX|A Chain A, Crystal Structure Of Human Cyp7a1 Length = 491 Back     alignment and structure
>pdb|1N97|A Chain A, Crystal Stucture Of Cyp175a1 From Thermus Thermophillus Strain Hb27 Length = 389 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|2FR7|A Chain A, Crystal Structure Of Cytochrome P450 Cyp199a2 Length = 412 Back     alignment and structure
>pdb|1CMN|A Chain A, Crystal Structures Of Ferric-No Complexes Of Fungal Nitric Oxide Reductase And Their Ser286 Mutants At Cryogenic Temperature Length = 402 Back     alignment and structure
>pdb|1EHG|A Chain A, Crystal Structures Of Cytochrome P450nor And Its Mutants (Ser286 Val, Thr) In The Ferric Resting State At Cryogenic Temperature: A Comparative Analysis With Monooxygenase Cytochrome P450s Length = 403 Back     alignment and structure
>pdb|1X8V|A Chain A, Estriol-Bound And Ligand-Free Structures Of Sterol 14alpha- Demethylase (Cyp51) Length = 455 Back     alignment and structure
>pdb|2W0A|A Chain A, Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[(1s)-2-Methyl-1-(Pyridin-4-Ylcarbamoyl)propyl] Cyclohexanecarboxamide Length = 455 Back     alignment and structure
>pdb|1EA1|A Chain A, Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) From Mycobacterium Tuberculosis In Complex With Fluconazole Length = 455 Back     alignment and structure
>pdb|1U13|A Chain A, Crystal Structure Analysis Of The C37lC151TC442A-Triple Mutant Of Cyp51 From Mycobacterium Tuberculosis Length = 455 Back     alignment and structure
>pdb|1EHF|A Chain A, Crystal Structures Of Cytochrome P450nor And Its Mutants (Ser286 Val, Thr) In The Ferric Resting State At Cryogenic Temperature: A Comparative Analysis With Monooxygenase Cytochrome P450s Length = 403 Back     alignment and structure
>pdb|1CMJ|A Chain A, Crystal Structures Of Ferric-No Complexes Of Fungal Nitric Oxide Reductase And Their Ser286 Mutants At Cryogenic Temperature Length = 402 Back     alignment and structure
>pdb|4DNZ|A Chain A, The Crystal Structures Of Cyp199a4 Length = 410 Back     alignment and structure
>pdb|1ULW|A Chain A, Crystal Structure Of P450nor Ser73gly/ser75gly Mutant Length = 402 Back     alignment and structure
>pdb|1CL6|A Chain A, Crystal Structures Of Ferric-No Complexes Of Fungal Nitric Oxide Reductase And Its Ser286 Mutants At Cryogenic Temperature Length = 402 Back     alignment and structure
>pdb|1EHE|A Chain A, Crystal Structures Of Cytochrome P450nor And Its Mutants (Ser286 Val, Thr) In The Ferric Resting State At Cryogenic Temperature: A Comparative Analysis With Monooxygenase Cytochrome P450s Length = 403 Back     alignment and structure
>pdb|1JFB|A Chain A, X-Ray Structure Of Nitric Oxide Reductase (Cytochrome P450nor) In The Ferric Resting State At Atomic Resolution Length = 404 Back     alignment and structure
>pdb|2ZUJ|A Chain A, Crystal Structure Of Camphor-Soaked Ferric Cytochrome P450cam Mutant(D297l) Length = 415 Back     alignment and structure
>pdb|2ZBY|A Chain A, Crystal Structure Of Vitamin D Hydroxylase Cytochrome P450 105a1 (R84a Mutant) Length = 412 Back     alignment and structure
>pdb|2ZBX|A Chain A, Crystal Structure Of Vitamin D Hydroxylase Cytochrome P450 105a1 (Wild Type) With Imidazole Bound Length = 412 Back     alignment and structure
>pdb|3CV9|A Chain A, Crystal Structure Of Vitamin D Hydroxylase Cytochrome P450 105a1 (R73aR84A MUTANT) IN COMPLEX WITH 1ALPHA,25- Dihydroxyvitamin D3 Length = 412 Back     alignment and structure
>pdb|3CV8|A Chain A, Crystal Structure Of Vitamin D Hydroxylase Cytochrome P450 105a1 (R84f Mutant) Length = 412 Back     alignment and structure
>pdb|1XQD|A Chain A, Crystal Structure Of P450nor Complexed With 3- Pyridinealdehyde Adenine Dinucleotide Length = 403 Back     alignment and structure
>pdb|2YOO|A Chain A, Cholest-4-en-3-one Bound Structure Of Cyp142 From Mycobacterium Smegmatis Length = 407 Back     alignment and structure
>pdb|2QBL|A Chain A, Crystal Structure Of Ferric G248t Cytochrome P450cam Length = 421 Back     alignment and structure
>pdb|2RFB|A Chain A, Crystal Structure Of A Cytochrome P450 From The Thermoacidophilic Archaeon Picrophilus Torridus Length = 343 Back     alignment and structure
>pdb|2H7R|A Chain A, L244a Mutant Of Cytochrome P450cam Complexed With Imidazole Length = 414 Back     alignment and structure
>pdb|1F25|A Chain A, Crystal Structure Of No Complex Of Thr243asn Mutants Of Cytochrome P450nor Length = 402 Back     alignment and structure
>pdb|1F24|A Chain A, Crystal Structure Of No Complex Of Thr243ala Mutants Of Cytochrome P450nor Length = 402 Back     alignment and structure
>pdb|1F26|A Chain A, Crystal Structure Of No Complex Of Thr243val Mutants Of Cytochrome P450nor Length = 402 Back     alignment and structure
>pdb|2GQX|A Chain A, Crystal Structure Of Cytochrome P450cam Mutant (F87wY96FL244AV247LC334A) WITH PENTACHLOROBENZENE Length = 405 Back     alignment and structure
>pdb|1CPT|A Chain A, Crystal Structure And Refinement Of Cytochrome P450-Terp At 2.3 Angstroms Resolution Length = 428 Back     alignment and structure
>pdb|2ZUH|A Chain A, Crystal Structure Of Camphor-Soaked Ferric Cytochrome P450cam Mutant (D297a) Length = 415 Back     alignment and structure
>pdb|3G1Q|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Ligand Free State Length = 450 Back     alignment and structure
>pdb|3GW9|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei Bound To An Inhibitor N-(1-(2,4- Dichlorophenyl)-2-(1h-Imidazol-1-Yl)ethyl)-4-(5-Phenyl- 1,3, 4-Oxaziazol-2-Yl)benzamide Length = 450 Back     alignment and structure
>pdb|3TIK|A Chain A, Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Complex With The Tipifarnib Derivative 6-((4-Chlorophenyl)(Methoxy)(1-Methyl- 1h-Imidazol-5-Yl)methyl)-4-(2, 6-Difluorophenyl)-1-Methylquinolin- 2(1h)-One Length = 454 Back     alignment and structure
>pdb|3P99|A Chain A, Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Brucei In Complex With Delta7-14alpha-Methylene-Cyclopropyl-Dihydrolanosterol Length = 453 Back     alignment and structure
>pdb|2X2N|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Brucei In Complex With Posaconazole In Two Different Conformations Length = 475 Back     alignment and structure
>pdb|2WV2|A Chain A, X-Ray Structure Of Cyp51 From The Human Pathogen Trypanosoma Brucei In Complex With Fluconazole Length = 475 Back     alignment and structure
>pdb|1QMQ|A Chain A, Optical Detection Of Cytochrome P450 By Sensitizer-Linked Substrates Length = 414 Back     alignment and structure
>pdb|2A1M|A Chain A, Crystal Structure Of Ferrous Dioxygen Complex Of Wild-Type Cytochrome P450cam Length = 415 Back     alignment and structure
>pdb|2QBN|A Chain A, Crystal Structure Of Ferric G248v Cytochrome P450cam Length = 421 Back     alignment and structure
>pdb|2X9P|A Chain A, X-Ray Structure Of The Substrate-Free Cytochrome P450 Pimd - A Polyene Macrolide Antibiotic Pimaricin Epoxidase Length = 404 Back     alignment and structure
>pdb|1P2Y|A Chain A, Crystal Structure Of Cytochrome P450cam In Complex With (S)- (-)-Nicotine Length = 420 Back     alignment and structure
>pdb|2LQD|A Chain A, Reduced And Co-Bound Cytochrome P450cam (Cyp101a1) Length = 405 Back     alignment and structure
>pdb|2FER|A Chain A, P450cam From Pseudomonas Putida Reconstituted With Manganic Protoporphyrin Ix Length = 411 Back     alignment and structure
>pdb|1RE9|A Chain A, Crystal Structure Of Cytochrome P450-cam With A Fluorescent Probe D-8-ad (adamantane-1-carboxylic Acid-5-dimethylamino- Naphthalene-1-sulfonylamino-octyl-amide) Length = 414 Back     alignment and structure
>pdb|2ZUI|A Chain A, Crystal Structure Of Camphor-Soaked Ferric Cytochrome P450cam Mutant (D297n) Length = 415 Back     alignment and structure
>pdb|1Q5D|A Chain A, Epothilone B-Bound Cytochrome P450epok Length = 419 Back     alignment and structure
>pdb|1IWJ|A Chain A, Putidaredoxin-Binding Stablilizes An Active Conformer Of Cytochrome P450cam In Its Reduced State; Crystal Structure Of Mutant(109k) Cytochrome P450cam Length = 415 Back     alignment and structure
>pdb|1IWK|A Chain A, Putidaredoxin-Binding Stablilizes An Active Conformer Of Cytochrome P450cam In Its Reduced State; Crystal Structure Of Mutant(112k) Cytochrome P450cam Length = 415 Back     alignment and structure
>pdb|1PKF|A Chain A, Crystal Structure Of Epothilone D-Bound Cytochrome P450epok Length = 419 Back     alignment and structure
>pdb|1LWL|A Chain A, Crystal Structure Of Cytochrome P450-Cam With A Fluorescent Probe D-8-Ad (Adamantane-1-Carboxylic Acid-5-Dimethylamino- Naphthalene-1-Sulfonylamino-Octyl-Amide) Length = 417 Back     alignment and structure
>pdb|2FE6|A Chain A, P450cam From Pseudomonas Putida Reconstituted With Manganic Protoporphyrin Ix Length = 421 Back     alignment and structure
>pdb|1GEK|A Chain A, Structural Characterization Of N-Butyl-Isocyanide Complexes Of Cytochromes P450nor And P450cam Length = 415 Back     alignment and structure
>pdb|1C8J|A Chain A, Crystal Structure Of Cytochrome P450cam Mutant (F87wY96F) Length = 414 Back     alignment and structure
>pdb|2A1N|A Chain A, Crystal Structure Of Ferrous Dioxygen Complex Of D251n Cytochrome P450cam Length = 415 Back     alignment and structure
>pdb|3FWG|A Chain A, Ferric Camphor Bound Cytochrome P450cam, Arg365leu, Glu366gln, Monoclinic Crystal Form Length = 405 Back     alignment and structure
>pdb|1DZ8|A Chain A, Oxygen Complex Of P450cam From Pseudomonas Putida Length = 414 Back     alignment and structure
>pdb|1ODO|A Chain A, 1.85 A Structure Of Cyp154a1 From Streptomyces Coelicolor A3(2) Length = 408 Back     alignment and structure
>pdb|6CP4|A Chain A, P450cam D251n Mutant Length = 414 Back     alignment and structure
>pdb|3RWL|A Chain A, Structure Of P450pyr Hydroxylase Length = 426 Back     alignment and structure
>pdb|4EK1|A Chain A, Crystal Structure Of Electron-Spin Labeled Cytochrome P450cam Length = 414 Back     alignment and structure
>pdb|2A1O|A Chain A, Crystal Structure Of Ferrous Dioxygen Complex Of T252a Cytochrome P450cam Length = 415 Back     alignment and structure
>pdb|4EP6|A Chain A, Crystal Structure Of The Xpla Heme Domain In Complex With Imidazole And Peg Length = 392 Back     alignment and structure
>pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 Back     alignment and structure
>pdb|2WIV|A Chain A, Cytochrome-P450 Xpla Heme Domain P21 Length = 394 Back     alignment and structure
>pdb|2CP4|A Chain A, Crystal Structure Of The Cytochrome P450-Cam Active Site Mutant Thr252ala Length = 414 Back     alignment and structure
>pdb|3ABB|A Chain A, Crystal Structure Of Cyp105d6 Length = 408 Back     alignment and structure
>pdb|4APY|A Chain A, Ethylene Glycol-bound Form Of P450 Cyp125a3 From Mycobacterium Smegmatis Length = 433 Back     alignment and structure
>pdb|3A4G|A Chain A, Structure Of Cytochrome P450 Vdh From Pseudonocardia Autotrophica (Trigonal Crystal Form) Length = 411 Back     alignment and structure
>pdb|3A4Z|A Chain A, Structure Of Cytochrome P450 Vdh Mutant (Vdh-K1) Obtained By Directed Evolution Length = 411 Back     alignment and structure
>pdb|1GEB|A Chain A, X-Ray Crystal Structure And Catalytic Properties Of Thr252ile Mutant Of Cytochrome P450cam Length = 415 Back     alignment and structure
>pdb|1T85|A Chain A, Crystal Structure Of The Ferrous Co-Bound Cytochrome P450cam Mutant (L358pC334A) Length = 414 Back     alignment and structure
>pdb|3NC3|A Chain A, Cyp134a1 Structure With A Closed Substrate Binding Loop Length = 441 Back     alignment and structure
>pdb|2Z3T|A Chain A, Crystal Structure Of Substrate Free Cytochrome P450 Stap (cyp245a1) Length = 425 Back     alignment and structure
>pdb|2XKR|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Cyp142: A Novel Cholesterol Oxidase Length = 398 Back     alignment and structure
>pdb|3KHM|A Chain A, Crystal Structure Of Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Cruzi In Complex With Inhibitor Fluconazole Length = 464 Back     alignment and structure
>pdb|2WUZ|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In Complex With Fluconazole In Alternative Conformation Length = 473 Back     alignment and structure
>pdb|3K1O|A Chain A, Crystal Structure Of Sterol 14-alpha Demethylase (cyp51) From Trypanosoma Cruzi In Complex With A Potential Antichagasic Drug, Posaconazole Length = 458 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query520
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 1e-136
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 1e-111
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 3e-43
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 1e-105
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 2e-40
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 1e-104
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 7e-44
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 1e-102
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 1e-37
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 1e-101
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 1e-38
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 1e-100
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 3e-38
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 5e-99
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 6e-40
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 8e-99
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 2e-37
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 5e-98
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 1e-37
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 2e-53
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 1e-52
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 2e-52
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 3e-19
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 2e-49
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 3e-38
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 4e-07
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 1e-36
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 2e-05
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 1e-36
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 1e-18
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 2e-36
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 1e-11
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 2e-34
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 2e-04
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 5e-34
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 1e-08
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 1e-32
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 1e-07
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 8e-30
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 6e-06
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 4e-28
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 8e-28
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 4e-27
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 5e-09
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 1e-26
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 2e-08
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 3e-20
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 2e-18
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 5e-18
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 8e-18
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 1e-17
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 3e-17
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 1e-16
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 2e-16
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 2e-16
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 3e-16
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 4e-16
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 2e-15
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 3e-15
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 3e-15
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 5e-15
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 7e-15
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 1e-14
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 1e-14
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 1e-14
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 1e-14
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 1e-14
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 2e-14
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 2e-14
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 3e-14
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 5e-14
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 7e-14
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 1e-13
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 1e-13
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 1e-13
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 1e-13
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 2e-13
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 2e-13
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 2e-13
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 3e-13
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 3e-13
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 3e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-13
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 5e-13
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 6e-13
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 9e-13
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 9e-13
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 1e-12
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 1e-12
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 2e-12
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 2e-12
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 3e-12
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 3e-12
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 4e-12
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 2e-11
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 2e-11
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
 Score =  403 bits (1038), Expect = e-136
 Identities = 122/550 (22%), Positives = 200/550 (36%), Gaps = 143/550 (26%)

Query: 34  KKVRSLPPGPWGLPIIGYLPFLKGDAHISFKNLSAKYGSIFSTKLGDQLIVVLSDYRHIR 93
              +  PPGP+  P+IG    +   AH+SF  L+ +YG +F  +LG   IVVL+  R I 
Sbjct: 5   TSSKGKPPGPFAWPLIGNAAAVGQAAHLSFARLARRYGDVFQIRLGSCPIVVLNGERAIH 64

Query: 94  EAF--RKEEFSGRPHT-ELSSILGGYEVNVF-----------------LKSLQAQA---- 129
           +A   +   F+ RP       + GG  +  F                 +++   +     
Sbjct: 65  QALVQQGSAFADRPSFASFRVVSGGRSM-AFGHYSEHWKVQRRAAHSMMRNFFTRQPRSR 123

Query: 130 ------------ELCGA--------TGVDVNPLLATSISNVICSIVMSVRFSNEDPQFKR 169
                       EL             +D  PL   +++NV+ ++              R
Sbjct: 124 QVLEGHVLSEARELVALLVRGSADGAFLDPRPLTVVAVANVMSAVCFG----------CR 173

Query: 170 FMHLIDEGFKLFETMAVVNFLPFVKYLPGLRETRKTLSKVSETLKKCSQPNEGFKLFETM 229
           + H  D             F   + +                         E  +     
Sbjct: 174 YSH-DDP-----------EFRELLSHN-----------------------EEFGRTVGAG 198

Query: 230 AVVNFLPFVKYLPGLRETRKTLSKLFETMAVVNFLPFVKYLPGLRETRKTLSKNRVEMGA 289
           ++V+ +P+++Y P                               R   +   +       
Sbjct: 199 SLVDVMPWLQYFPNPV----------------------------RTVFREFEQLNRNFSN 230

Query: 290 YFQEKINEHRTTFDASNI-RDMLDSYLFEIEKAKMENRSDQLFNGKNHDRQMQQIIGDLF 348
           +  +K   H  +       RDM+D+++   EK    +        +     +   I D+F
Sbjct: 231 FILDKFLRHCESLRPGAAPRDMMDAFILSAEKKAAGDSHGG--GARLDLENVPATITDIF 288

Query: 349 STGMETIKNTLQWSLVYMMHYPAVAKAVQDELDTV-------------------ATILET 389
               +T+   LQW L+    YP V   VQ ELD V                   A + E 
Sbjct: 289 GASQDTLSTALQWLLLLFTRYPDVQTRVQAELDQVVGRDRLPCMGDQPNLPYVLAFLYEA 348

Query: 390 LRRSSVVALGTIHAVTRDVKFNGFTIPKNTQIVPLLHAVHMDPELWESPEDFRPTRFLTP 449
           +R SS V +   HA T +    G+ IPK+T +     +V+ DP  W +PE+F P RFL  
Sbjct: 349 MRFSSFVPVTIPHATTANTSVLGYHIPKDTVVFVNQWSVNHDPLKWPNPENFDPARFLDK 408

Query: 450 EGKVTK--PEFFLPFGVGRRMCLGDVLARMELFLFFSTLMHTFGIESPPGQPLPSLKGNA 507
           +G + K      + F VG+R C+G+ L++M+LFLF S L H     + P +P   +  + 
Sbjct: 409 DGLINKDLTSRVMIFSVGKRRCIGEELSKMQLFLFISILAHQCDFRANPNEP-AKMNFSY 467

Query: 508 GVTITPDSHK 517
           G+TI P S K
Sbjct: 468 GLTIKPKSFK 477
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Length = 417 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Length = 415 Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Length = 396 Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Length = 441 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Length = 404 Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Length = 419 Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Length = 396 Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 1t2b_A* 3bdz_A* 3be0_A* Length = 398 Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Length = 418 Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Length = 412 Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Length = 398 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Length = 412 Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Length = 413 Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Length = 406 Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Length = 436 Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Length = 403 Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Length = 411 Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} Length = 417 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 408 Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Length = 426 Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Length = 394 Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Length = 343 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Length = 398 Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Length = 416 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Length = 417 Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 381 Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Length = 415 Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Length = 411 Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Length = 397 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Length = 408 Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Length = 404 Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} PDB: 3ejd_B* 3eje_B* Length = 404 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 411 Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Length = 368 Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Length = 425 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Length = 414 Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Length = 428 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Length = 404 Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Length = 435 Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Length = 450 Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} PDB: 3o1a_A* Length = 384 Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Length = 367 Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Length = 411 Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Length = 433 Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Length = 406 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query520
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 100.0
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 100.0
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 100.0
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 100.0
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 100.0
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 100.0
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 100.0
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 100.0
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 100.0
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 100.0
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 100.0
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 100.0
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 100.0
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 100.0
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 100.0
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 100.0
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 100.0
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 100.0
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 100.0
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 100.0
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 100.0
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 100.0
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 100.0
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 100.0
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 100.0
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 100.0
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 100.0
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 100.0
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 100.0
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 100.0
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 100.0
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 100.0
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 100.0
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 100.0
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 100.0
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 100.0
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 100.0
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 100.0
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 100.0
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 100.0
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 100.0
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 100.0
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 100.0
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 100.0
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 100.0
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 100.0
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 100.0
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 100.0
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 100.0
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 100.0
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 100.0
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 100.0
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 100.0
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 100.0
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 100.0
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 100.0
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 100.0
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 100.0
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 100.0
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 100.0
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 100.0
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 100.0
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 100.0
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 100.0
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 100.0
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 100.0
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 100.0
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 100.0
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 100.0
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 100.0
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 100.0
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 100.0
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=100.00  E-value=4.9e-67  Score=549.14  Aligned_cols=407  Identities=37%  Similarity=0.618  Sum_probs=316.0

Q ss_pred             HhcCCCCCCCCCcccccccccccC-CchHHHHHHHHHhhcCCeeEEEecCeeEEEecCHHHHHHHHhhc--cccCCCcch
Q psy4821          32 YIKKVRSLPPGPWGLPIIGYLPFL-KGDAHISFKNLSAKYGSIFSTKLGDQLIVVLSDYRHIREAFRKE--EFSGRPHTE  108 (520)
Q Consensus        32 ~~~~~~~~ppgP~~~p~lG~~~~l-~~~~~~~~~~~~~kyG~i~~~~~g~~~~vvi~dp~~i~~i~~~~--~~~~r~~~~  108 (520)
                      +..++.++||||++||++||++++ .++++..+.+|++||||||++++|++++|+|+||+++++++.++  .|++|+...
T Consensus         4 ~~ss~~kLPPGP~~lP~iGn~~~~~~~~~~~~~~~~~~kYG~i~~~~~g~~~~vvv~~p~~i~~vl~~~~~~f~~r~~~~   83 (479)
T 3tbg_A            4 KTSSKGKLPPGPLPLPGLGNLLHVDFQNTPYCFDQLRRRFGDVFSLQLAWTPVVVLNGLAAVREALVTHGEDTADRPPVP   83 (479)
T ss_dssp             -----CCCCCCSCCBTTTBTGGGCCTTSHHHHHHHHHHHHCSEEEEEETTEEEEEEEHHHHHHHHHTTTGGGSCBCCCCG
T ss_pred             CCCCCCCCCCCCCCcCcccchHhhcCCCHHHHHHHHHHHhCCEEEEEECCeeEEEECCHHHHHHHHHhCChhhcCCCchH
Confidence            334455799999999999999988 57889999999999999999999999999999999999999876  788787655


Q ss_pred             hhhhhC----CchHH------------HHH-----------HHHHHHH-----------HHhCCCCCChhHHHHHHHHHH
Q psy4821         109 LSSILG----GYEVN------------VFL-----------KSLQAQA-----------ELCGATGVDVNPLLATSISNV  150 (520)
Q Consensus       109 ~~~~~~----g~~~~------------~~~-----------~~~~~~~-----------~l~~~~~~~l~~~~~~~~~~~  150 (520)
                      ....+.    +.++.            +++           ..++..+           ....++.+|+...+..++.++
T Consensus        84 ~~~~~~~~~~~~~~~~~~~g~~w~~~R~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~  163 (479)
T 3tbg_A           84 ITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLEQWVTEEAACLCAAFANHSGRPFRPNGLLDKAVSNV  163 (479)
T ss_dssp             GGGGGTCBTTBCCSTTCCSSHHHHHHHHHHHHHHHHTTSTTCHHHHHHHHHHHHHHHHHHTTTTCCBCTHHHHHHHHHHH
T ss_pred             HHHHhccCCCCCceeeCCCCHHHHHHHHHHHHHhcchhhhHHHHHHHHHHHHHHHHHHHHhccCCcccHHHHHHHHHHHH
Confidence            443321    11111            000           0111111           114667899999999999999


Q ss_pred             HHHHHhcccCCCCChHHHHHHHHHHHHhhhhhhchhhcccccccccccchhhhhhhhhhhhhhhccCCCCCchhhhhhhh
Q psy4821         151 ICSIVMSVRFSNEDPQFKRFMHLIDEGFKLFETMAVVNFLPFVKYLPGLRETRKTLSKVSETLKKCSQPNEGFKLFETMA  230 (520)
Q Consensus       151 i~~~~fg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  230 (520)
                      ++.++||..++..++....+.+..............                                            
T Consensus       164 ~~~~~fg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------------------------------------------  199 (479)
T 3tbg_A          164 IASLTCGRRFEYDDPRFLRLLDLAQEGLKEESGFLR--------------------------------------------  199 (479)
T ss_dssp             HHHHHHSCCCCTTCHHHHHHHHHHHHHHHTTSSHHH--------------------------------------------
T ss_pred             HHHhhcCCcccccchhhhhhhhhhhhhhhhhhhhhh--------------------------------------------
Confidence            999999999998777655555444332221111000                                            


Q ss_pred             hhccccccccccchhHHHHHHHHHHhhhhhhcccccccccCCchHHHHHHHHHHHHHHHHHHHHHHHhhhhcC-CCCcch
Q psy4821         231 VVNFLPFVKYLPGLRETRKTLSKLFETMAVVNFLPFVKYLPGLRETRKTLSKNRVEMGAYFQEKINEHRTTFD-ASNIRD  309 (520)
Q Consensus       231 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~l~~l~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~-~~~~~d  309 (520)
                                                  .....+|+...++.   ..++.....+...+.+.+.+.+..+... .....|
T Consensus       200 ----------------------------~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d  248 (479)
T 3tbg_A          200 ----------------------------EVLNAVPVLLHIPA---LAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRD  248 (479)
T ss_dssp             ----------------------------HHHHHSGGGGGSHH---HHHHHTHHHHHHHHHHHHHHHHHHHHCCTTSCCCS
T ss_pred             ----------------------------hhhcccchhccchh---hHHHHHHHHHHHHHHHHHHHHHHHHhhhcccccch
Confidence                                        00023344333332   3444555556666666666666655433 234567


Q ss_pred             hHHHHHHHHHHHhhcccccccccCCCcHHHHHHHHHHHhhhhhhhHHHHHHHHHHHHHhChhHHHHHHHHHHhH------
Q psy4821         310 MLDSYLFEIEKAKMENRSDQLFNGKNHDRQMQQIIGDLFSTGMETIKNTLQWSLVYMMHYPAVAKAVQDELDTV------  383 (520)
Q Consensus       310 ~l~~ll~~~~~~~~~~~~~~~l~~~~~~~ei~~~~~~~l~Ag~dtta~tl~~~l~~L~~~P~v~~klr~Ei~~~------  383 (520)
                      +++.++........+  ....+    +++++.+++.++++||+|||+++++|++++|++||++|+|||+||+.+      
T Consensus       249 ~~~~~~~~~~~~~~~--~~~~l----~~~~i~~~~~~~~~AG~dTta~~l~~~l~~L~~~P~~q~kl~~Ei~~~~~~~~~  322 (479)
T 3tbg_A          249 LTEAFLAEMEKAKGN--PESSF----NDENLRIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRR  322 (479)
T ss_dssp             HHHHHHHHHHHTTTC--TTCSC----SHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHTCSSSC
T ss_pred             hhhhhhhhhhhcccC--Cccch----hhHHHHHHHHHHHHhhhhhhHHHHHHHHHHhccCHHHHHHHHHHHHHHHhhccc
Confidence            888777665543322  22236    999999999999999999999999999999999999999999999976      


Q ss_pred             -------------hHHHhhhccccCccccceeeccccceecCeeeCCCCEEEecccccccCCCCCCCCCCccCCccCCCC
Q psy4821         384 -------------ATILETLRRSSVVALGTIHAVTRDVKFNGFTIPKNTQIVPLLHAVHMDPELWESPEDFRPTRFLTPE  450 (520)
Q Consensus       384 -------------a~i~E~lRl~p~~~~~~~R~~~~d~~l~g~~iP~G~~v~~~~~~~~~d~~~~~~p~~F~PeRfl~~~  450 (520)
                                   |||+|+||+||+++....|.+.+|++++||.|||||.|+++.+++||||++|+||++|+||||++++
T Consensus       323 ~~~~~l~~lpyl~avi~EtlRl~p~~~~~~~~~~~~d~~~~g~~IP~Gt~V~~~~~~~h~d~~~~~dP~~F~PeRfl~~~  402 (479)
T 3tbg_A          323 PEMGDQAHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQ  402 (479)
T ss_dssp             CCHHHHTTCHHHHHHHHHHHHHHCSSTTCCCEECSSCEEETTEEECTTCEEEEEHHHHHTCTTTSSSTTSCCGGGGBCTT
T ss_pred             cchhhhccccccccceeeeccccccccccceeecCCCceECCEEecCCCeeeechhhhcCChhhCCCccccCccccCCCC
Confidence                         9999999999999997777889999999999999999999999999999999999999999999988


Q ss_pred             CCccCCCcccccCCCCCCCcchHHHHHHHHHHHHHHHhhcceecCCCCCCCCCCCCCceeecCCCCCCC
Q psy4821         451 GKVTKPEFFLPFGVGRRMCLGDVLARMELFLFFSTLMHTFGIESPPGQPLPSLKGNAGVTITPDSHKDE  519 (520)
Q Consensus       451 ~~~~~~~~~~~FG~G~r~C~G~~~a~~e~~~~l~~ll~~f~~~~~~~~~~~~~~~~~~~~~~p~~~~~~  519 (520)
                      ++..++..|+|||+|+|.|||++||.+|++++++.||++|+|+++++.+.|......+++..|++++|.
T Consensus       403 ~~~~~~~~~~pFG~G~R~C~G~~lA~~e~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~~~~P~~~~v~  471 (479)
T 3tbg_A          403 GHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGVFAFLVSPSPYELC  471 (479)
T ss_dssp             CCBCCCTTCCTTCCSTTSCTTHHHHHHHHHHHHHHHHHHEEEECCTTSCCCCSCEEESSSEEECCCCBE
T ss_pred             cccCCCCceecCCCCCcCChhHHHHHHHHHHHHHHHHHccEEEeCCCCCCccccccceeeecCCCeEEE
Confidence            777788899999999999999999999999999999999999998887666666667888999998874
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 520
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 4e-58
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 1e-51
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 4e-50
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 3e-47
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 2e-42
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 1e-27
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 4e-22
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 5e-22
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 6e-22
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 3e-19
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 3e-19
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 4e-19
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 5e-19
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 7e-19
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 2e-18
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 5e-17
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 0.001
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 1e-16
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 3e-16
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 5e-15
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 6e-15
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 1e-07
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 2e-14
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 1e-13
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2b4
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]

 Score =  197 bits (502), Expect = 4e-58
 Identities = 130/503 (25%), Positives = 199/503 (39%), Gaps = 71/503 (14%)

Query: 39  LPPGPWGLPIIGYLP-FLKGDAHISFKNLSAKYGSIFSTKLGDQLIVVLSDYRHIREAFR 97
           LPPGP  LP++G L    +     SF  L  KYG +F+  LG + +VVL     IREA  
Sbjct: 3   LPPGPSPLPVLGNLLQMDRKGLLRSFLRLREKYGDVFTVYLGSRPVVVLCGTDAIREALV 62

Query: 98  K--EEFSGRPHTE-LSSILGGYEVNVFLKSLQAQAELCGATGVDVNPLLATSISNVICSI 154
              E FSGR     +  I  GY V                                    
Sbjct: 63  DQAEAFSGRGKIAVVDPIFQGYGV------------------------------------ 86

Query: 155 VMSVRFSNEDPQFKRFMHLIDEGFKLFETMAVVNFLPFVKYLPGLRETRKTLSKVSETLK 214
                      +++          + F            +    L E  +          
Sbjct: 87  -----IFANGERWRALRRFSLATMRDFGMGKRSVEERIQEEARCLVEELRKSKGALLDNT 141

Query: 215 KCSQPNEGFKLFETMAVVNFLPFVKYLPGLRETRKTLSKLFETMAVVNFLPFVKYLPGLR 274
                     +   +    F         L +       L  + +   F  F  +L    
Sbjct: 142 LLFHSITSNIICSIVFGKRFDYKDPVFLRLLDLFFQSFSLISSFSSQVFELFSGFLKHFP 201

Query: 275 ETRKTLSKNRVEMGAYFQEKINEHRTTFDASNIRDMLDSYLFEIEKAKMENRSDQLFNGK 334
            T + + +N  E+  +  + + +HR T D SN RD +D YL  +EK K +  S+      
Sbjct: 202 GTHRQIYRNLQEINTFIGQSVEKHRATLDPSNPRDFIDVYLLRMEKDKSDPSSEF----- 256

Query: 335 NHDRQMQQIIGDLFSTGMETIKNTLQWSLVYMMHYPAVAKAVQDELDTVA---------- 384
            H + +   +  LF  G ET   TL++  + M+ YP V + VQ E++ V           
Sbjct: 257 -HHQNLILTVLSLFFAGTETTSTTLRYGFLLMLKYPHVTERVQKEIEQVIGSHRPPALDD 315

Query: 385 ---------TILETLRRSSVVALGTIHAVTRDVKFNGFTIPKNTQIVPLLHAVHMDPELW 435
                     I E  R   ++  G  H VT+D +F G+ IPKNT++ P+L +   DP  +
Sbjct: 316 RAKMPYTDAVIHEIQRLGDLIPFGVPHTVTKDTQFRGYVIPKNTEVFPVLSSALHDPRYF 375

Query: 436 ESPEDFRPTRFLTPEGKVTKPEFFLPFGVGRRMCLGDVLARMELFLFFSTLMHTFGIESP 495
           E+P  F P  FL   G + + E F+PF +G+R+CLG+ +AR ELFLFF+T++  F I SP
Sbjct: 376 ETPNTFNPGHFLDANGALKRNEGFMPFSLGKRICLGEGIARTELFLFFTTILQNFSIASP 435

Query: 496 -PGQPLPSLKGNAGVTITPDSHK 517
            P + +      +GV   P S++
Sbjct: 436 VPPEDIDLTPRESGVGNVPPSYQ 458
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query520
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 100.0
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 100.0
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 100.0
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 100.0
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 100.0
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 100.0
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 100.0
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 100.0
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 100.0
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 100.0
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 100.0
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 100.0
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 100.0
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 100.0
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 100.0
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 100.0
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 100.0
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 100.0
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Vitamin D 25-hydroxylase Cyp2R1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.3e-63  Score=516.19  Aligned_cols=399  Identities=32%  Similarity=0.578  Sum_probs=316.2

Q ss_pred             CCCCcccccccccccC---CchHHHHHHHHHhhcCCeeEEEecCeeEEEecCHHHHHHHHhhc--cccCCCcchhhhhh-
Q psy4821          40 PPGPWGLPIIGYLPFL---KGDAHISFKNLSAKYGSIFSTKLGDQLIVVLSDYRHIREAFRKE--EFSGRPHTELSSIL-  113 (520)
Q Consensus        40 ppgP~~~p~lG~~~~l---~~~~~~~~~~~~~kyG~i~~~~~g~~~~vvi~dp~~i~~i~~~~--~~~~r~~~~~~~~~-  113 (520)
                      ||||+++|++||++++   ...++.++.++++||||||++++|++++++|+||+++++++.++  .|++++........ 
T Consensus         1 ~PGP~~~P~iG~~~~~~~~~~~~~~~~~~~~~kyG~if~~~~g~~~~vvv~dp~~i~~il~~~~~~f~~r~~~~~~~~~~   80 (463)
T d3czha1           1 PPGPPGLPFIGNIYSLAASSELPHVYMRKQSQVYGEIFSLDLGGISTVVLNGYDVVKECLVHQSEIFADRPCLPLFMKMT   80 (463)
T ss_dssp             CCCCCCBTTTBHHHHHHHCSSCHHHHHHHHHHHHCSEEEEEETTEEEEEEESHHHHHHHHTTTTTTTCBCCCCHHHHHHH
T ss_pred             CcCCCCcCccccHHHhhCCCCcHHHHHHHHHHHhCCEEEEEECCceEEEECCHHHHHHHHHhCccccCCCCchhhhHhhc
Confidence            8999999999999887   34589999999999999999999999999999999999999876  67777655544322 


Q ss_pred             CCchHH------------HHH-----------HHHHHHH-----------HHhCCCCCChhHHHHHHHHHHHHHHHhccc
Q psy4821         114 GGYEVN------------VFL-----------KSLQAQA-----------ELCGATGVDVNPLLATSISNVICSIVMSVR  159 (520)
Q Consensus       114 ~g~~~~------------~~~-----------~~~~~~~-----------~l~~~~~~~l~~~~~~~~~~~i~~~~fg~~  159 (520)
                      .+.++.            +.+           ..++..+           +...++.+|+...+..++.++++.++||..
T Consensus        81 ~~~~~~~~~~g~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~i~~~~~~g~~  160 (463)
T d3czha1          81 KMGGLLNSRYGRGWVDHRRLAVNSFRYFGYGQKSFESKILEETKFFNDAIETYKGRPFDFKQLITNAVSNITNLIIFGER  160 (463)
T ss_dssp             TTCSSTTCCSSHHHHHHHHHHHHHHHHTTTTSTTHHHHHHHHHHHHHHHHHTTTTCCBCCHHHHHHHHHHHHHHHHHSSC
T ss_pred             CCCCceeCCCChHHHHHHHHhhhhhhccchhHHHHHHHHHHHHHHHHHHhhhcCCCceehHHHHHHHHHHHHhhhccCcc
Confidence            222111            000           0011111           124667899999999999999999999999


Q ss_pred             CCCCChHHHHHHHHHHHHhhhhhhchhhcccccccccccchhhhhhhhhhhhhhhccCCCCCchhhhhhhhhhccccccc
Q psy4821         160 FSNEDPQFKRFMHLIDEGFKLFETMAVVNFLPFVKYLPGLRETRKTLSKVSETLKKCSQPNEGFKLFETMAVVNFLPFVK  239 (520)
Q Consensus       160 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  239 (520)
                      ++..+.....................                                                      
T Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~------------------------------------------------------  186 (463)
T d3czha1         161 FTYEDTDFQHMIELFSENVELAASAS------------------------------------------------------  186 (463)
T ss_dssp             CCTTCHHHHHHHHHHHHHHHHTTSHH------------------------------------------------------
T ss_pred             cCccchhhhhHHHHhhhhhhhhcccc------------------------------------------------------
Confidence            98766544333322222211111110                                                      


Q ss_pred             cccchhHHHHHHHHHHhhhhhhcccccccccCCchHHHHHHHHHHHHHHHHHHHHHHHhhhhcCCCCcchhHHHHHHHHH
Q psy4821         240 YLPGLRETRKTLSKLFETMAVVNFLPFVKYLPGLRETRKTLSKNRVEMGAYFQEKINEHRTTFDASNIRDMLDSYLFEIE  319 (520)
Q Consensus       240 ~~~~~~~~~~~~~~~~~~~~~~~~~P~l~~l~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~d~l~~ll~~~~  319 (520)
                                        ......+|++...+..  ..++..+..+.+.++..+.++++++....+...+..+.+.....
T Consensus       187 ------------------~~~~~~~p~l~~~~~~--~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~  246 (463)
T d3czha1         187 ------------------VFLYNAFPWIGILPFG--KHQQLFRNAAVVYDFLSRLIEKASVNRKPQLPQHFVDAYLDEMD  246 (463)
T ss_dssp             ------------------HHHHHHCGGGGGCSSS--HHHHHHHHHHHHHHHHHHHHHHHHTTCCTTCCSSHHHHHHHHHH
T ss_pred             ------------------hhccccccchhhccch--HHHHHHHHHHHHHHHHHHHHHhhhcccccccccchhhhhhhhhh
Confidence                              0011456677666655  67778888889999999988888776554444444444444443


Q ss_pred             HHhhcccccccccCCCcHHHHHHHHHHHhhhhhhhHHHHHHHHHHHHHhChhHHHHHHHHHHhH----------------
Q psy4821         320 KAKMENRSDQLFNGKNHDRQMQQIIGDLFSTGMETIKNTLQWSLVYMMHYPAVAKAVQDELDTV----------------  383 (520)
Q Consensus       320 ~~~~~~~~~~~l~~~~~~~ei~~~~~~~l~Ag~dtta~tl~~~l~~L~~~P~v~~klr~Ei~~~----------------  383 (520)
                      +.....  ...+    +++++.+++.++++||+|||+++++|++++|++||++|+|||+||+.+                
T Consensus       247 ~~~~~~--~~~~----s~~~i~~~~~~~l~ag~~tt~~~l~~~l~~L~~~P~~~~kl~~Ei~~~~~~~~~~~~~~l~~lp  320 (463)
T d3czha1         247 QGKNDP--SSTF----SKENLIFSVGELIIAGTETTTNVLRWAILFMALYPNIQGQVQKEIDLIMGPNGKPSWDDKCKMP  320 (463)
T ss_dssp             HTTTCT--TCCC----CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHTCSSSCCCGGGGGGCH
T ss_pred             hhcccc--cchh----HHHHHHHHHHHHHhhhhccchhhhhhHHHhhccCcHHHHHHHHHHHhhcCCCCCCCHHHHHhhh
Confidence            322211  1135    999999999999999999999999999999999999999999999876                


Q ss_pred             ---hHHHhhhccccCccccceeeccccceecCeeeCCCCEEEecccccccCCCCCCCCCCccCCccCCCCCCccCCCccc
Q psy4821         384 ---ATILETLRRSSVVALGTIHAVTRDVKFNGFTIPKNTQIVPLLHAVHMDPELWESPEDFRPTRFLTPEGKVTKPEFFL  460 (520)
Q Consensus       384 ---a~i~E~lRl~p~~~~~~~R~~~~d~~l~g~~iP~G~~v~~~~~~~~~d~~~~~~p~~F~PeRfl~~~~~~~~~~~~~  460 (520)
                         ||++|++|++|+++....|.+.+|+.++||.|||||.|+++.+++||||++|+||++|+||||++.+++..++..|+
T Consensus       321 ~l~a~~~Et~Rl~~~~~~~~~r~~~~~~~~~g~~ipkG~~v~~~~~~~~~d~~~~~dp~~F~PeRfl~~~~~~~~~~~~~  400 (463)
T d3czha1         321 YTEAVLHEVLRFCNIVPLGIFHATSEDAVVRGYSIPKGTTVITNLYSVHFDEKYWRDPEVFHPERFLDSSGYFAKKEALV  400 (463)
T ss_dssp             HHHHHHHHHHHHHCSSTTCSCEECSSCEEETTEEECTTCEEEEEHHHHHTCTTTCSSTTSCCGGGGBCTTSCBCCCTTCC
T ss_pred             hcccccceeeeeeccccccceecccCCcccCCcEECCCCcccCcHHHhhCCcccCCChhhcCccccCCCccccCCCCcee
Confidence               89999999999999888899999999999999999999999999999999999999999999999887777788999


Q ss_pred             ccCCCCCCCcchHHHHHHHHHHHHHHHhhcceecCCCCCCCCCCCCCceeecCCCCCCC
Q psy4821         461 PFGVGRRMCLGDVLARMELFLFFSTLMHTFGIESPPGQPLPSLKGNAGVTITPDSHKDE  519 (520)
Q Consensus       461 ~FG~G~r~C~G~~~a~~e~~~~l~~ll~~f~~~~~~~~~~~~~~~~~~~~~~p~~~~~~  519 (520)
                      |||+|+|.|||++||.+|+++++++||++|+|+++++. .|++....++++.|+++++.
T Consensus       401 ~FG~G~r~C~G~~~A~~~~~~~la~ll~~f~~~~~~~~-~~~~~~~~~~~~~p~~~~v~  458 (463)
T d3czha1         401 PFSLGRRHCLGEHLARMEMFLFFTALLQRFHLHFPHEL-VPDLKPRLGMTLQPQPYLIC  458 (463)
T ss_dssp             TTCCSTTCCTTHHHHHHHHHHHHHHHHHHEEEECGGGC-CCCCCCCSSSSCCCCCCCBE
T ss_pred             CCCCCCcCCchHHHHHHHHHHHHHHHHHhcEEEeCCCC-CCCceeccCeEEeccCcEEE
Confidence            99999999999999999999999999999999997654 46788888999999988763
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure