Psyllid ID: psy5095
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 192 | 2.2.26 [Sep-21-2011] | |||||||
| Q80LP4 | 337 | Viral cathepsin OS=Adoxop | N/A | N/A | 0.854 | 0.486 | 0.394 | 1e-27 | |
| Q6VTL7 | 324 | Viral cathepsin OS=Choris | N/A | N/A | 0.864 | 0.512 | 0.389 | 3e-27 | |
| Q8QLK1 | 337 | Viral cathepsin OS=Mamest | N/A | N/A | 0.859 | 0.489 | 0.373 | 3e-27 | |
| Q8V5U0 | 367 | Viral cathepsin OS=Heliot | N/A | N/A | 0.854 | 0.446 | 0.36 | 5e-27 | |
| Q91BH1 | 337 | Viral cathepsin OS=Spodop | N/A | N/A | 0.854 | 0.486 | 0.382 | 6e-27 | |
| Q9J8B9 | 337 | Viral cathepsin OS=Spodop | N/A | N/A | 0.854 | 0.486 | 0.371 | 1e-26 | |
| Q91CL9 | 324 | Viral cathepsin OS=Anther | N/A | N/A | 0.864 | 0.512 | 0.378 | 2e-26 | |
| P41715 | 324 | Viral cathepsin OS=Choris | N/A | N/A | 0.854 | 0.506 | 0.363 | 3e-26 | |
| P41721 | 323 | Viral cathepsin OS=Bombyx | N/A | N/A | 0.843 | 0.501 | 0.355 | 7e-26 | |
| P25783 | 323 | Viral cathepsin OS=Autogr | N/A | N/A | 0.864 | 0.513 | 0.350 | 1e-25 |
| >sp|Q80LP4|CATV_NPVAH Viral cathepsin OS=Adoxophyes honmai nucleopolyhedrovirus GN=VCATH PE=3 SV=1 | Back alignment and function desciption |
|---|
Score = 123 bits (308), Expect = 1e-27, Method: Compositional matrix adjust.
Identities = 69/175 (39%), Positives = 99/175 (56%), Gaps = 11/175 (6%)
Query: 2 LESQYAIKHGTLLPLSKSQLIECNIYNQGCQGGGFNKAIQYLKHAG-LEAEADYPFRNQN 60
LE+ YAIKH L+ LS+ QLI+C+ N C GG + A + L +AG L E DYP++
Sbjct: 159 LETLYAIKHNYLINLSEQQLIDCDSANMACDGGLMHTAFEQLMNAGGLMEEIDYPYQ--- 215
Query: 61 GVTGRCAYDARKVKVRVSDF--LVFNGSDTFRRMLYHYGPLVAGMNGALLQDYNGKLIRK 118
G G C D +K + VS +F + ++ L GP+ ++ A + Y+ +I
Sbjct: 216 GTKGVCKIDNKKFALSVSSCKRYIFQNEENLKKELITMGPIAMAIDAASISTYSKGIIH- 274
Query: 119 NDVCPSENLNHAVVIVGYGMRHQVPVWIVRNSWGR-WGPDDGYFTVERGTNACGI 172
C + LNHAV++VGYG V W ++NSWG WG +DGYF V+R NACG+
Sbjct: 275 --FCENLGLNHAVLLVGYGTEGGVSYWTLKNSWGSDWG-EDGYFRVKRNINACGL 326
|
Cysteine protease that plays an essential role in host liquefaction to facilitate horizontal transmission of the virus. May participate in the degradation of foreign protein expressed by the baculovirus system. Adoxophyes honmai (taxid: 85585) EC: 3EC: .EC: 4EC: .EC: 2EC: 2EC: .EC: 5EC: 0 |
| >sp|Q6VTL7|CATV_NPVCD Viral cathepsin OS=Choristoneura fumiferana defective polyhedrosis virus GN=Vcath PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q8QLK1|CATV_NPVMC Viral cathepsin OS=Mamestra configurata nucleopolyhedrovirus GN=VCATH PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q8V5U0|CATV_NPVHZ Viral cathepsin OS=Heliothis zea nuclear polyhedrosis virus GN=VCATH PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q91BH1|CATV_NPVST Viral cathepsin OS=Spodoptera litura multicapsid nucleopolyhedrovirus GN=VCATH PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q9J8B9|CATV_NPVSE Viral cathepsin OS=Spodoptera exigua nuclear polyhedrosis virus (strain US) GN=VCATH PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q91CL9|CATV_NPVAP Viral cathepsin OS=Antheraea pernyi nuclear polyhedrosis virus GN=VCATH PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P41715|CATV_NPVCF Viral cathepsin OS=Choristoneura fumiferana nuclear polyhedrosis virus GN=Vcath PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P41721|CATV_NPVBM Viral cathepsin OS=Bombyx mori nuclear polyhedrosis virus GN=VCATH PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P25783|CATV_NPVAC Viral cathepsin OS=Autographa californica nuclear polyhedrosis virus GN=VCATH PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 192 | ||||||
| 340503366 | 1095 | hypothetical protein IMG5_145110 [Ichthy | 0.895 | 0.157 | 0.387 | 2e-28 | |
| 118395092 | 344 | Papain family cysteine protease containi | 0.901 | 0.502 | 0.377 | 1e-27 | |
| 114679921 | 359 | cathepsin [Leucania separata nuclear pol | 0.854 | 0.456 | 0.388 | 1e-26 | |
| 37732137 | 322 | cysteine proteinase [Anthonomus grandis] | 0.854 | 0.509 | 0.383 | 4e-26 | |
| 29567137 | 337 | cathepsin [Adoxophyes honmai NPV] gi|370 | 0.854 | 0.486 | 0.394 | 5e-26 | |
| 209978824 | 337 | cathepsin [Adoxophyes orana nucleopolyhe | 0.854 | 0.486 | 0.394 | 6e-26 | |
| 12597541 | 365 | cathepsin [Helicoverpa armigera nucleopo | 0.854 | 0.449 | 0.365 | 7e-26 | |
| 90592736 | 343 | VCATH [Agrotis segetum nucleopolyhedrovi | 0.859 | 0.481 | 0.379 | 8e-26 | |
| 156389068 | 276 | predicted protein [Nematostella vectensi | 0.911 | 0.634 | 0.360 | 8e-26 | |
| 344310882 | 367 | cathepsin-like cysteine proteinase [Heli | 0.854 | 0.446 | 0.365 | 1e-25 |
| >gi|340503366|gb|EGR29962.1| hypothetical protein IMG5_145110 [Ichthyophthirius multifiliis] | Back alignment and taxonomy information |
|---|
Score = 130 bits (328), Expect = 2e-28, Method: Composition-based stats.
Identities = 71/183 (38%), Positives = 110/183 (60%), Gaps = 11/183 (6%)
Query: 1 MLESQYAIKHGTLLPLSKSQLIECNIYNQGCQGGGFNKAIQYLKHA-GLEAEADY-PFRN 58
++ESQYAIKH L+P S+ QL++C+ N GC GG A +YL+ + GLE DY ++N
Sbjct: 915 VIESQYAIKHQKLVPFSEQQLVDCDDINDGCHGGLMTDAYKYLQQSGGLEFAEDYGDYKN 974
Query: 59 QNGVTGRCAYDARKVKVRVSDFLVFN-GSDTFRRMLYHYGPLVAGMNGALLQDYNGKLIR 117
+ +C +D KV+ ++ ++ + + ++ LY GP+ AG+N LLQ Y +
Sbjct: 975 KK---EKCKFDLNKVQAKIKEWQQIDEDEEIIKKQLYQNGPIAAGVNARLLQFYKSGIFD 1031
Query: 118 KNDVCPSENLNHAVVIVGYGM-RHQVPVWIVRNSWGR-WGPDDGYFTVERGTNACGIESY 175
+ C S+ +NHA++IVGYG+ + WI++N WG+ WG DGYF + RG CGI +Y
Sbjct: 1032 PKE-CDSD-INHAILIVGYGVEKDGQKYWIIKNQWGKDWGM-DGYFKLARGKKQCGIHTY 1088
Query: 176 GGI 178
I
Sbjct: 1089 ASI 1091
|
Source: Ichthyophthirius multifiliis Species: Ichthyophthirius multifiliis Genus: Ichthyophthirius Family: Order: Hymenostomatida Class: Oligohymenophorea Phylum: Superkingdom: Eukaryota |
| >gi|118395092|ref|XP_001029901.1| Papain family cysteine protease containing protein [Tetrahymena thermophila] gi|89284178|gb|EAR82238.1| Papain family cysteine protease containing protein [Tetrahymena thermophila SB210] | Back alignment and taxonomy information |
|---|
| >gi|114679921|ref|YP_758371.1| cathepsin [Leucania separata nuclear polyhedrosis virus] gi|39598652|gb|AAR28838.1| cathepsin [Leucania separata nuclear polyhedrosis virus] | Back alignment and taxonomy information |
|---|
| >gi|37732137|gb|AAR02406.1| cysteine proteinase [Anthonomus grandis] | Back alignment and taxonomy information |
|---|
| >gi|29567137|ref|NP_818699.1| cathepsin [Adoxophyes honmai NPV] gi|37076951|sp|Q80LP4.1|CATV_NPVAH RecName: Full=Viral cathepsin; Short=V-cath; AltName: Full=Cysteine proteinase; Short=CP; Flags: Precursor gi|29467913|dbj|BAC67303.1| cathepsin [Adoxophyes honmai NPV] | Back alignment and taxonomy information |
|---|
| >gi|209978824|ref|YP_002300567.1| cathepsin [Adoxophyes orana nucleopolyhedrovirus] gi|192758806|gb|ACF05341.1| cathepsin [Adoxophyes orana nucleopolyhedrovirus] | Back alignment and taxonomy information |
|---|
| >gi|12597541|ref|NP_075125.1| cathepsin [Helicoverpa armigera nucleopolyhedrovirus G4] gi|15426394|ref|NP_203611.1| cathepsin [Helicoverpa armigera NPV] gi|12483807|gb|AAG53799.1|AF271059_56 cathepsin [Helicoverpa armigera nucleopolyhedrovirus G4] gi|15384470|gb|AAK96381.1|AF303045_123 cathepsin [Helicoverpa armigera NPV] gi|18027090|gb|AAL55725.1|AF268612_1 cathepsin [Helicoverpa armigera NPV] | Back alignment and taxonomy information |
|---|
| >gi|90592736|ref|YP_529689.1| VCATH [Agrotis segetum nucleopolyhedrovirus] gi|71559186|gb|AAZ38185.1| VCATH [Agrotis segetum nucleopolyhedrovirus] | Back alignment and taxonomy information |
|---|
| >gi|156389068|ref|XP_001634814.1| predicted protein [Nematostella vectensis] gi|156221901|gb|EDO42751.1| predicted protein [Nematostella vectensis] | Back alignment and taxonomy information |
|---|
| >gi|344310882|gb|AEN03980.1| cathepsin-like cysteine proteinase [Helicoverpa armigera NPV strain Australia] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 192 | ||||||
| UNIPROTKB|F1RU23 | 367 | CTSW "Uncharacterized protein" | 0.890 | 0.465 | 0.357 | 5.9e-25 | |
| TAIR|locus:2082687 | 367 | AT3G54940 [Arabidopsis thalian | 0.869 | 0.455 | 0.356 | 5.9e-25 | |
| UNIPROTKB|F1RWA9 | 194 | CTSO "Uncharacterized protein" | 0.859 | 0.850 | 0.382 | 7.6e-25 | |
| UNIPROTKB|F1RU48 | 460 | CTSF "Uncharacterized protein" | 0.869 | 0.363 | 0.348 | 7.9e-25 | |
| ZFIN|ZDB-GENE-080724-8 | 334 | ctso "cathepsin O" [Danio reri | 0.875 | 0.502 | 0.388 | 9.7e-25 | |
| FB|FBgn0260462 | 614 | CG12163 [Drosophila melanogast | 0.869 | 0.271 | 0.351 | 1.2e-24 | |
| UNIPROTKB|F6X9C1 | 305 | CTSH "Uncharacterized protein" | 0.859 | 0.540 | 0.370 | 1.2e-24 | |
| UNIPROTKB|P43234 | 321 | CTSO "Cathepsin O" [Homo sapie | 0.859 | 0.514 | 0.387 | 1.2e-24 | |
| UNIPROTKB|F1P0K2 | 320 | CTSO "Uncharacterized protein" | 0.859 | 0.515 | 0.382 | 2e-24 | |
| UNIPROTKB|F1PGK4 | 316 | CTSO "Uncharacterized protein" | 0.875 | 0.531 | 0.377 | 2e-24 |
| UNIPROTKB|F1RU23 CTSW "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Score = 284 (105.0 bits), Expect = 5.9e-25, P = 5.9e-25
Identities = 68/190 (35%), Positives = 103/190 (54%)
Query: 2 LESQYAIKHGTLLPLSKSQLIECNIYNQGCQGGG-FNKAIQYLKHAGLEAEADYPFRNQN 60
+E+Q+AIK+ + LS Q+++C+ GC GG ++ + L +GL +E DYP++
Sbjct: 162 VEAQWAIKYHQAVQLSVQQVLDCDRCGNGCNGGFVWDAFLTVLNTSGLASEQDYPYKG-T 220
Query: 61 GVTGRC-AYDARKVKVRVSDFLVFNGSD-TFRRMLYHYGPLVAGMNGALLQDYNGKLIRK 118
T RC A RKV + DFL+ + + R L GP+ +N LLQ Y +IR
Sbjct: 221 VKTHRCLAKQHRKV-AWIQDFLMLQFCEQSIARYLATEGPITVTINAGLLQQYKRGVIRA 279
Query: 119 NDV-CPSENLNHAVVIVGYGMR-----------HQVPVWIVRNSWGR-WGPDDGYFTVER 165
C +NH+V++VG+G H +P WI++NSWG WG ++GYF + R
Sbjct: 280 TPATCDPHLVNHSVLLVGFGKSKSVEGRRPRPGHSIPYWILKNSWGPDWG-EEGYFRLHR 338
Query: 166 GTNACGIESY 175
G+N CGI Y
Sbjct: 339 GSNTCGITKY 348
|
|
| TAIR|locus:2082687 AT3G54940 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RWA9 CTSO "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RU48 CTSF "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-080724-8 ctso "cathepsin O" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0260462 CG12163 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6X9C1 CTSH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P43234 CTSO "Cathepsin O" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P0K2 CTSO "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PGK4 CTSO "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 192 | |||
| cd02248 | 210 | cd02248, Peptidase_C1A, Peptidase C1A subfamily (M | 8e-51 | |
| pfam00112 | 213 | pfam00112, Peptidase_C1, Papain family cysteine pr | 3e-46 | |
| smart00645 | 175 | smart00645, Pept_C1, Papain family cysteine protea | 2e-31 | |
| PTZ00200 | 448 | PTZ00200, PTZ00200, cysteine proteinase; Provision | 1e-28 | |
| PTZ00203 | 348 | PTZ00203, PTZ00203, cathepsin L protease; Provisio | 8e-25 | |
| cd02621 | 243 | cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; al | 2e-24 | |
| cd02620 | 236 | cd02620, Peptidase_C1A_CathepsinB, Cathepsin B gro | 9e-20 | |
| PTZ00021 | 489 | PTZ00021, PTZ00021, falcipain-2; Provisional | 1e-16 | |
| cd02619 | 223 | cd02619, Peptidase_C1, C1 Peptidase family (MEROPS | 4e-14 | |
| PTZ00364 | 548 | PTZ00364, PTZ00364, dipeptidyl-peptidase I precurs | 2e-12 | |
| cd02698 | 239 | cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; th | 5e-12 | |
| PTZ00049 | 693 | PTZ00049, PTZ00049, cathepsin C-like protein; Prov | 9e-10 | |
| PTZ00462 | 1004 | PTZ00462, PTZ00462, Serine-repeat antigen protein; | 1e-07 | |
| COG4870 | 372 | COG4870, COG4870, Cysteine protease [Posttranslati | 3e-05 |
| >gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
Score = 162 bits (412), Expect = 8e-51
Identities = 71/181 (39%), Positives = 105/181 (58%), Gaps = 10/181 (5%)
Query: 1 MLESQYAIKHGTLLPLSKSQLIEC-NIYNQGCQGGGFNKAIQYLKHAGLEAEADYPFRNQ 59
LE YAIK G L+ LS+ QL++C N GC GG + A +Y+K+ GL +E+DYP+
Sbjct: 32 ALEGAYAIKTGKLVSLSEQQLVDCSTSGNNGCNGGNPDNAFEYVKNGGLASESDYPY--- 88
Query: 60 NGVTGRCAYDARKVKVRVSDF--LVFNGSDTFRRMLYHYGPLVAGMNGAL-LQDYNGKLI 116
G G C Y++ KV +++ + + + + L +YGP+ ++ + Q Y G +
Sbjct: 89 TGKDGTCKYNSSKVGAKITGYSNVPPGDEEALKAALANYGPVSVAIDASSSFQFYKGGIY 148
Query: 117 RKNDVCPSENLNHAVVIVGYGMRHQVPVWIVRNSWG-RWGPDDGYFTVERGTNACGIESY 175
C + NLNHAV++VGYG + V WIV+NSWG WG + GY + RG+N CGI SY
Sbjct: 149 -SGPCCSNTNLNHAVLLVGYGTENGVDYWIVKNSWGTSWG-EKGYIRIARGSNLCGIASY 206
Query: 176 G 176
Sbjct: 207 A 207
|
Papain is an endopeptidase with specific substrate preferences, primarily for bulky hydrophobic or aromatic residues at the S2 subsite, a hydrophobic pocket in papain that accommodates the P2 sidechain of the substrate (the second residue away from the scissile bond). Most members of the papain subfamily are endopeptidases. Some exceptions to this rule can be explained by specific details of the catalytic domains like the occluding loop in cathepsin B which confers an additional carboxydipeptidyl activity and the mini-chain of cathepsin H resulting in an N-terminal exopeptidase activity. Papain-like CPs have different functions in various organisms. Plant CPs are used to mobilize storage proteins in seeds. Parasitic CPs act extracellularly to help invade tissues and cells, to hatch or to evade the host immune system. Mammalian CPs are primarily lysosomal enzymes with the exception of cathepsin W, which is retained in the endoplasmic reticulum. They are responsible for protein degradation in the lysosome. Papain-like CPs are synthesized as inactive proenzymes with N-terminal propeptide regions, which are removed upon activation. In addition to its inhibitory role, the propeptide is required for proper folding of the newly synthesized enzyme and its stabilization in denaturing pH conditions. Residues within the propeptide region also play a role in the transport of the proenzyme to lysosomes or acidified vesicles. Also included in this subfamily are proteins classified as non-peptidase homologs, which lack peptidase activity or have missing active site residues. Length = 210 |
| >gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|240310 PTZ00200, PTZ00200, cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185513 PTZ00203, PTZ00203, cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239112 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >gnl|CDD|239111 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239110 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|240381 PTZ00364, PTZ00364, dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239149 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >gnl|CDD|240244 PTZ00049, PTZ00049, cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185641 PTZ00462, PTZ00462, Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227207 COG4870, COG4870, Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 192 | |||
| KOG1542|consensus | 372 | 100.0 | ||
| PTZ00203 | 348 | cathepsin L protease; Provisional | 100.0 | |
| cd02621 | 243 | Peptidase_C1A_CathepsinC Cathepsin C; also known a | 100.0 | |
| cd02698 | 239 | Peptidase_C1A_CathepsinX Cathepsin X; the only pap | 100.0 | |
| cd02620 | 236 | Peptidase_C1A_CathepsinB Cathepsin B group; compos | 100.0 | |
| cd02248 | 210 | Peptidase_C1A Peptidase C1A subfamily (MEROPS data | 100.0 | |
| KOG1543|consensus | 325 | 100.0 | ||
| PTZ00021 | 489 | falcipain-2; Provisional | 100.0 | |
| PTZ00364 | 548 | dipeptidyl-peptidase I precursor; Provisional | 100.0 | |
| PTZ00200 | 448 | cysteine proteinase; Provisional | 100.0 | |
| PF00112 | 219 | Peptidase_C1: Papain family cysteine protease This | 100.0 | |
| PTZ00049 | 693 | cathepsin C-like protein; Provisional | 100.0 | |
| PTZ00462 | 1004 | Serine-repeat antigen protein; Provisional | 100.0 | |
| cd02619 | 223 | Peptidase_C1 C1 Peptidase family (MEROPS database | 100.0 | |
| smart00645 | 174 | Pept_C1 Papain family cysteine protease. | 100.0 | |
| KOG1544|consensus | 470 | 100.0 | ||
| COG4870 | 372 | Cysteine protease [Posttranslational modification, | 99.78 | |
| cd00585 | 437 | Peptidase_C1B Peptidase C1B subfamily (MEROPS data | 99.76 | |
| PF03051 | 438 | Peptidase_C1_2: Peptidase C1-like family This fami | 99.19 | |
| COG3579 | 444 | PepC Aminopeptidase C [Amino acid transport and me | 98.05 | |
| PF13529 | 144 | Peptidase_C39_2: Peptidase_C39 like family; PDB: 3 | 96.65 | |
| PF05543 | 175 | Peptidase_C47: Staphopain peptidase C47; InterPro: | 92.46 | |
| PF09778 | 212 | Guanylate_cyc_2: Guanylylate cyclase; InterPro: IP | 92.24 | |
| PF14399 | 317 | Transpep_BrtH: NlpC/p60-like transpeptidase | 91.49 | |
| KOG4128|consensus | 457 | 85.5 | ||
| COG4990 | 195 | Uncharacterized protein conserved in bacteria [Fun | 85.07 | |
| cd00044 | 315 | CysPc Calpains, domains IIa, IIb; calcium-dependen | 82.35 | |
| PF12385 | 166 | Peptidase_C70: Papain-like cysteine protease AvrRp | 80.86 |
| >KOG1542|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=5e-55 Score=355.89 Aligned_cols=177 Identities=38% Similarity=0.795 Sum_probs=167.1
Q ss_pred CchhhHHHHhCCCCCCCHHHHhhhcCCCCCCCCCCHHHHHHHHH-HcCcccCcccccccCCCCCC-CccccCCCceeEec
Q psy5095 1 MLESQYAIKHGTLLPLSKSQLIECNIYNQGCQGGGFNKAIQYLK-HAGLEAEADYPFRNQNGVTG-RCAYDARKVKVRVS 78 (192)
Q Consensus 1 a~E~~~~i~~~~~~~lS~Q~l~dC~~~~~gC~GG~~~~a~~~~~-~~Gi~~e~~yPY~~~~~~~~-~C~~~~~~~~~~i~ 78 (192)
++|++++|++|++++||||||+||+..+.||+||.+..||+|++ ..|+..|++|||++ ..+ .|........+.|+
T Consensus 189 ~vEga~~i~~g~LvsLSEQeLvDCD~~d~gC~GGl~~nA~~~~~~~gGL~~E~dYPY~g---~~~~~C~~~~~~~~v~I~ 265 (372)
T KOG1542|consen 189 AVEGAWAIATGKLVSLSEQELVDCDSCDNGCNGGLMDNAFKYIKKAGGLEKEKDYPYTG---KKGNQCHFDKSKIVVSIK 265 (372)
T ss_pred hhhhHHHhhcCcccccchhhhhcccCcCCcCCCCChhHHHHHHHHhCCccccccCCccc---cCCCccccchhhceEEEe
Confidence 68999999999999999999999999999999999999999955 89999999999999 666 89999999999999
Q ss_pred ceEEeC-ChHHHHHHHHhcCCEEEEEeCCcccCCCCceEeCC-CCCCCCCCCeEEEEEEEeecC-CccEEEEEcCCCCCC
Q psy5095 79 DFLVFN-GSDTFRRMLYHYGPLVAGMNGALLQDYNGKLIRKN-DVCPSENLNHAVVIVGYGMRH-QVPVWIVRNSWGRWG 155 (192)
Q Consensus 79 ~~~~i~-~~~~ik~~l~~~gPv~~~~~~~~f~~y~~Giy~~~-~~~~~~~~~Hav~iVGyg~~~-g~~ywivkNSWG~~W 155 (192)
+|..++ ||++|.+.|.++|||+|+|++..+|+|.+||..+. ..|++..++|+|+|||||... .++|||||||||++|
T Consensus 266 ~f~~l~~nE~~ia~wLv~~GPi~vgiNa~~mQ~YrgGV~~P~~~~Cs~~~~~HaVLlvGyG~~g~~~PYWIVKNSWG~~W 345 (372)
T KOG1542|consen 266 DFSMLSNNEDQIAAWLVTFGPLSVGINAKPMQFYRGGVSCPSKYICSPKLLNHAVLLVGYGSSGYEKPYWIVKNSWGTSW 345 (372)
T ss_pred ccEecCCCHHHHHHHHHhcCCeEEEEchHHHHHhcccccCCCcccCCccccCceEEEEeecCCCCCCceEEEECCccccc
Confidence 999999 99999999999999999999999999999999874 579988899999999999887 899999999999999
Q ss_pred CCCcEEEEEeCCCcccccceeeEEE
Q psy5095 156 PDDGYFTVERGTNACGIESYGGICT 180 (192)
Q Consensus 156 G~~Gy~~i~~~~n~cgi~~~~~~~~ 180 (192)
|++||+|+.||.|.|||++.++.+.
T Consensus 346 GE~GY~~l~RG~N~CGi~~mvss~~ 370 (372)
T KOG1542|consen 346 GEKGYYKLCRGSNACGIADMVSSAA 370 (372)
T ss_pred cccceEEEeccccccccccchhhhh
Confidence 9999999999999999999887654
|
|
| >PTZ00203 cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >cd02621 Peptidase_C1A_CathepsinC Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >cd02698 Peptidase_C1A_CathepsinX Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >cd02620 Peptidase_C1A_CathepsinB Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >cd02248 Peptidase_C1A Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >KOG1543|consensus | Back alignment and domain information |
|---|
| >PTZ00021 falcipain-2; Provisional | Back alignment and domain information |
|---|
| >PTZ00364 dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >PTZ00200 cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >PF00112 Peptidase_C1: Papain family cysteine protease This is family C1 in the peptidase classification | Back alignment and domain information |
|---|
| >PTZ00049 cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00462 Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
| >cd02619 Peptidase_C1 C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >smart00645 Pept_C1 Papain family cysteine protease | Back alignment and domain information |
|---|
| >KOG1544|consensus | Back alignment and domain information |
|---|
| >COG4870 Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00585 Peptidase_C1B Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC) | Back alignment and domain information |
|---|
| >PF03051 Peptidase_C1_2: Peptidase C1-like family This family is a subfamily of the Prosite entry; InterPro: IPR004134 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >COG3579 PepC Aminopeptidase C [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13529 Peptidase_C39_2: Peptidase_C39 like family; PDB: 3ERV_A | Back alignment and domain information |
|---|
| >PF05543 Peptidase_C47: Staphopain peptidase C47; InterPro: IPR008750 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF09778 Guanylate_cyc_2: Guanylylate cyclase; InterPro: IPR018616 Members of this family of proteins catalyse the conversion of guanosine triphosphate (GTP) to 3',5'-cyclic guanosine monophosphate (cGMP) and pyrophosphate | Back alignment and domain information |
|---|
| >PF14399 Transpep_BrtH: NlpC/p60-like transpeptidase | Back alignment and domain information |
|---|
| >KOG4128|consensus | Back alignment and domain information |
|---|
| >COG4990 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >cd00044 CysPc Calpains, domains IIa, IIb; calcium-dependent cytoplasmic cysteine proteinases, papain-like | Back alignment and domain information |
|---|
| >PF12385 Peptidase_C70: Papain-like cysteine protease AvrRpt2; InterPro: IPR022118 This is a family of cysteine proteases, found in actinobacteria, protobacteria and firmicutes | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 192 | ||||
| 2p7u_A | 215 | The Crystal Structure Of Rhodesain, The Major Cyste | 9e-23 | ||
| 8pch_A | 220 | Crystal Structure Of Porcine Cathepsin H Determined | 3e-21 | ||
| 1mem_A | 215 | Crystal Structure Of Cathepsin K Complexed With A P | 4e-20 | ||
| 1u9v_A | 217 | Crystal Structure Of The Cysteine Protease Human Ca | 5e-20 | ||
| 3ovz_A | 213 | Cathepsin K In Complex With A Covalent Inhibitor Wi | 5e-20 | ||
| 1snk_A | 214 | Cathepsin K Complexed With Carbamate Derivatized No | 5e-20 | ||
| 2f7d_A | 215 | A Mutant Rabbit Cathepsin K With A Nitrile Inhibito | 7e-20 | ||
| 7pck_A | 314 | Crystal Structure Of Wild Type Human Procathepsin K | 7e-20 | ||
| 3qj3_A | 331 | Structure Of Digestive Procathepsin L2 Proteinase F | 2e-19 | ||
| 1m6d_A | 214 | Crystal Structure Of Human Cathepsin F Length = 214 | 3e-19 | ||
| 3h7d_A | 215 | The Crystal Structure Of The Cathepsin K Variant M5 | 4e-19 | ||
| 2o6x_A | 310 | Crystal Structure Of Procathepsin L1 From Fasciola | 3e-18 | ||
| 2f1g_A | 220 | Cathepsin S In Complex With Non-Covalent 2-(Benzoxa | 5e-18 | ||
| 3mpe_A | 220 | Crystal Structure Of Human Cathepsin-S C25s Mutant | 5e-18 | ||
| 3kwn_A | 219 | Cathepsin S In Complex With Thioether Acetamide P3 | 5e-18 | ||
| 3iej_A | 222 | Pyrazole-Based Cathepsin S Inhibitors With Arylalky | 5e-18 | ||
| 3ovx_A | 218 | Cathepsin S In Complex With A Covalent Inhibitor Wi | 5e-18 | ||
| 3n3g_A | 217 | 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitri | 6e-18 | ||
| 2fq9_A | 225 | Cathepsin S With Nitrile Inhibitor Length = 225 | 6e-18 | ||
| 1ms6_A | 222 | Dipeptide Nitrile Inhibitor Bound To Cathepsin S. L | 6e-18 | ||
| 1npz_A | 217 | Crystal Structures Of Cathepsin S Inhibitor Complex | 6e-18 | ||
| 2c0y_A | 315 | The Crystal Structure Of A Cys25ala Mutant Of Human | 6e-18 | ||
| 1glo_A | 217 | Crystal Structure Of Cys25ser Mutant Of Human Cathe | 9e-18 | ||
| 2pns_A | 208 | 1.9 Angstrom Resolution Crystal Structure Of A Plan | 1e-17 | ||
| 2fye_A | 217 | Mutant Human Cathepsin S With Irreversible Inhibito | 1e-17 | ||
| 2g6d_A | 217 | Human Cathepsin S Mutant With Vinyl Sulfone Inhibit | 1e-17 | ||
| 3bcn_A | 209 | Crystal Structure Of A Papain-Like Cysteine Proteas | 2e-17 | ||
| 1ewp_A | 215 | Cruzain Bound To Mor-Leu-Hpq Length = 215 | 2e-17 | ||
| 3qt4_A | 329 | Structure Of Digestive Procathepsin L 3 Of Tenebrio | 2e-17 | ||
| 1aim_A | 215 | Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluor | 3e-17 | ||
| 1vsn_A | 215 | Crystal Structure Of A Potent Small Molecule Inhibi | 4e-17 | ||
| 3iut_A | 221 | The Crystal Structure Of Cruzain In Complex With A | 8e-17 | ||
| 3hd3_A | 215 | High Resolution Crystal Structure Of Cruzain Bound | 8e-17 | ||
| 2b1m_A | 246 | Crystal Structure Of A Papain-Fold Protein Without | 9e-17 | ||
| 1cqd_A | 221 | The 2.1 Angstrom Structure Of A Cysteine Protease W | 1e-16 | ||
| 1o0e_A | 208 | 1.9 Angstrom Crystal Structure Of A Plant Cysteine | 2e-16 | ||
| 1iwd_A | 215 | Proposed Amino Acid Sequence And The 1.63 Angstrom | 6e-16 | ||
| 3h6s_A | 221 | Strucure Of Clitocypin - Cathepsin V Complex Length | 8e-16 | ||
| 1fh0_A | 221 | Crystal Structure Of Human Cathepsin V Complexed Wi | 8e-16 | ||
| 2fo5_A | 262 | Crystal Structure Of Recombinant Barley Cysteine En | 2e-14 | ||
| 3pdf_A | 441 | Discovery Of Novel Cyanamide-Based Inhibitors Of Ca | 9e-14 | ||
| 3u8e_A | 222 | Crystal Structure Of Cysteine Protease From Bulbs O | 1e-13 | ||
| 1s4v_A | 229 | The 2.0 A Crystal Structure Of The Kdel-Tailed Cyst | 2e-13 | ||
| 2act_A | 220 | Crystallographic Refinement Of The Structure Of Act | 3e-13 | ||
| 1yvb_A | 241 | The Plasmodium Falciparum Cysteine Protease Falcipa | 5e-13 | ||
| 3pnr_A | 240 | Structure Of Pbicp-C In Complex With Falcipain-2 Le | 5e-13 | ||
| 3p5u_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 1e-12 | ||
| 3p5w_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 1e-12 | ||
| 3bc3_A | 220 | Exploring Inhibitor Binding At The S Subsites Of Ca | 1e-12 | ||
| 2nqd_B | 221 | Crystal Structure Of Cysteine Protease Inhibitor, C | 1e-12 | ||
| 3of8_A | 221 | Structural Basis For Reversible And Irreversible In | 1e-12 | ||
| 3iv2_A | 220 | Crystal Structure Of Mature Apo-Cathepsin L C25a Mu | 1e-12 | ||
| 3h89_A | 220 | A Combined Crystallographic And Molecular Dynamics | 1e-12 | ||
| 3kse_A | 220 | Unreduced Cathepsin L In Complex With Stefin A Leng | 1e-12 | ||
| 3hwn_A | 258 | Cathepsin L With Az13010160 Length = 258 | 1e-12 | ||
| 3hha_A | 220 | Crystal Structure Of Cathepsin L In Complex With Az | 2e-12 | ||
| 1cs8_A | 316 | Crystal Structure Of Procathepsin L Length = 316 | 2e-12 | ||
| 1cjl_A | 312 | Crystal Structure Of A Cysteine Protease Proform Le | 2e-12 | ||
| 1aec_A | 218 | Crystal Structure Of Actinidin-E-64 Complex+ Length | 7e-12 | ||
| 3d6s_A | 223 | Crystal Structure Of Mite Allergen Der F 1 Length = | 2e-11 | ||
| 3bpm_A | 243 | Crystal Structure Of Falcipain-3 With Its Inhibitor | 4e-11 | ||
| 3hhi_A | 325 | Crystal Structure Of Cathepsin B From T. Brucei In | 6e-11 | ||
| 3mor_A | 317 | Crystal Structure Of Cathepsin B From Trypanosoma B | 7e-11 | ||
| 2vhs_A | 217 | Cathsilicatein, A Chimera Length = 217 | 7e-11 | ||
| 2bdz_A | 214 | Mexicain From Jacaratia Mexicana Length = 214 | 8e-11 | ||
| 4hwy_A | 340 | Trypanosoma Brucei Procathepsin B Solved From 40 Fs | 8e-11 | ||
| 1jqp_A | 438 | Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric | 2e-10 | ||
| 1yal_A | 218 | Carica Papaya Chymopapain At 1.7 Angstroms Resoluti | 8e-10 | ||
| 3f75_A | 224 | Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In | 9e-10 | ||
| 1mhw_A | 175 | Design Of Non-covalent Inhibitors Of Human Cathepsi | 1e-08 | ||
| 1icf_A | 175 | Crystal Structure Of Mhc Class Ii Associated P41 Ii | 2e-08 | ||
| 3qsd_A | 254 | Structure Of Cathepsin B1 From Schistosoma Mansoni | 2e-08 | ||
| 1gec_E | 216 | Glycyl Endopeptidase-complex With Benzyloxycarbonyl | 2e-08 | ||
| 2as8_A | 222 | Crystal Structure Of Mature And Fully Active Der P | 2e-08 | ||
| 3f5v_A | 222 | C2 Crystal Form Of Mite Allergen Der P 1 Length = 2 | 2e-08 | ||
| 1xkg_A | 312 | Crystal Structure Of The Major House Dust Mite Alle | 3e-08 | ||
| 1k3b_C | 69 | Crystal Structure Of Human Dipeptidyl Peptidase I ( | 4e-08 | ||
| 3rvw_A | 222 | Crystal Structure Of Der P 1 Complexed With Fab 4c1 | 4e-08 | ||
| 3tnx_A | 363 | Structure Of The Precursor Of A Thermostable Varian | 9e-08 | ||
| 1mir_A | 322 | Rat Procathepsin B Length = 322 | 9e-08 | ||
| 1cpj_A | 260 | Crystal Structures Of Recombinant Rat Cathepsin B A | 1e-07 | ||
| 1cte_A | 254 | Crystal Structures Of Recombinant Rat Cathepsin B A | 1e-07 | ||
| 1ppo_A | 216 | Determination Of The Structure Of Papaya Protease O | 3e-07 | ||
| 1meg_A | 216 | Crystal Structure Of A Caricain D158e Mutant In Com | 4e-07 | ||
| 3ioq_A | 213 | Crystal Structure Of The Carica Candamarcensis Cyst | 4e-07 | ||
| 1khp_A | 212 | Monoclinic Form Of Papain/zlfg-dam Covalent Complex | 6e-07 | ||
| 1sp4_B | 205 | Crystal Structure Of Ns-134 In Complex With Bovine | 6e-07 | ||
| 1pip_A | 212 | Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Al | 6e-07 | ||
| 3ima_A | 212 | Complex Strcuture Of Tarocystatin And Papain Length | 7e-07 | ||
| 1ppp_A | 212 | Crystal Structure Of Papain-E64-C Complex. Binding | 7e-07 | ||
| 1stf_E | 212 | The Refined 2.4 Angstroms X-Ray Crystal Structure O | 7e-07 | ||
| 2cio_A | 212 | The High Resolution X-Ray Structure Of Papain Compl | 7e-07 | ||
| 1pbh_A | 317 | Crystal Structure Of Human Recombinant Procathepsin | 8e-07 | ||
| 1qdq_A | 253 | X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 | 1e-06 | ||
| 3cbj_A | 266 | Chagasin-cathepsin B Complex Length = 266 | 1e-06 | ||
| 1huc_B | 205 | The Refined 2.15 Angstroms X-Ray Crystal Structure | 1e-06 | ||
| 3ai8_B | 256 | Cathepsin B In Complex With The Nitroxoline Length | 1e-06 | ||
| 3k9m_A | 254 | Cathepsin B In Complex With Stefin A Length = 254 | 1e-06 | ||
| 1gmy_A | 261 | Cathepsin B Complexed With Dipeptidyl Nitrile Inhib | 1e-06 | ||
| 1ito_A | 256 | Crystal Structure Analysis Of Bovine Spleen Catheps | 2e-06 | ||
| 2wbf_X | 265 | Crystal Structure Analysis Of Sera5e From Plasmodiu | 7e-06 | ||
| 3ch2_X | 265 | Crystal Structure Analysis Of Sera5e From Plasmodiu | 7e-06 | ||
| 1pci_A | 322 | Procaricain Length = 322 | 1e-05 | ||
| 1ef7_A | 242 | Crystal Structure Of Human Cathepsin X Length = 242 | 1e-05 | ||
| 1deu_A | 277 | Crystal Structure Of Human Procathepsin X: A Cystei | 2e-05 |
| >pdb|2P7U|A Chain A, The Crystal Structure Of Rhodesain, The Major Cysteine Protease Of T. Brucei Rhodesiense, Bound To Inhibitor K777 Length = 215 | Back alignment and structure |
|
| >pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cathepsin H Determined At 2.1 Angstrom Resolution: Location Of The Mini-Chain C-Terminal Carboxyl Group Defines Cathepsin H Aminopeptidase Function Length = 220 | Back alignment and structure |
| >pdb|1MEM|A Chain A, Crystal Structure Of Cathepsin K Complexed With A Potent Vinyl Sulfone Inhibitor Length = 215 | Back alignment and structure |
| >pdb|1U9V|A Chain A, Crystal Structure Of The Cysteine Protease Human Cathepsin K In Complex With The Covalent Inhibitor Nvp-Abe854 Length = 217 | Back alignment and structure |
| >pdb|3OVZ|A Chain A, Cathepsin K In Complex With A Covalent Inhibitor With A Ketoamide Warhead Length = 213 | Back alignment and structure |
| >pdb|1SNK|A Chain A, Cathepsin K Complexed With Carbamate Derivatized Norleucine Aldehyde Length = 214 | Back alignment and structure |
| >pdb|2F7D|A Chain A, A Mutant Rabbit Cathepsin K With A Nitrile Inhibitor Length = 215 | Back alignment and structure |
| >pdb|7PCK|A Chain A, Crystal Structure Of Wild Type Human Procathepsin K Length = 314 | Back alignment and structure |
| >pdb|3QJ3|A Chain A, Structure Of Digestive Procathepsin L2 Proteinase From Tenebrio Molitor Larval Midgut Length = 331 | Back alignment and structure |
| >pdb|1M6D|A Chain A, Crystal Structure Of Human Cathepsin F Length = 214 | Back alignment and structure |
| >pdb|3H7D|A Chain A, The Crystal Structure Of The Cathepsin K Variant M5 In Compl Chondroitin-4-Sulfate Length = 215 | Back alignment and structure |
| >pdb|2O6X|A Chain A, Crystal Structure Of Procathepsin L1 From Fasciola Hepatica Length = 310 | Back alignment and structure |
| >pdb|2F1G|A Chain A, Cathepsin S In Complex With Non-Covalent 2-(Benzoxazol-2-Ylamino)- Acetamide Length = 220 | Back alignment and structure |
| >pdb|3MPE|A Chain A, Crystal Structure Of Human Cathepsin-S C25s Mutant With Bound Drug Length = 220 | Back alignment and structure |
| >pdb|3KWN|A Chain A, Cathepsin S In Complex With Thioether Acetamide P3 Inhibitor Length = 219 | Back alignment and structure |
| >pdb|3IEJ|A Chain A, Pyrazole-Based Cathepsin S Inhibitors With Arylalkynes As P1 Binding Elements Length = 222 | Back alignment and structure |
| >pdb|3OVX|A Chain A, Cathepsin S In Complex With A Covalent Inhibitor With An Aldehyde Warhead Length = 218 | Back alignment and structure |
| >pdb|3N3G|A Chain A, 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitrile As Cathepsin S Inhibitors: N3, Not N1 Is Critically Important Length = 217 | Back alignment and structure |
| >pdb|2FQ9|A Chain A, Cathepsin S With Nitrile Inhibitor Length = 225 | Back alignment and structure |
| >pdb|1MS6|A Chain A, Dipeptide Nitrile Inhibitor Bound To Cathepsin S. Length = 222 | Back alignment and structure |
| >pdb|1NPZ|A Chain A, Crystal Structures Of Cathepsin S Inhibitor Complexes Length = 217 | Back alignment and structure |
| >pdb|2C0Y|A Chain A, The Crystal Structure Of A Cys25ala Mutant Of Human Procathepsin S Length = 315 | Back alignment and structure |
| >pdb|1GLO|A Chain A, Crystal Structure Of Cys25ser Mutant Of Human Cathepsin S Length = 217 | Back alignment and structure |
| >pdb|2PNS|A Chain A, 1.9 Angstrom Resolution Crystal Structure Of A Plant Cysteine Protease Ervatamin-C Refinement With Cdna Derived Amino Acid Sequence Length = 208 | Back alignment and structure |
| >pdb|2FYE|A Chain A, Mutant Human Cathepsin S With Irreversible Inhibitor Cra- 14013 Length = 217 | Back alignment and structure |
| >pdb|2G6D|A Chain A, Human Cathepsin S Mutant With Vinyl Sulfone Inhibitor Cra- 14009 Length = 217 | Back alignment and structure |
| >pdb|3BCN|A Chain A, Crystal Structure Of A Papain-Like Cysteine Protease Ervatamin-A Complexed With Irreversible Inhibitor E-64 Length = 209 | Back alignment and structure |
| >pdb|1EWP|A Chain A, Cruzain Bound To Mor-Leu-Hpq Length = 215 | Back alignment and structure |
| >pdb|3QT4|A Chain A, Structure Of Digestive Procathepsin L 3 Of Tenebrio Molitor Larval Midgut Length = 329 | Back alignment and structure |
| >pdb|1AIM|A Chain A, Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluoromethylketone Length = 215 | Back alignment and structure |
| >pdb|1VSN|A Chain A, Crystal Structure Of A Potent Small Molecule Inhibitor Bound To Cathepsin K Length = 215 | Back alignment and structure |
| >pdb|3IUT|A Chain A, The Crystal Structure Of Cruzain In Complex With A Tetrafluorophenoxymethyl Ketone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|3HD3|A Chain A, High Resolution Crystal Structure Of Cruzain Bound To The Vinyl Sulfone Inhibitor Smdc-256047 Length = 215 | Back alignment and structure |
| >pdb|2B1M|A Chain A, Crystal Structure Of A Papain-Fold Protein Without The Catalytic Cysteine From Seeds Of Pachyrhizus Erosus Length = 246 | Back alignment and structure |
| >pdb|1CQD|A Chain A, The 2.1 Angstrom Structure Of A Cysteine Protease With Proline Specificity From Ginger Rhizome, Zingiber Officinale Length = 221 | Back alignment and structure |
| >pdb|1O0E|A Chain A, 1.9 Angstrom Crystal Structure Of A Plant Cysteine Protease Ervatamin C Length = 208 | Back alignment and structure |
| >pdb|1IWD|A Chain A, Proposed Amino Acid Sequence And The 1.63 Angstrom X-ray Crystal Structure Of A Plant Cysteine Protease Ervatamin B: Insight Into The Structural Basis Of Its Stability And Substrate Specificity Length = 215 | Back alignment and structure |
| >pdb|3H6S|A Chain A, Strucure Of Clitocypin - Cathepsin V Complex Length = 221 | Back alignment and structure |
| >pdb|1FH0|A Chain A, Crystal Structure Of Human Cathepsin V Complexed With An Irreversible Vinyl Sulfone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|2FO5|A Chain A, Crystal Structure Of Recombinant Barley Cysteine Endoprotease B Isoform 2 (Ep-B2) In Complex With Leupeptin Length = 262 | Back alignment and structure |
| >pdb|3PDF|A Chain A, Discovery Of Novel Cyanamide-Based Inhibitors Of Cathepsin C Length = 441 | Back alignment and structure |
| >pdb|3U8E|A Chain A, Crystal Structure Of Cysteine Protease From Bulbs Of Crocus Sativus At 1.3 A Resolution Length = 222 | Back alignment and structure |
| >pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of The Kdel-Tailed Cysteine Endopeptidase Functioning In Programmed Cell Death Of Ricinus Communis Endosperm Length = 229 | Back alignment and structure |
| >pdb|2ACT|A Chain A, Crystallographic Refinement Of The Structure Of Actinidin At 1.7 Angstroms Resolution By Fast Fourier Least-Squares Methods Length = 220 | Back alignment and structure |
| >pdb|1YVB|A Chain A, The Plasmodium Falciparum Cysteine Protease Falcipain-2 Length = 241 | Back alignment and structure |
| >pdb|3PNR|A Chain A, Structure Of Pbicp-C In Complex With Falcipain-2 Length = 240 | Back alignment and structure |
| >pdb|3P5U|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|3P5W|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|3BC3|A Chain A, Exploring Inhibitor Binding At The S Subsites Of Cathepsin L Length = 220 | Back alignment and structure |
| >pdb|2NQD|B Chain B, Crystal Structure Of Cysteine Protease Inhibitor, Chagasin, In Complex With Human Cathepsin L Length = 221 | Back alignment and structure |
| >pdb|3OF8|A Chain A, Structural Basis For Reversible And Irreversible Inhibition Of Human Cathepsin L By Their Respective Dipeptidyl Glyoxal And Diazomethylketone Inhibitors Length = 221 | Back alignment and structure |
| >pdb|3IV2|A Chain A, Crystal Structure Of Mature Apo-Cathepsin L C25a Mutant Length = 220 | Back alignment and structure |
| >pdb|3H89|A Chain A, A Combined Crystallographic And Molecular Dynamics Study Of Cathepsin-L Retro-Binding Inhibitors(Compound 4) Length = 220 | Back alignment and structure |
| >pdb|3KSE|A Chain A, Unreduced Cathepsin L In Complex With Stefin A Length = 220 | Back alignment and structure |
| >pdb|3HWN|A Chain A, Cathepsin L With Az13010160 Length = 258 | Back alignment and structure |
| >pdb|3HHA|A Chain A, Crystal Structure Of Cathepsin L In Complex With Az12878478 Length = 220 | Back alignment and structure |
| >pdb|1CS8|A Chain A, Crystal Structure Of Procathepsin L Length = 316 | Back alignment and structure |
| >pdb|1CJL|A Chain A, Crystal Structure Of A Cysteine Protease Proform Length = 312 | Back alignment and structure |
| >pdb|1AEC|A Chain A, Crystal Structure Of Actinidin-E-64 Complex+ Length = 218 | Back alignment and structure |
| >pdb|3D6S|A Chain A, Crystal Structure Of Mite Allergen Der F 1 Length = 223 | Back alignment and structure |
| >pdb|3BPM|A Chain A, Crystal Structure Of Falcipain-3 With Its Inhibitor, Leupeptin Length = 243 | Back alignment and structure |
| >pdb|3HHI|A Chain A, Crystal Structure Of Cathepsin B From T. Brucei In Complex With Ca074 Length = 325 | Back alignment and structure |
| >pdb|3MOR|A Chain A, Crystal Structure Of Cathepsin B From Trypanosoma Brucei Length = 317 | Back alignment and structure |
| >pdb|2VHS|A Chain A, Cathsilicatein, A Chimera Length = 217 | Back alignment and structure |
| >pdb|2BDZ|A Chain A, Mexicain From Jacaratia Mexicana Length = 214 | Back alignment and structure |
| >pdb|4HWY|A Chain A, Trypanosoma Brucei Procathepsin B Solved From 40 Fs Free-electron Laser Pulse Data By Serial Femtosecond X-ray Crystallography Length = 340 | Back alignment and structure |
| >pdb|1JQP|A Chain A, Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric Cysteine Protease Of The Papain Family Length = 438 | Back alignment and structure |
| >pdb|1YAL|A Chain A, Carica Papaya Chymopapain At 1.7 Angstroms Resolution Length = 218 | Back alignment and structure |
| >pdb|3F75|A Chain A, Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In Complex With Its Propeptide Length = 224 | Back alignment and structure |
| >pdb|1MHW|A Chain A, Design Of Non-covalent Inhibitors Of Human Cathepsin L. From The 96- Residue Proregion To Optimized Tripeptides Length = 175 | Back alignment and structure |
| >pdb|1ICF|A Chain A, Crystal Structure Of Mhc Class Ii Associated P41 Ii Fragment In Complex With Cathepsin L Length = 175 | Back alignment and structure |
| >pdb|3QSD|A Chain A, Structure Of Cathepsin B1 From Schistosoma Mansoni In Complex With Ca074 Inhibitor Length = 254 | Back alignment and structure |
| >pdb|1GEC|E Chain E, Glycyl Endopeptidase-complex With Benzyloxycarbonyl-leucine-valine- Glycine-methylene Covalently Bound To Cysteine 25 Length = 216 | Back alignment and structure |
| >pdb|2AS8|A Chain A, Crystal Structure Of Mature And Fully Active Der P 1 Allergen Length = 222 | Back alignment and structure |
| >pdb|3F5V|A Chain A, C2 Crystal Form Of Mite Allergen Der P 1 Length = 222 | Back alignment and structure |
| >pdb|1XKG|A Chain A, Crystal Structure Of The Major House Dust Mite Allergen Der P 1 In Its Pro Form At 1.61 A Resolution Length = 312 | Back alignment and structure |
| >pdb|1K3B|C Chain C, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 69 | Back alignment and structure |
| >pdb|3RVW|A Chain A, Crystal Structure Of Der P 1 Complexed With Fab 4c1 Length = 222 | Back alignment and structure |
| >pdb|3TNX|A Chain A, Structure Of The Precursor Of A Thermostable Variant Of Papain At 2.6 Angstroem Resolution Length = 363 | Back alignment and structure |
| >pdb|1MIR|A Chain A, Rat Procathepsin B Length = 322 | Back alignment and structure |
| >pdb|1CPJ|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 260 | Back alignment and structure |
| >pdb|1CTE|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 254 | Back alignment and structure |
| >pdb|1PPO|A Chain A, Determination Of The Structure Of Papaya Protease Omega Length = 216 | Back alignment and structure |
| >pdb|1MEG|A Chain A, Crystal Structure Of A Caricain D158e Mutant In Complex With E-64 Length = 216 | Back alignment and structure |
| >pdb|3IOQ|A Chain A, Crystal Structure Of The Carica Candamarcensis Cysteine Protease Cms1ms2 In Complex With E-64 Length = 213 | Back alignment and structure |
| >pdb|1KHP|A Chain A, Monoclinic Form Of Papain/zlfg-dam Covalent Complex Length = 212 | Back alignment and structure |
| >pdb|1SP4|B Chain B, Crystal Structure Of Ns-134 In Complex With Bovine Cathepsin B: A Two Headed Epoxysuccinyl Inhibitor Extends Along The Whole Active Site Cleft Length = 205 | Back alignment and structure |
| >pdb|1PIP|A Chain A, Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Ala-Ala-P- Nitroanilide Complex At 1.7 Angstroms Resolution: Noncovalent Binding Mode Of A Common Sequence Of Endogenous Thiol Protease Inhibitors Length = 212 | Back alignment and structure |
| >pdb|3IMA|A Chain A, Complex Strcuture Of Tarocystatin And Papain Length = 212 | Back alignment and structure |
| >pdb|1PPP|A Chain A, Crystal Structure Of Papain-E64-C Complex. Binding Diversity Of E64-C To Papain S2 And S3 Subsites Length = 212 | Back alignment and structure |
| >pdb|1STF|E Chain E, The Refined 2.4 Angstroms X-Ray Crystal Structure Of Recombinant Human Stefin B In Complex With The Cysteine Proteinase Papain: A Novel Type Of Proteinase Inhibitor Interaction Length = 212 | Back alignment and structure |
| >pdb|2CIO|A Chain A, The High Resolution X-Ray Structure Of Papain Complexed With Fragments Of The Trypanosoma Brucei Cysteine Protease Inhibitor Icp Length = 212 | Back alignment and structure |
| >pdb|1PBH|A Chain A, Crystal Structure Of Human Recombinant Procathepsin B At 3.2 Angstrom Resolution Length = 317 | Back alignment and structure |
| >pdb|1QDQ|A Chain A, X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 Complex Length = 253 | Back alignment and structure |
| >pdb|3CBJ|A Chain A, Chagasin-cathepsin B Complex Length = 266 | Back alignment and structure |
| >pdb|1HUC|B Chain B, The Refined 2.15 Angstroms X-Ray Crystal Structure Of Human Liver Cathepsin B: The Structural Basis For Its Specificity Length = 205 | Back alignment and structure |
| >pdb|3AI8|B Chain B, Cathepsin B In Complex With The Nitroxoline Length = 256 | Back alignment and structure |
| >pdb|3K9M|A Chain A, Cathepsin B In Complex With Stefin A Length = 254 | Back alignment and structure |
| >pdb|1GMY|A Chain A, Cathepsin B Complexed With Dipeptidyl Nitrile Inhibitor Length = 261 | Back alignment and structure |
| >pdb|1ITO|A Chain A, Crystal Structure Analysis Of Bovine Spleen Cathepsin B- E64c Complex Length = 256 | Back alignment and structure |
| >pdb|2WBF|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum With Loop 690-700 Ordered Length = 265 | Back alignment and structure |
| >pdb|3CH2|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum Length = 265 | Back alignment and structure |
| >pdb|1PCI|A Chain A, Procaricain Length = 322 | Back alignment and structure |
| >pdb|1EF7|A Chain A, Crystal Structure Of Human Cathepsin X Length = 242 | Back alignment and structure |
| >pdb|1DEU|A Chain A, Crystal Structure Of Human Procathepsin X: A Cysteine Protease With The Proregion Covalently Linked To The Active Site Cysteine Length = 277 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Length = 214 | Back alignment and structure |
|---|
Score = 160 bits (407), Expect = 3e-50
Identities = 60/178 (33%), Positives = 96/178 (53%), Gaps = 8/178 (4%)
Query: 2 LESQYAIKHGTLLPLSKSQLIECNIYNQGCQGGGFNKAIQYLKHA-GLEAEADYPFRNQN 60
+E Q+ + GTLL LS+ +L++C+ ++ C GG + A +K+ GLE E DY ++
Sbjct: 34 VEGQWFLNQGTLLSLSEQELLDCDKMDKACMGGLPSNAYSAIKNLGGLETEDDYSYQ--- 90
Query: 61 GVTGRCAYDARKVKVRVSDFL-VFNGSDTFRRMLYHYGPLVAGMNGALLQDY-NGKLIRK 118
G C + A K KV + D + + L GP+ +N +Q Y +G
Sbjct: 91 GHMQSCQFSAEKAKVYIQDSVELSQNEQKLAAWLAKRGPISVAINAFGMQFYRHGISRPL 150
Query: 119 NDVCPSENLNHAVVIVGYGMRHQVPVWIVRNSWG-RWGPDDGYFTVERGTNACGIESY 175
+C ++HAV++VGYG R VP W ++NSWG WG + GY+ + RG+ ACG+ +
Sbjct: 151 RPLCSPWLIDHAVLLVGYGQRSDVPFWAIKNSWGTDWG-EKGYYYLHRGSGACGVNTM 207
|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Length = 215 | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 | Back alignment and structure |
|---|
| >3f5v_A DER P 1 allergen; allergy, asthma, DUST mites, glycoprotein, hydrola protease, secreted, thiol protease; HET: P6G; 1.36A {Dermatophagoides pteronyssinus} PDB: 2as8_A 3rvw_A* 3rvx_A 3rvv_A* 3d6s_A* Length = 222 | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Length = 441 | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Length = 246 | Back alignment and structure |
|---|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Length = 220 | Back alignment and structure |
|---|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Length = 215 | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Length = 243 | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Length = 241 | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Length = 218 | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Length = 208 | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Length = 216 | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} Length = 213 | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 | Back alignment and structure |
|---|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} PDB: 3mor_A* Length = 325 | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Length = 214 | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Length = 322 | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Length = 218 | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Length = 212 | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Length = 265 | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Length = 215 | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 224 | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Length = 277 | Back alignment and structure |
|---|
| >3p5u_A Actinidin; SAD, cysteine proteinases, hydrolase; 1.50A {Actinidia arguta} PDB: 3p5v_A 3p5w_A 3p5x_A 1aec_A* 2act_A Length = 220 | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Length = 229 | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} Length = 222 | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Length = 262 | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Length = 266 | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} PDB: 3s3q_A* 3s3r_A* Length = 254 | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Length = 291 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 192 | |||
| 3i06_A | 215 | Cruzipain; autocatalytic cleavage, glycoprotein, p | 100.0 | |
| 8pch_A | 220 | Cathepsin H; hydrolase, protease, cysteine protein | 100.0 | |
| 3kwz_A | 215 | Cathepsin K; enzyme inhibitor, covalent reversible | 100.0 | |
| 1m6d_A | 214 | Cathepsin F, catsf; papain family cysteine proteas | 100.0 | |
| 3qt4_A | 329 | Cathepsin-L-like midgut cysteine proteinase; hydro | 100.0 | |
| 2xu3_A | 220 | Cathepsin L1; hydrolase, drug design, thiol protea | 100.0 | |
| 3qj3_A | 331 | Cathepsin L-like protein; hydrolase, proteinase, l | 100.0 | |
| 2b1m_A | 246 | SPE31; papain-like, sugar binding protein; HET: NA | 100.0 | |
| 2o6x_A | 310 | Procathepsin L1, secreted cathepsin L 1; hydrolase | 100.0 | |
| 3ovx_A | 218 | Cathepsin S; hydrolase, covalent inhibitor, aldehy | 100.0 | |
| 3f5v_A | 222 | DER P 1 allergen; allergy, asthma, DUST mites, gly | 100.0 | |
| 1xkg_A | 312 | DER P I, major mite fecal allergen DER P 1; major | 100.0 | |
| 1iwd_A | 215 | Ervatamin B; cysteine protease, alpha-beta protein | 100.0 | |
| 1by8_A | 314 | Protein (procathepsin K); hydrolase(sulfhydryl pro | 100.0 | |
| 1ppo_A | 216 | Protease omega; hydrolase(thiol protease); 1.80A { | 100.0 | |
| 1cqd_A | 221 | Protein (protease II); cysteine protease, glycopro | 100.0 | |
| 3u8e_A | 222 | Papain-like cysteine protease; papain-like cystein | 100.0 | |
| 1yal_A | 218 | Chymopapain; hydrolase, thiol protease; 1.70A {Car | 100.0 | |
| 3p5u_A | 220 | Actinidin; SAD, cysteine proteinases, hydrolase; 1 | 100.0 | |
| 2c0y_A | 315 | Procathepsin S; proenzyme, proteinase, hydrolase, | 100.0 | |
| 3hhi_A | 325 | Cathepsin B-like cysteine protease; occluding loop | 100.0 | |
| 1cs8_A | 316 | Human procathepsin L; prosegment, propeptide, inhi | 100.0 | |
| 2cio_A | 212 | Papain; hydrolase/inhibitor, complex hydrolase/inh | 100.0 | |
| 2oul_A | 241 | Falcipain 2; cysteine protease, inhibitor, macromo | 100.0 | |
| 1pci_A | 322 | Procaricain; zymogen, hydrolase, thiol protease; 3 | 100.0 | |
| 3f75_A | 224 | Toxopain-2, cathepsin L protease; medical structur | 100.0 | |
| 3bwk_A | 243 | Cysteine protease falcipain-3; malaria, hydrolase; | 100.0 | |
| 1o0e_A | 208 | Ervatamin C; plant cysteine protease, two domain, | 100.0 | |
| 2bdz_A | 214 | Mexicain; cysteine protease, peptidase_C1, papain- | 100.0 | |
| 1s4v_A | 229 | Cysteine endopeptidase; KDEL ER retention signal, | 100.0 | |
| 3pdf_A | 441 | Cathepsin C, dipeptidyl peptidase 1; two domains, | 100.0 | |
| 1deu_A | 277 | Procathepsin X; cysteine protease, proregion, pros | 100.0 | |
| 2fo5_A | 262 | Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst | 100.0 | |
| 3ioq_A | 213 | CMS1MS2; caricaceae, cysteine protease, papain fam | 100.0 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 100.0 | |
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 100.0 | |
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 100.0 | |
| 3tnx_A | 363 | Papain; hydrolase, cytoplasm for recombinant expre | 100.0 | |
| 2wbf_X | 265 | Serine-repeat antigen protein; SERA, malaria, vacu | 100.0 | |
| 3ois_A | 291 | Cysteine protease; alpha and beta, hydrolase; HET: | 100.0 | |
| 2cb5_A | 453 | Protein (bleomycin hydrolase); aminopeptidase, cys | 100.0 | |
| 2e01_A | 457 | Cysteine proteinase 1; bleomycin hydrolase, thiol | 99.98 | |
| 3pw3_A | 383 | Aminopeptidase C; bleomycin, cysteine proteinase f | 99.94 | |
| 1pxv_A | 183 | Cysteine protease; hydrolase; 1.80A {Staphylococcu | 97.25 | |
| 1x9y_A | 367 | Cysteine proteinase; half-barrel, barrel-sandwich- | 96.73 | |
| 1cv8_A | 174 | Staphopain; cysteine protease, thiol protease, pap | 93.58 | |
| 3erv_A | 236 | Putative C39-like peptidase; structural genomics, | 91.7 |
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} SCOP: d.3.1.1 PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... | Back alignment and structure |
|---|
Probab=100.00 E-value=8.7e-56 Score=350.20 Aligned_cols=178 Identities=25% Similarity=0.575 Sum_probs=162.2
Q ss_pred CchhhHHHHhCCCCCCCHHHHhhhcCCCCCCCCCCHHHHHHHHHHc---CcccCcccccccCCCCCCCccccCCCceeEe
Q psy5095 1 MLESQYAIKHGTLLPLSKSQLIECNIYNQGCQGGGFNKAIQYLKHA---GLEAEADYPFRNQNGVTGRCAYDARKVKVRV 77 (192)
Q Consensus 1 a~E~~~~i~~~~~~~lS~Q~l~dC~~~~~gC~GG~~~~a~~~~~~~---Gi~~e~~yPY~~~~~~~~~C~~~~~~~~~~i 77 (192)
|||++++|++++.++||||+|+||+..+.||+||++..||+|++++ |+++|++|||.......+.|........+++
T Consensus 33 ale~~~~i~~~~~~~lS~q~l~dC~~~~~gC~GG~~~~a~~y~~~~~~gGi~~e~~yPY~~~~~~~~~C~~~~~~~~~~i 112 (215)
T 3i06_A 33 NVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATI 112 (215)
T ss_dssp HHHHHHHHTTSCCCCCCHHHHHHHCSSSCGGGCCCHHHHHHHHHHHSTTEEEC-CCSCCCCTTSCCCCCCCSSCCEEEEE
T ss_pred HHHHHHHHhCCCCCccCHHHHhccCCCCCCCCCCCHHHHHHHHHHhccccccccCccCCcCCCCCCCccccCCcccceEe
Confidence 5899999999999999999999999888999999999999999964 7999999999975445568987766667889
Q ss_pred cceEEeC-ChHHHHHHHHhcCCEEEEEeCCcccCCCCceEeCCCCCCCCCCCeEEEEEEEeecCCccEEEEEcCCCCCCC
Q psy5095 78 SDFLVFN-GSDTFRRMLYHYGPLVAGMNGALLQDYNGKLIRKNDVCPSENLNHAVVIVGYGMRHQVPVWIVRNSWGRWGP 156 (192)
Q Consensus 78 ~~~~~i~-~~~~ik~~l~~~gPv~~~~~~~~f~~y~~Giy~~~~~~~~~~~~Hav~iVGyg~~~g~~ywivkNSWG~~WG 156 (192)
.+|..++ ++++||++|+++|||+++|++++|++|++|||.. |.....+|||+|||||++++++|||||||||++||
T Consensus 113 ~~~~~v~~~~~~ik~~l~~~gPV~v~~~~~~f~~Y~~Giy~~---~~~~~~~HaV~iVGyg~~~g~~yWivkNSWG~~WG 189 (215)
T 3i06_A 113 TGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTS---CVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWG 189 (215)
T ss_dssp EEEEECCSCHHHHHHHHHHHCCEEEEECCTTGGGCCSSEECS---CCCSCCCEEEEEEEEESSSSSCEEEEECSBCTTST
T ss_pred cceEEeCChHHHHHHHHHHCCCEEEEEEchHHhcCCCCcccC---CCCCccCcEEEEEEEeccCCcEEEEEECCCCCCcc
Confidence 9999997 9999999999999999999998899999999975 76667899999999999999999999999999999
Q ss_pred CCcEEEEEeCCCcccccceeeEEEE
Q psy5095 157 DDGYFTVERGTNACGIESYGGICTR 181 (192)
Q Consensus 157 ~~Gy~~i~~~~n~cgi~~~~~~~~~ 181 (192)
++|||||+|+.|.|||++++.+|+.
T Consensus 190 e~Gy~~i~rg~n~cgi~~~~~~~~~ 214 (215)
T 3i06_A 190 EEGYIRIAKGSNQCLVKEEASSAVV 214 (215)
T ss_dssp BTTEEEEESSSCGGGTTSSEEEEEE
T ss_pred cCceEEEecCCCeecCCCceeEEec
Confidence 9999999999999999999999874
|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... | Back alignment and structure |
|---|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} SCOP: d.3.1.1 PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... | Back alignment and structure |
|---|
| >3f5v_A DER P 1 allergen; allergy, asthma, DUST mites, glycoprotein, hydrola protease, secreted, thiol protease; HET: P6G; 1.36A {Dermatophagoides pteronyssinus} PDB: 2as8_A 3rvw_A* 3rvx_A 3rvv_A* 3d6s_A* | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* | Back alignment and structure |
|---|
| >3p5u_A Actinidin; SAD, cysteine proteinases, hydrolase; 1.50A {Actinidia arguta} SCOP: d.3.1.1 PDB: 3p5v_A 3p5w_A 3p5x_A 1aec_A* 2act_A | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} | Back alignment and structure |
|---|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} SCOP: d.3.1.0 PDB: 4hwy_A* 3mor_A* | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} SCOP: d.3.1.0 PDB: 3s3q_A* 3s3r_A* | Back alignment and structure |
|---|
| >3tnx_A Papain; hydrolase, cytoplasm for recombinant expression; 2.62A {Carica papaya} | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >2cb5_A Protein (bleomycin hydrolase); aminopeptidase, cysteine protease, SELF- compartmentalizing, cylinase; 1.85A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cb5_A | Back alignment and structure |
|---|
| >2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >1pxv_A Cysteine protease; hydrolase; 1.80A {Staphylococcus aureus} SCOP: d.3.1.1 PDB: 1y4h_A | Back alignment and structure |
|---|
| >1x9y_A Cysteine proteinase; half-barrel, barrel-sandwich-hybrid, hydrolase; 2.50A {Staphylococcus aureus} SCOP: d.3.1.1 d.17.1.4 | Back alignment and structure |
|---|
| >1cv8_A Staphopain; cysteine protease, thiol protease, papain family; HET: E64; 1.75A {Staphylococcus aureus} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3erv_A Putative C39-like peptidase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.10A {Bacillus anthracis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 192 | ||||
| d1m6da_ | 214 | d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta | 3e-27 | |
| d2h7ja1 | 217 | d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa | 8e-26 | |
| d1xkga1 | 302 | d.3.1.1 (A:4-305) Major mite fecal allergen der p | 2e-25 | |
| d1cqda_ | 216 | d.3.1.1 (A:) Proline-specific cysteine protease {G | 2e-24 | |
| d2r6na1 | 215 | d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa | 4e-24 | |
| g8pch.1 | 228 | d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax | 8e-24 | |
| d1gmya_ | 254 | d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens | 1e-23 | |
| d1me4a_ | 215 | d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 | 4e-23 | |
| d1cs8a_ | 316 | d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens | 3e-22 | |
| d1o0ea_ | 208 | d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv | 4e-22 | |
| d1ppoa_ | 216 | d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca | 5e-22 | |
| d1yala_ | 218 | d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ | 5e-22 | |
| g1k3b.1 | 233 | d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase | 2e-21 | |
| d2oula1 | 241 | d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip | 2e-21 | |
| d1deua_ | 275 | d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens | 3e-20 | |
| d1iwda_ | 215 | d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia | 3e-20 | |
| d1s4va_ | 224 | d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor | 1e-19 | |
| d1aeca_ | 218 | d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi | 1e-19 | |
| d1khqa_ | 212 | d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId | 3e-18 | |
| d1fh0a_ | 221 | d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens | 6e-18 | |
| d3gcba_ | 458 | d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (S | 2e-06 | |
| d2cb5a_ | 453 | d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapi | 1e-05 |
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Papain-like domain: Cathepsin F species: Human (Homo sapiens) [TaxId: 9606]
Score = 100 bits (249), Expect = 3e-27
Identities = 55/178 (30%), Positives = 88/178 (49%), Gaps = 6/178 (3%)
Query: 1 MLESQYAIKHGTLLPLSKSQLIECNIYNQGCQGGGFNKAIQYLKHAG-LEAEADYPFRNQ 59
+E Q+ + GTLL LS+ +L++C+ ++ C GG + A +K+ G LE E DY ++
Sbjct: 33 NVEGQWFLNQGTLLSLSEQELLDCDKMDKACMGGLPSNAYSAIKNLGGLETEDDYSYQGH 92
Query: 60 NGVTGRCAYDARKVKVRVSDFLVFNGSDTFRRMLYHYGPLVAGMNGALLQDYN-GKLIRK 118
A A+ + L GP+ +N +Q Y G
Sbjct: 93 MQSCQFSAEKAKVYIQDSVEL--SQNEQKLAAWLAKRGPISVAINAFGMQFYRHGISRPL 150
Query: 119 NDVCPSENLNHAVVIVGYGMRHQVPVWIVRNSWG-RWGPDDGYFTVERGTNACGIESY 175
+C ++HAV++VGYG R VP W ++NSWG WG + GY+ + RG+ ACG+ +
Sbjct: 151 RPLCSPWLIDHAVLLVGYGQRSDVPFWAIKNSWGTDWG-EKGYYYLHRGSGACGVNTM 207
|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 | Back information, alignment and structure |
|---|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 | Back information, alignment and structure |
|---|
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Length = 254 | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 | Back information, alignment and structure |
|---|
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 | Back information, alignment and structure |
|---|
| >d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Length = 458 | Back information, alignment and structure |
|---|
| >d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 453 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 192 | |||
| d1xkga1 | 302 | Major mite fecal allergen der p 1 {House-dust mite | 100.0 | |
| d1cs8a_ | 316 | (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| g8pch.1 | 228 | Cathepsin H {Pig (Sus scrofa) [TaxId: 9823]} | 100.0 | |
| d1m6da_ | 214 | Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d2r6na1 | 215 | (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1yala_ | 218 | Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | 100.0 | |
| g1k3b.1 | 233 | Cathepsin C (dipeptidyl peptidase I), catalytic do | 100.0 | |
| d1ppoa_ | 216 | Caricain (protease omega) {Papaya (Carica papaya) | 100.0 | |
| d1me4a_ | 215 | Cruzain {Trypanosoma cruzi [TaxId: 5693]} | 100.0 | |
| d2h7ja1 | 217 | (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1cqda_ | 216 | Proline-specific cysteine protease {Ginger rhizome | 100.0 | |
| d1deua_ | 275 | (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d2oula1 | 241 | Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} | 100.0 | |
| d1gmya_ | 254 | (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1fh0a_ | 221 | (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1aeca_ | 218 | Actinidin {Chinese gooseberry or kiwifruit (Actini | 100.0 | |
| d1khqa_ | 212 | Papain {Papaya (Carica papaya) [TaxId: 3649]} | 100.0 | |
| d1s4va_ | 224 | Vignain (bean endopeptidase) {Castor bean (Ricinus | 100.0 | |
| d1iwda_ | 215 | Ervatamin B {Adam's apple (Ervatamia coronaria) [T | 100.0 | |
| d1o0ea_ | 208 | Ervatamin C {East indian rosebay (Ervatamia corona | 100.0 | |
| d3gcba_ | 458 | Bleomycin hydrolase {Baker's yeast (Saccharomyces | 99.29 | |
| d2cb5a_ | 453 | Bleomycin hydrolase {Human (Homo sapiens) [TaxId: | 99.06 | |
| d1pxva_ | 183 | Staphopain SspB {Staphylococcus aureus [TaxId: 128 | 93.2 | |
| d1cv8a_ | 173 | Staphopain StpA {Staphylococcus aureus [TaxId: 128 | 86.45 |
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Papain-like domain: Major mite fecal allergen der p 1 species: House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]
Probab=100.00 E-value=4.1e-48 Score=318.43 Aligned_cols=175 Identities=25% Similarity=0.436 Sum_probs=153.4
Q ss_pred CchhhHHHHhCCCCCCCHHHHhhhcCCCCCCCCCCHHHHHHHHHHcCcccCcccccccCCCCCCCccccCCCceeEecce
Q psy5095 1 MLESQYAIKHGTLLPLSKSQLIECNIYNQGCQGGGFNKAIQYLKHAGLEAEADYPFRNQNGVTGRCAYDARKVKVRVSDF 80 (192)
Q Consensus 1 a~E~~~~i~~~~~~~lS~Q~l~dC~~~~~gC~GG~~~~a~~~~~~~Gi~~e~~yPY~~~~~~~~~C~~~~~~~~~~i~~~ 80 (192)
++|++++|++++.+.||+|+|+||+. +.+|.||++..|++|+++.|+++|++|||.. ..+.|... ....+++..+
T Consensus 119 ~lE~~~~i~~~~~~~lS~q~lvdC~~-~~~C~gG~~~~a~~~~~~~Gi~~e~~yPY~~---~~~~C~~~-~~~~~~~~~~ 193 (302)
T d1xkga1 119 ATESAYLAYRDQSLDLAEQELVDCAS-QHGCHGDTIPRGIEYIQHNGVVQESYYRYVA---REQSCRRP-NAQRFGISNY 193 (302)
T ss_dssp HHHHHHHHHHCCCCCBCHHHHHHHTC-SSTTBCCCHHHHHHHHHHHCEEBGGGSCCCS---SCCCCCCC-SSCEECCSEE
T ss_pred hHHHHHHHhcCCcccchhHHHHhccc-cCccCCCccchhhhhhccCcccchhhccccc---cccccccc-ccccceeeee
Confidence 58999999999999999999999986 6799999999999999999999999999998 78889864 3445677888
Q ss_pred EEeC--ChHHHHHHHHhcCC-EEEEEeC---CcccCCCCceEeCCCCCCCCCCCeEEEEEEEeecCCccEEEEEcCCCCC
Q psy5095 81 LVFN--GSDTFRRMLYHYGP-LVAGMNG---ALLQDYNGKLIRKNDVCPSENLNHAVVIVGYGMRHQVPVWIVRNSWGRW 154 (192)
Q Consensus 81 ~~i~--~~~~ik~~l~~~gP-v~~~~~~---~~f~~y~~Giy~~~~~~~~~~~~Hav~iVGyg~~~g~~ywivkNSWG~~ 154 (192)
..+. ++++|+++|+..+| +++.+.. +.|+.|.+||+.. ..|+...++|||+|||||+++|++|||||||||++
T Consensus 194 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~y~~gi~~~-~~~~~~~~~HaV~iVGyg~~~g~~YWivkNSWG~~ 272 (302)
T d1xkga1 194 CQIYPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQ-RDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTN 272 (302)
T ss_dssp EECCSCCHHHHHHHHHHHCCCEEEEEEESCHHHHHTCCSSSCBC-CCCSSCCEEEEEEEEEEEEETTEEEEEEECSBCTT
T ss_pred eeecCchHHHHHHhhhhcccccceeecccccchhhccccceeec-CCCCCCcCCEEEEEEEEeccCCeEEEEEEcCCCCc
Confidence 7775 88999999987554 4444433 5788899999877 67777778899999999999999999999999999
Q ss_pred CCCCcEEEEEeCCCcccccceeeEEEE
Q psy5095 155 GPDDGYFTVERGTNACGIESYGGICTR 181 (192)
Q Consensus 155 WG~~Gy~~i~~~~n~cgi~~~~~~~~~ 181 (192)
|||+|||||+|+.|.|||++++++|+.
T Consensus 273 WGe~GY~~i~~~~n~cgi~~~~~~~~~ 299 (302)
T d1xkga1 273 WGDNGYGYFAANIDLMMIEEYPYVVIL 299 (302)
T ss_dssp STBTTEEEEECSSCGGGTTTCCEEEEC
T ss_pred hhcCCEEEEECCCCeeccCCCcEEEEe
Confidence 999999999999999999999999874
|
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pxva_ d.3.1.1 (A:) Staphopain SspB {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1cv8a_ d.3.1.1 (A:) Staphopain StpA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|