Psyllid ID: psy5462


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180--
MSQDRTTGHIHGILFIPWCLPTKTHVAVYFKADVSDKAEIKKLNENVRKIGYVDILINNAGIVASSSVLAHTDHEIERIMDVNLMSNIKMVREFLPDMLENNTGHIVCISSIAALTAAVNVSAYFASKYGVTENHPSIKCFSGYMLWGTTVTTPLRSVTILYQRSVLTIQLLAFDKKSKRHM
cccHHHHHHHHHHccccccccccccEEEEEEEccccHHHHHHHHHHHHHcccccEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccccccccccccccccccHHHHHccc
cccccccccHHHHHHHHHHHHHcccEEEEEEEEcccHHHHHHHHHHHHHHccccEEEEcccccccEccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccEEEEEEccHHHccEcccEHHHHHHHHHHEEHHHHHHHHHHHcccEEEEEccccEcccHHHHccHHHHHHHcccccHccc
msqdrttghihgilfipwclptkthVAVYFKADVSDKAEIKKLNENVRKIGYVDILINNAGIVASSSVLAHTDHEIERIMDVNLMSNIKMVREFLPDmlenntghivCISSIAALTAAVNVSAYFAskygvtenhpsikcfsgymlwgttvttplrsVTILYQRSVLTIQLLAFDKKSKRHM
msqdrttghihgilfipwclpTKTHVAVYFKADVSDKAEIKKLNENVRKIGYVDILINNAGIVASSSVLAHTDHEIERIMDVNLMSNIKMVREFLPDMLENNTGHIVCISSIAALTAAVNVSAYFASKYGVTENHPSIKCFSGYMLWGTTVTTPLRSVTILYQRSVLtiqllafdkkskrhm
MSQDRTTGHIHGILFIPWCLPTKTHVAVYFKADVSDKAEIKKLNENVRKIGYVDILINNAGIVASSSVLAHTDHEIERIMDVNLMSNIKMVREFLPDMLENNTGHIVCISSIAALTAAVNVSAYFASKYGVTENHPSIKCFSGYMLWGTTVTTPLRSVTILYQRSVLTIQLLAFDKKSKRHM
*******GHIHGILFIPWCLPTKTHVAVYFKADVSDKAEIKKLNENVRKIGYVDILINNAGIVASSSVLAHTDHEIERIMDVNLMSNIKMVREFLPDMLENNTGHIVCISSIAALTAAVNVSAYFASKYGVTENHPSIKCFSGYMLWGTTVTTPLRSVTILYQRSVLTIQLLAF********
****R***HIHGILFIPWCLPTKTHVAVYFKADVSDKAEIKKLNENVRKIGYVDILINNAGIVASSSVLAHTDHEIERIMDVNLMSNIKMVREFLPDMLENNTGHIVCISSIAALTAAVNVSAYFASKYGVTENHPSIKCFSGYMLWGTTVTTPLRSVTILYQRSVLTIQLLAFD**SKRH*
********HIHGILFIPWCLPTKTHVAVYFKADVSDKAEIKKLNENVRKIGYVDILINNAGIVASSSVLAHTDHEIERIMDVNLMSNIKMVREFLPDMLENNTGHIVCISSIAALTAAVNVSAYFASKYGVTENHPSIKCFSGYMLWGTTVTTPLRSVTILYQRSVLTIQLLAFDKKSKRHM
**********HGILFIPWCLPTKTHVAVYFKADVSDKAEIKKLNENVRKIGYVDILINNAGIVASSSVLAHTDHEIERIMDVNLMSNIKMVREFLPDMLENNTGHIVCISSIAALTAAVNVSAYFASKYGVTENHPSIKCFSGYMLWGTTVTTPLRSVTILYQRSVLTIQLLAFD*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQDRTTGHIHGILFIPWCLPTKTHVAVYFKADVSDKAEIKKLNENVRKIGYVDILINNAGIVASSSVLAHTDHEIERIMDVNLMSNIKMVREFLPDMLENNTGHIVCISSIAALTAAVNVSAYFASKYGVTENHPSIKCFSGYMLWGTTVTTPLRSVTILYQRSVLTIQLLAFDKKSKRHM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query182 2.2.26 [Sep-21-2011]
A5PJJ7316 Short-chain dehydrogenase yes N/A 0.681 0.392 0.392 3e-16
Q7TQA3309 Epidermal retinol dehydro yes N/A 0.549 0.323 0.425 2e-15
A1L1W4339 Retinol dehydrogenase 10- yes N/A 0.697 0.374 0.378 2e-15
Q05A13316 Short-chain dehydrogenase no N/A 0.587 0.338 0.412 4e-15
Q80ZF7341 Retinol dehydrogenase 10 no N/A 0.642 0.343 0.394 2e-14
Q8VCH7341 Retinol dehydrogenase 10 no N/A 0.642 0.343 0.394 2e-14
Q8IZV5341 Retinol dehydrogenase 10 yes N/A 0.598 0.319 0.4 2e-14
Q8HZT6341 Retinol dehydrogenase 10 no N/A 0.598 0.319 0.4 2e-14
Q7T2D1336 Retinol dehydrogenase 10- no N/A 0.598 0.324 0.4 3e-14
Q8N3Y7309 Epidermal retinol dehydro no N/A 0.576 0.339 0.385 4e-14
>sp|A5PJJ7|S16C6_BOVIN Short-chain dehydrogenase/reductase family 16C member 6 OS=Bos taurus GN=SDR16C6 PE=2 SV=1 Back     alignment and function desciption
 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 73/130 (56%), Gaps = 6/130 (4%)

Query: 30  FKADVSDKAEIKKLNENVRK-IGYVDILINNAGIVASSSVLAHTDHEIERIMDVNLMSNI 88
           +  D S++ ++ ++ + V+K +G V ILINNAG+V     L   DH +ER   VN+MS+ 
Sbjct: 91  YTCDCSNRQDVYRVADQVKKEVGNVTILINNAGVVTGREFLKTPDHMVERSFLVNVMSHF 150

Query: 89  KMVREFLPDMLENNTGHIVCISSIAALTAAVNVSAYFASK---YGVTEN-HPSIKCFSGY 144
              + FLP MLE N GH+VCISS A +     +S Y ASK   YG  E+ H  +K     
Sbjct: 151 WTYKAFLPAMLEANHGHLVCISSFAGIVGINELSDYCASKFAAYGFAESLHFELKLLQKS 210

Query: 145 MLWGTTVTTP 154
            +  TT+  P
Sbjct: 211 KI-NTTIVCP 219





Bos taurus (taxid: 9913)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q7TQA3|RDHE2_MOUSE Epidermal retinol dehydrogenase 2 OS=Mus musculus GN=Sdr16c5 PE=2 SV=1 Back     alignment and function description
>sp|A1L1W4|RD10A_DANRE Retinol dehydrogenase 10-A OS=Danio rerio GN=rdh10a PE=2 SV=1 Back     alignment and function description
>sp|Q05A13|S16C6_MOUSE Short-chain dehydrogenase/reductase family 16C member 6 OS=Mus musculus GN=Sdr16c6 PE=2 SV=1 Back     alignment and function description
>sp|Q80ZF7|RDH10_RAT Retinol dehydrogenase 10 OS=Rattus norvegicus GN=Rdh10 PE=1 SV=1 Back     alignment and function description
>sp|Q8VCH7|RDH10_MOUSE Retinol dehydrogenase 10 OS=Mus musculus GN=Rdh10 PE=1 SV=2 Back     alignment and function description
>sp|Q8IZV5|RDH10_HUMAN Retinol dehydrogenase 10 OS=Homo sapiens GN=RDH10 PE=1 SV=1 Back     alignment and function description
>sp|Q8HZT6|RDH10_BOVIN Retinol dehydrogenase 10 OS=Bos taurus GN=RDH10 PE=1 SV=1 Back     alignment and function description
>sp|Q7T2D1|RD10B_DANRE Retinol dehydrogenase 10-B OS=Danio rerio GN=rdh10b PE=2 SV=2 Back     alignment and function description
>sp|Q8N3Y7|RDHE2_HUMAN Epidermal retinol dehydrogenase 2 OS=Homo sapiens GN=SDR16C5 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query182
328707668 324 PREDICTED: estradiol 17-beta-dehydrogena 0.582 0.327 0.495 9e-21
332373474 312 unknown [Dendroctonus ponderosae] 0.576 0.336 0.490 5e-19
442753851 385 Putative hydroxysteroid 17-beta dehydrog 0.560 0.264 0.456 2e-18
241743320 364 short-chain dehydrogenase, putative [Ixo 0.560 0.280 0.456 2e-18
307180161 312 Epidermal retinal dehydrogenase 2 [Campo 0.604 0.352 0.414 7e-17
383864620 316 PREDICTED: short-chain dehydrogenase/red 0.560 0.322 0.436 7e-17
254572235 316 Putative protein of unknown function wit 0.604 0.348 0.423 9e-17
357602501 327 short-chain dehydrogenase [Danaus plexip 0.576 0.321 0.415 9e-17
255731656 349 conserved hypothetical protein [Candida 0.648 0.338 0.403 1e-16
332030877 306 Short chain dehydrogenase/reductase fami 0.604 0.359 0.405 1e-16
>gi|328707668|ref|XP_001952321.2| PREDICTED: estradiol 17-beta-dehydrogenase 11-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  105 bits (262), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 53/107 (49%), Positives = 77/107 (71%), Gaps = 1/107 (0%)

Query: 27  AVYFKADVSDKAEIKKLNENVR-KIGYVDILINNAGIVASSSVLAHTDHEIERIMDVNLM 85
           A ++  +V++ +++ +L + V  K G VD+LINNAGIVAS+ ++  TD +I+R++DVNL+
Sbjct: 116 ADFYTTNVAEPSQVNELAKAVEEKWGKVDVLINNAGIVASAPLMDTTDEQIKRMIDVNLV 175

Query: 86  SNIKMVREFLPDMLENNTGHIVCISSIAALTAAVNVSAYFASKYGVT 132
           S+  MVR FLP M + N GHIV  SS+AA T A N+  Y A+KYGVT
Sbjct: 176 SHFWMVRAFLPAMRKRNEGHIVATSSVAAFTCAANIVPYAATKYGVT 222




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|332373474|gb|AEE61878.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|442753851|gb|JAA69085.1| Putative hydroxysteroid 17-beta dehydrogenase 11 [Ixodes ricinus] Back     alignment and taxonomy information
>gi|241743320|ref|XP_002412414.1| short-chain dehydrogenase, putative [Ixodes scapularis] gi|215505743|gb|EEC15237.1| short-chain dehydrogenase, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|307180161|gb|EFN68195.1| Epidermal retinal dehydrogenase 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383864620|ref|XP_003707776.1| PREDICTED: short-chain dehydrogenase/reductase family 16C member 6-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|254572235|ref|XP_002493227.1| Putative protein of unknown function with similarity to acyl-carrier-protein reductases [Komagataella pastoris GS115] gi|238033025|emb|CAY71048.1| Putative protein of unknown function with similarity to acyl-carrier-protein reductases [Komagataella pastoris GS115] gi|328352759|emb|CCA39157.1| Retinol dehydrogenase 10-A [Komagataella pastoris CBS 7435] Back     alignment and taxonomy information
>gi|357602501|gb|EHJ63420.1| short-chain dehydrogenase [Danaus plexippus] Back     alignment and taxonomy information
>gi|255731656|ref|XP_002550752.1| conserved hypothetical protein [Candida tropicalis MYA-3404] gi|240131761|gb|EER31320.1| conserved hypothetical protein [Candida tropicalis MYA-3404] Back     alignment and taxonomy information
>gi|332030877|gb|EGI70513.1| Short chain dehydrogenase/reductase family 16C member 6 [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query182
UNIPROTKB|A5PJJ7316 SDR16C6 "Short-chain dehydroge 0.681 0.392 0.392 1.6e-17
UNIPROTKB|E1BS37299 HSD17B11 "Uncharacterized prot 0.598 0.364 0.4 2e-17
UNIPROTKB|F1NPQ5285 F1NPQ5 "Uncharacterized protei 0.582 0.371 0.392 6.7e-17
CGD|CAL0003030 345 orf19.6502 [Candida albicans ( 0.604 0.318 0.405 7.4e-17
RGD|1562060316 Sdr16c6 "short chain dehydroge 0.587 0.338 0.422 1.6e-16
FB|FBgn0032405318 CG14946 [Drosophila melanogast 0.571 0.327 0.377 2.9e-16
MGI|MGI:2668443309 Sdr16c5 "short chain dehydroge 0.725 0.427 0.371 5.2e-16
RGD|1565999309 Sdr16c5 "short chain dehydroge 0.549 0.323 0.425 5.2e-16
ZFIN|ZDB-GENE-070112-2242339 rdh10a "retinol dehydrogenase 0.697 0.374 0.386 5.7e-16
MGI|MGI:2685269316 Sdr16c6 "short chain dehydroge 0.587 0.338 0.412 6.2e-16
UNIPROTKB|A5PJJ7 SDR16C6 "Short-chain dehydrogenase/reductase family 16C member 6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 214 (80.4 bits), Expect = 1.6e-17, P = 1.6e-17
 Identities = 51/130 (39%), Positives = 73/130 (56%)

Query:    30 FKADVSDKAEIKKLNENVRK-IGYVDILINNAGIVASSSVLAHTDHEIERIMDVNLMSNI 88
             +  D S++ ++ ++ + V+K +G V ILINNAG+V     L   DH +ER   VN+MS+ 
Sbjct:    91 YTCDCSNRQDVYRVADQVKKEVGNVTILINNAGVVTGREFLKTPDHMVERSFLVNVMSHF 150

Query:    89 KMVREFLPDMLENNTGHIVCISSIAALTAAVNVSAYFASK---YGVTEN-HPSIKCFSGY 144
                + FLP MLE N GH+VCISS A +     +S Y ASK   YG  E+ H  +K     
Sbjct:   151 WTYKAFLPAMLEANHGHLVCISSFAGIVGINELSDYCASKFAAYGFAESLHFELKLLQKS 210

Query:   145 MLWGTTVTTP 154
              +  TT+  P
Sbjct:   211 KI-NTTIVCP 219




GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
UNIPROTKB|E1BS37 HSD17B11 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NPQ5 F1NPQ5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
CGD|CAL0003030 orf19.6502 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
RGD|1562060 Sdr16c6 "short chain dehydrogenase/reductase family 16C, member 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0032405 CG14946 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:2668443 Sdr16c5 "short chain dehydrogenase/reductase family 16C, member 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1565999 Sdr16c5 "short chain dehydrogenase/reductase family 16C, member 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070112-2242 rdh10a "retinol dehydrogenase 10a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:2685269 Sdr16c6 "short chain dehydrogenase/reductase family 16C, member 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
cd05339243 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hy 1e-36
cd05233234 cd05233, SDR_c, classical (c) SDRs 3e-31
PRK07666239 PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-25
cd05374248 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxyster 4e-25
PRK05565247 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) 4e-24
COG0300265 COG0300, DltE, Short-chain dehydrogenases of vario 3e-23
PRK07201657 PRK07201, PRK07201, short chain dehydrogenase; Pro 4e-22
PRK05872296 PRK05872, PRK05872, short chain dehydrogenase; Pro 1e-21
cd08939239 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine 6e-21
PRK05557248 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) 7e-21
COG4221246 COG4221, COG4221, Short-chain alcohol dehydrogenas 8e-21
PRK05653246 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-20
COG1028251 COG1028, FabG, Dehydrogenases with different speci 2e-20
PRK12825249 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) 3e-20
cd05323244 cd05323, ADH_SDR_c_like, insect type alcohol dehyd 4e-20
cd05332257 cd05332, 11beta-HSD1_like_SDR_c, 11beta-hydroxyste 2e-19
PRK05855582 PRK05855, PRK05855, short chain dehydrogenase; Val 3e-19
PRK06550235 PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) 3e-19
PRK06398258 PRK06398, PRK06398, aldose dehydrogenase; Validate 3e-18
PRK07825273 PRK07825, PRK07825, short chain dehydrogenase; Pro 4e-18
cd05333240 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein 4e-18
PRK06463255 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) 8e-18
cd08940258 cd08940, HBDH_SDR_c, d-3-hydroxybutyrate dehydroge 1e-17
PRK12939250 PRK12939, PRK12939, short chain dehydrogenase; Pro 1e-17
TIGR01830239 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier 3e-17
cd05344253 cd05344, BKR_like_SDR_like, putative beta-ketoacyl 4e-17
PRK12828239 PRK12828, PRK12828, short chain dehydrogenase; Pro 7e-17
PRK07231251 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) 8e-17
cd05347248 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogena 9e-17
cd05341247 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta 2e-16
cd08944246 cd08944, SDR_c12, classical (c) SDR, subgroup 12 4e-16
cd05324225 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicu 4e-16
PRK06172253 PRK06172, PRK06172, short chain dehydrogenase; Pro 4e-16
cd05368241 cd05368, DHRS6_like_SDR_c, human DHRS6-like, class 5e-16
cd08934243 cd08934, CAD_SDR_c, clavulanic acid dehydrogenase 7e-16
TIGR04316250 TIGR04316, dhbA_paeA, 2,3-dihydro-2,3-dihydroxyben 9e-16
cd05362243 cd05362, THN_reductase-like_SDR_c, tetrahydroxynap 1e-15
PRK05650270 PRK05650, PRK05650, short chain dehydrogenase; Pro 1e-15
PRK12826251 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-prote 1e-15
PRK07832272 PRK07832, PRK07832, short chain dehydrogenase; Pro 2e-15
PRK12824245 PRK12824, PRK12824, acetoacetyl-CoA reductase; Pro 3e-15
cd05346249 cd05346, SDR_c5, classical (c) SDR, subgroup 5 5e-15
PRK07454241 PRK07454, PRK07454, short chain dehydrogenase; Pro 5e-15
cd05358253 cd05358, GlcDH_SDR_c, glucose 1 dehydrogenase (Glc 5e-15
TIGR01832248 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogena 7e-15
pfam00106167 pfam00106, adh_short, short chain dehydrogenase 8e-15
PRK06180277 PRK06180, PRK06180, short chain dehydrogenase; Pro 9e-15
PRK05866293 PRK05866, PRK05866, short chain dehydrogenase; Pro 1e-14
cd05366257 cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol 1e-14
cd08932223 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like 1e-14
PRK06181263 PRK06181, PRK06181, short chain dehydrogenase; Pro 1e-14
cd05354235 cd05354, SDR_c7, classical (c) SDR, subgroup 7 2e-14
cd09806258 cd09806, type1_17beta-HSD-like_SDR_c, human estrog 2e-14
PRK06935258 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrog 2e-14
PRK12429258 PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenas 2e-14
PRK12829264 PRK12829, PRK12829, short chain dehydrogenase; Pro 3e-14
PRK08264238 PRK08264, PRK08264, short chain dehydrogenase; Val 3e-14
PRK06484 520 PRK06484, PRK06484, short chain dehydrogenase; Val 4e-14
PRK05876275 PRK05876, PRK05876, short chain dehydrogenase; Pro 5e-14
TIGR01963255 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase 6e-14
cd05359242 cd05359, ChcA_like_SDR_c, 1-cyclohexenylcarbonyl_c 6e-14
PRK07097265 PRK07097, PRK07097, gluconate 5-dehydrogenase; Pro 7e-14
PRK07831262 PRK07831, PRK07831, short chain dehydrogenase; Pro 7e-14
PRK06194287 PRK06194, PRK06194, hypothetical protein; Provisio 7e-14
cd05345248 cd05345, BKR_3_SDR_c, putative beta-ketoacyl acyl 8e-14
PRK06914280 PRK06914, PRK06914, short chain dehydrogenase; Pro 9e-14
TIGR02415254 TIGR02415, 23BDH, acetoin reductases 1e-13
PRK08324681 PRK08324, PRK08324, short chain dehydrogenase; Val 2e-13
cd05330257 cd05330, cyclohexanol_reductase_SDR_c, cyclohexano 2e-13
PRK12936245 PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-prote 3e-13
PRK08263275 PRK08263, PRK08263, short chain dehydrogenase; Pro 3e-13
PRK07063260 PRK07063, PRK07063, short chain dehydrogenase; Pro 5e-13
cd05373238 cd05373, SDR_c10, classical (c) SDR, subgroup 10 5e-13
PRK12827249 PRK12827, PRK12827, short chain dehydrogenase; Pro 6e-13
TIGR03971265 TIGR03971, SDR_subfam_1, oxidoreductase, SDR famil 7e-13
cd05360233 cd05360, SDR_c3, classical (c) SDR, subgroup 3 1e-12
PRK07069251 PRK07069, PRK07069, short chain dehydrogenase; Val 1e-12
PRK07060245 PRK07060, PRK07060, short chain dehydrogenase; Pro 2e-12
PRK12935247 PRK12935, PRK12935, acetoacetyl-CoA reductase; Pro 2e-12
cd05338246 cd05338, DHRS1_HSDL2-like_SDR_c, human dehydrogena 2e-12
PRK08220252 PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehy 3e-12
PRK06523260 PRK06523, PRK06523, short chain dehydrogenase; Pro 4e-12
cd05329251 cd05329, TR_SDR_c, tropinone reductase-I and II (T 4e-12
cd05350239 cd05350, SDR_c6, classical (c) SDR, subgroup 6 4e-12
PRK06482276 PRK06482, PRK06482, short chain dehydrogenase; Pro 6e-12
cd08943250 cd08943, R1PA_ADH_SDR_c, rhamnulose-1-phosphate al 6e-12
PRK06138252 PRK06138, PRK06138, short chain dehydrogenase; Pro 6e-12
PRK06077252 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) 7e-12
PRK06179270 PRK06179, PRK06179, short chain dehydrogenase; Pro 8e-12
PRK06841255 PRK06841, PRK06841, short chain dehydrogenase; Pro 1e-11
PRK08213259 PRK08213, PRK08213, gluconate 5-dehydrogenase; Pro 1e-11
PRK06484520 PRK06484, PRK06484, short chain dehydrogenase; Val 2e-11
cd08937256 cd08937, DHB_DH-like_SDR_c, 1,6-dihydroxycyclohexa 2e-11
cd05343250 cd05343, Mgc4172-like_SDR_c, human Mgc4172-like, c 2e-11
cd08945258 cd08945, PKR_SDR_c, Polyketide ketoreductase, clas 2e-11
cd05367241 cd05367, SPR-like_SDR_c, sepiapterin reductase (SP 3e-11
PRK06171266 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydro 3e-11
cd05356239 cd05356, 17beta-HSD1_like_SDR_c, 17-beta-hydroxyst 3e-11
PRK08589272 PRK08589, PRK08589, short chain dehydrogenase; Val 3e-11
cd05325233 cd05325, carb_red_sniffer_like_SDR_c, carbonyl red 4e-11
cd05364253 cd05364, SDR_c11, classical (c) SDR, subgroup 11 4e-11
cd05352252 cd05352, MDH-like_SDR_c, mannitol dehydrogenase (M 5e-11
PRK09072263 PRK09072, PRK09072, short chain dehydrogenase; Pro 6e-11
TIGR02632676 TIGR02632, RhaD_aldol-ADH, rhamnulose-1-phosphate 7e-11
PRK08277278 PRK08277, PRK08277, D-mannonate oxidoreductase; Pr 9e-11
PRK07326237 PRK07326, PRK07326, short chain dehydrogenase; Pro 9e-11
cd08935271 cd08935, mannonate_red_SDR_c, putative D-mannonate 1e-10
PRK08226263 PRK08226, PRK08226, short chain dehydrogenase; Pro 1e-10
cd08929226 cd08929, SDR_c4, classical (c) SDR, subgroup 4 1e-10
PRK06124256 PRK06124, PRK06124, gluconate 5-dehydrogenase; Pro 1e-10
cd05353250 cd05353, hydroxyacyl-CoA-like_DH_SDR_c-like, (3R)- 2e-10
TIGR01829242 TIGR01829, AcAcCoA_reduct, acetoacetyl-CoA reducta 2e-10
PRK09242257 PRK09242, PRK09242, tropinone reductase; Provision 3e-10
PRK06057255 PRK06057, PRK06057, short chain dehydrogenase; Pro 4e-10
PRK12937245 PRK12937, PRK12937, short chain dehydrogenase; Pro 4e-10
PRK08219227 PRK08219, PRK08219, short chain dehydrogenase; Pro 4e-10
PRK09291257 PRK09291, PRK09291, short chain dehydrogenase; Pro 4e-10
PRK08628258 PRK08628, PRK08628, short chain dehydrogenase; Pro 5e-10
cd05371252 cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydr 7e-10
PRK07109 334 PRK07109, PRK07109, short chain dehydrogenase; Pro 7e-10
cd09761242 cd09761, A3DFK9-like_SDR_c, Clostridium thermocell 8e-10
PRK07074257 PRK07074, PRK07074, short chain dehydrogenase; Pro 1e-09
cd09805281 cd09805, type2_17beta_HSD-like_SDR_c, human 17beta 2e-09
cd05351244 cd05351, XR_like_SDR_c, xylulose reductase-like, c 2e-09
cd05370228 cd05370, SDR_c2, classical (c) SDR, subgroup 2 2e-09
cd05331244 cd05331, DH-DHB-DH_SDR_c, 2,3 dihydro-2,3 dihydroz 3e-09
PRK12384259 PRK12384, PRK12384, sorbitol-6-phosphate dehydroge 5e-09
cd05326249 cd05326, secoisolariciresinol-DH_like_SDR_c, secoi 5e-09
PRK12481251 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrog 6e-09
cd05365242 cd05365, 7_alpha_HSDH_SDR_c, 7 alpha-hydroxysteroi 7e-09
PRK07890258 PRK07890, PRK07890, short chain dehydrogenase; Pro 7e-09
PRK06182273 PRK06182, PRK06182, short chain dehydrogenase; Val 7e-09
PRK06198260 PRK06198, PRK06198, short chain dehydrogenase; Pro 9e-09
PRK12823260 PRK12823, benD, 1,6-dihydroxycyclohexa-2,4-diene-1 1e-08
PRK06947248 PRK06947, PRK06947, glucose-1-dehydrogenase; Provi 1e-08
PRK12745256 PRK12745, PRK12745, 3-ketoacyl-(acyl-carrier-prote 1e-08
PRK08217253 PRK08217, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-08
PRK08063250 PRK08063, PRK08063, enoyl-(acyl carrier protein) r 2e-08
PRK08267260 PRK08267, PRK08267, short chain dehydrogenase; Pro 2e-08
PRK06123248 PRK06123, PRK06123, short chain dehydrogenase; Pro 2e-08
cd05322257 cd05322, SDH_SDR_c_like, Sorbitol 6-phosphate dehy 3e-08
PRK07856252 PRK07856, PRK07856, short chain dehydrogenase; Pro 3e-08
PRK07067257 PRK07067, PRK07067, sorbitol dehydrogenase; Provis 4e-08
TIGR03206250 TIGR03206, benzo_BadH, 2-hydroxycyclohexanecarboxy 4e-08
PRK05693274 PRK05693, PRK05693, short chain dehydrogenase; Pro 5e-08
cd08933261 cd08933, RDH_SDR_c, retinal dehydrogenase-like, cl 5e-08
PLN02253280 PLN02253, PLN02253, xanthoxin dehydrogenase 6e-08
PRK13394262 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenas 6e-08
PRK07062265 PRK07062, PRK07062, short chain dehydrogenase; Pro 7e-08
PRK10538248 PRK10538, PRK10538, malonic semialdehyde reductase 1e-07
PRK08993253 PRK08993, PRK08993, 2-deoxy-D-gluconate 3-dehydrog 2e-07
PRK08261450 PRK08261, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-07
PRK07478254 PRK07478, PRK07478, short chain dehydrogenase; Pro 3e-07
PRK07775274 PRK07775, PRK07775, short chain dehydrogenase; Pro 3e-07
cd05357234 cd05357, PR_SDR_c, pteridine reductase (PR), class 4e-07
cd11731198 cd11731, Lin1944_like_SDR_c, Lin1944 and related p 4e-07
cd05337255 cd05337, BKR_1_SDR_c, putative beta-ketoacyl acyl 5e-07
cd08930250 cd08930, SDR_c8, classical (c) SDR, subgroup 8 7e-07
PRK07024257 PRK07024, PRK07024, short chain dehydrogenase; Pro 8e-07
cd08942250 cd08942, RhlG_SDR_c, RhlG and related beta-ketoacy 9e-07
cd02266186 cd02266, SDR, Short-chain dehydrogenases/reductase 1e-06
PRK08265261 PRK08265, PRK08265, short chain dehydrogenase; Pro 1e-06
PRK08936261 PRK08936, PRK08936, glucose-1-dehydrogenase; Provi 2e-06
PRK07577234 PRK07577, PRK07577, short chain dehydrogenase; Pro 2e-06
COG3967245 COG3967, DltE, Short-chain dehydrogenase involved 2e-06
cd05327269 cd05327, retinol-DH_like_SDR_c_like, retinol dehyd 2e-06
PRK12938246 PRK12938, PRK12938, acetyacetyl-CoA reductase; Pro 2e-06
cd08936256 cd08936, CR_SDR_c, Porcine peroxisomal carbonyl re 2e-06
cd05348257 cd05348, BphB-like_SDR_c, cis-biphenyl-2,3-dihydro 3e-06
PRK06114254 PRK06114, PRK06114, short chain dehydrogenase; Pro 4e-06
PRK07774250 PRK07774, PRK07774, short chain dehydrogenase; Pro 4e-06
PRK08643256 PRK08643, PRK08643, acetoin reductase; Validated 5e-06
cd05334221 cd05334, DHPR_SDR_c_like, dihydropteridine reducta 6e-06
PRK06125259 PRK06125, PRK06125, short chain dehydrogenase; Pro 6e-06
PRK08085254 PRK08085, PRK08085, gluconate 5-dehydrogenase; Pro 7e-06
cd08931227 cd08931, SDR_c9, classical (c) SDR, subgroup 9 1e-05
cd05340236 cd05340, Ycik_SDR_c, Escherichia coli K-12 YCIK-li 2e-05
PRK07792306 PRK07792, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-05
pfam13561239 pfam13561, adh_short_C2, Enoyl-(Acyl carrier prote 3e-05
cd05328250 cd05328, 3alpha_HSD_SDR_c, alpha hydroxysteroid de 3e-05
cd05363254 cd05363, SDH_SDR_c, Sorbitol dehydrogenase (SDH), 4e-05
PLN02780320 PLN02780, PLN02780, ketoreductase/ oxidoreductase 4e-05
PRK12746254 PRK12746, PRK12746, short chain dehydrogenase; Pro 5e-05
PRK09730247 PRK09730, PRK09730, putative NAD(P)-binding oxidor 7e-05
cd11730206 cd11730, Tthb094_like_SDR_c, Tthb094 and related p 7e-05
PRK06113255 PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydro 7e-05
PRK06500249 PRK06500, PRK06500, short chain dehydrogenase; Pro 1e-04
PRK12742237 PRK12742, PRK12742, oxidoreductase; Provisional 1e-04
PRK06701290 PRK06701, PRK06701, short chain dehydrogenase; Pro 1e-04
cd05355270 cd05355, SDR_c1, classical (c) SDR, subgroup 1 1e-04
PRK12744257 PRK12744, PRK12744, short chain dehydrogenase; Pro 2e-04
PRK07523255 PRK07523, PRK07523, gluconate 5-dehydrogenase; Pro 3e-04
cd08951260 cd08951, DR_C-13_KR_SDR_c_like, daunorubicin C-13 3e-04
cd05349246 cd05349, BKR_2_SDR_c, putative beta-ketoacyl acyl 4e-04
PRK06949258 PRK06949, PRK06949, short chain dehydrogenase; Pro 4e-04
PRK06940275 PRK06940, PRK06940, short chain dehydrogenase; Pro 6e-04
PRK06200263 PRK06200, PRK06200, 2,3-dihydroxy-2,3-dihydropheny 8e-04
cd09762243 cd09762, HSDL2_SDR_c, human hydroxysteroid dehydro 0.001
PRK05867253 PRK05867, PRK05867, short chain dehydrogenase; Pro 0.002
PRK12747252 PRK12747, PRK12747, short chain dehydrogenase; Pro 0.003
cd08953436 cd08953, KR_2_SDR_x, ketoreductase (KR), subgroup 0.003
cd05369249 cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reducta 0.003
PRK08017256 PRK08017, PRK08017, oxidoreductase; Provisional 0.004
PRK08251248 PRK08251, PRK08251, short chain dehydrogenase; Pro 0.004
>gnl|CDD|187598 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hydroxysteroid dehydrogenase XI-like, classical (c) SDRs Back     alignment and domain information
 Score =  126 bits (320), Expect = 1e-36
 Identities = 47/128 (36%), Positives = 69/128 (53%), Gaps = 13/128 (10%)

Query: 27  AVYFKADVSDKAEIKKLNENVRK-IGYVDILINNAGIVASSSVLAHTDHEIERIMDVNLM 85
             Y+K DVS + E+ +  + ++K +G V ILINNAG+V+   +L   D EIE+  +VN +
Sbjct: 50  VHYYKCDVSKREEVYEAAKKIKKEVGDVTILINNAGVVSGKKLLELPDEEIEKTFEVNTL 109

Query: 86  SNIKMVREFLPDMLENNTGHIVCISSIAALTAAVNVSAYFASKYGV------------TE 133
           ++    + FLPDMLE N GHIV I+S+A L +   ++ Y ASK                 
Sbjct: 110 AHFWTTKAFLPDMLERNHGHIVTIASVAGLISPAGLADYCASKAAAVGFHESLRLELKAY 169

Query: 134 NHPSIKCF 141
             P IK  
Sbjct: 170 GKPGIKTT 177


17-beta-hydroxysteroid dehydrogenases (17betaHSD) are a group of isozymes that catalyze activation and inactivation of estrogen and androgens. 17betaHSD type XI, a classical SDR, preferentially converts 3alpha-adiol to androsterone but not numerous other tested steroids. This subgroup of classical SDRs also includes members identified as retinol dehydrogenases, which convert retinol to retinal, a property that overlaps with 17betaHSD activity. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs. Length = 243

>gnl|CDD|212491 cd05233, SDR_c, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236074 PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187632 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235506 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|223377 COG0300, DltE, Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>gnl|CDD|235962 PRK07201, PRK07201, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235633 PRK05872, PRK05872, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187643 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine reductase (KDSR) and related proteins, classical (c) SDR Back     alignment and domain information
>gnl|CDD|235500 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|226674 COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>gnl|CDD|235546 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|223959 COG1028, FabG, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|237218 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187584 cd05323, ADH_SDR_c_like, insect type alcohol dehydrogenase (ADH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187593 cd05332, 11beta-HSD1_like_SDR_c, 11beta-hydroxysteroid dehydrogenase type 1 (11beta-HSD1)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235628 PRK05855, PRK05855, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180617 PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|235794 PRK06398, PRK06398, aldose dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181136 PRK07825, PRK07825, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187594 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein reductase (BKR), involved in Type II FAS, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180576 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187644 cd08940, HBDH_SDR_c, d-3-hydroxybutyrate dehydrogenase (HBDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|183833 PRK12939, PRK12939, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|233590 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>gnl|CDD|187602 cd05344, BKR_like_SDR_like, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR)-like, SDR Back     alignment and domain information
>gnl|CDD|237220 PRK12828, PRK12828, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235975 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187605 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogenase (Ga5DH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187600 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187648 cd08944, SDR_c12, classical (c) SDR, subgroup 12 Back     alignment and domain information
>gnl|CDD|187585 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicular carbonyl reductase (PTCR)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180440 PRK06172, PRK06172, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187626 cd05368, DHRS6_like_SDR_c, human DHRS6-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187639 cd08934, CAD_SDR_c, clavulanic acid dehydrogenase (CAD), classical (c) SDR Back     alignment and domain information
>gnl|CDD|213929 TIGR04316, dhbA_paeA, 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase Back     alignment and domain information
>gnl|CDD|187620 cd05362, THN_reductase-like_SDR_c, tetrahydroxynaphthalene/trihydroxynaphthalene reductase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235545 PRK05650, PRK05650, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183775 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>gnl|CDD|181139 PRK07832, PRK07832, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183773 PRK12824, PRK12824, acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|187604 cd05346, SDR_c5, classical (c) SDR, subgroup 5 Back     alignment and domain information
>gnl|CDD|180984 PRK07454, PRK07454, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187616 cd05358, GlcDH_SDR_c, glucose 1 dehydrogenase (GlcDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|188170 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>gnl|CDD|215720 pfam00106, adh_short, short chain dehydrogenase Back     alignment and domain information
>gnl|CDD|180446 PRK06180, PRK06180, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235631 PRK05866, PRK05866, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187624 cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|212493 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|235726 PRK06181, PRK06181, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187612 cd05354, SDR_c7, classical (c) SDR, subgroup 7 Back     alignment and domain information
>gnl|CDD|187666 cd09806, type1_17beta-HSD-like_SDR_c, human estrogenic 17beta-hydroxysteroid dehydrogenase type 1 (type 1 17beta-HSD)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180761 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237100 PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183778 PRK12829, PRK12829, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181335 PRK08264, PRK08264, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|135637 PRK05876, PRK05876, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|211705 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>gnl|CDD|187617 cd05359, ChcA_like_SDR_c, 1-cyclohexenylcarbonyl_coenzyme A_reductase (ChcA)_like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235933 PRK07097, PRK07097, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236110 PRK07831, PRK07831, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180458 PRK06194, PRK06194, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|187603 cd05345, BKR_3_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR), subgroup 3, classical (c) SDR Back     alignment and domain information
>gnl|CDD|180744 PRK06914, PRK06914, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|131468 TIGR02415, 23BDH, acetoin reductases Back     alignment and domain information
>gnl|CDD|236241 PRK08324, PRK08324, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187591 cd05330, cyclohexanol_reductase_SDR_c, cyclohexanol reductases, including levodione reductase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|171820 PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>gnl|CDD|181334 PRK08263, PRK08263, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235924 PRK07063, PRK07063, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187631 cd05373, SDR_c10, classical (c) SDR, subgroup 10 Back     alignment and domain information
>gnl|CDD|237219 PRK12827, PRK12827, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|234422 TIGR03971, SDR_subfam_1, oxidoreductase, SDR family Back     alignment and domain information
>gnl|CDD|187618 cd05360, SDR_c3, classical (c) SDR, subgroup 3 Back     alignment and domain information
>gnl|CDD|180822 PRK07069, PRK07069, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180817 PRK07060, PRK07060, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183832 PRK12935, PRK12935, acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|187597 cd05338, DHRS1_HSDL2-like_SDR_c, human dehydrogenase/reductase (SDR family) member 1 (DHRS1) and human hydroxysteroid dehydrogenase-like protein 2 (HSDL2), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236190 PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180604 PRK06523, PRK06523, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187590 cd05329, TR_SDR_c, tropinone reductase-I and II (TR-1, and TR-II)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187608 cd05350, SDR_c6, classical (c) SDR, subgroup 6 Back     alignment and domain information
>gnl|CDD|235813 PRK06482, PRK06482, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187647 cd08943, R1PA_ADH_SDR_c, rhamnulose-1-phosphate aldolase/alcohol dehydrogenase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235712 PRK06138, PRK06138, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235693 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|235725 PRK06179, PRK06179, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180723 PRK06841, PRK06841, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181295 PRK08213, PRK08213, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187642 cd08937, DHB_DH-like_SDR_c, 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase (DHB DH)-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187601 cd05343, Mgc4172-like_SDR_c, human Mgc4172-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187649 cd08945, PKR_SDR_c, Polyketide ketoreductase, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187625 cd05367, SPR-like_SDR_c, sepiapterin reductase (SPR)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180439 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187614 cd05356, 17beta-HSD1_like_SDR_c, 17-beta-hydroxysteroid dehydrogenases (17beta-HSDs) types -1, -3, and -12, -like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181491 PRK08589, PRK08589, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187586 cd05325, carb_red_sniffer_like_SDR_c, carbonyl reductase sniffer-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187622 cd05364, SDR_c11, classical (c) SDR, subgroup 11 Back     alignment and domain information
>gnl|CDD|187610 cd05352, MDH-like_SDR_c, mannitol dehydrogenase (MDH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236372 PRK09072, PRK09072, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|131680 TIGR02632, RhaD_aldol-ADH, rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|236216 PRK08277, PRK08277, D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|235990 PRK07326, PRK07326, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187640 cd08935, mannonate_red_SDR_c, putative D-mannonate oxidoreductase, classical (c) SDR Back     alignment and domain information
>gnl|CDD|181305 PRK08226, PRK08226, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187634 cd08929, SDR_c4, classical (c) SDR, subgroup 4 Back     alignment and domain information
>gnl|CDD|235702 PRK06124, PRK06124, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187611 cd05353, hydroxyacyl-CoA-like_DH_SDR_c-like, (3R)-hydroxyacyl-CoA dehydrogenase-like, classical(c)-like SDRs Back     alignment and domain information
>gnl|CDD|188169 TIGR01829, AcAcCoA_reduct, acetoacetyl-CoA reductase Back     alignment and domain information
>gnl|CDD|181721 PRK09242, PRK09242, tropinone reductase; Provisional Back     alignment and domain information
>gnl|CDD|180371 PRK06057, PRK06057, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|171821 PRK12937, PRK12937, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181298 PRK08219, PRK08219, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181762 PRK09291, PRK09291, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181508 PRK08628, PRK08628, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187629 cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydrogenase type 10 (HSD10)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235935 PRK07109, PRK07109, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187662 cd09761, A3DFK9-like_SDR_c, Clostridium thermocellum A3DFK9-like, a putative carbohydrate or polyalcohol metabolizing SDR, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180823 PRK07074, PRK07074, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187665 cd09805, type2_17beta_HSD-like_SDR_c, human 17beta-hydroxysteroid dehydrogenase type 2 (type 2 17beta-HSD)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187609 cd05351, XR_like_SDR_c, xylulose reductase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187628 cd05370, SDR_c2, classical (c) SDR, subgroup 2 Back     alignment and domain information
>gnl|CDD|187592 cd05331, DH-DHB-DH_SDR_c, 2,3 dihydro-2,3 dihydrozybenzoate dehydrogenases, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|183489 PRK12384, PRK12384, sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187587 cd05326, secoisolariciresinol-DH_like_SDR_c, secoisolariciresinol dehydrogenase (secoisolariciresinol-DH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|171531 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187623 cd05365, 7_alpha_HSDH_SDR_c, 7 alpha-hydroxysteroid dehydrogenase (7 alpha-HSDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181159 PRK07890, PRK07890, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180448 PRK06182, PRK06182, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180462 PRK06198, PRK06198, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183772 PRK12823, benD, 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180771 PRK06947, PRK06947, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237188 PRK12745, PRK12745, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181297 PRK08217, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|236145 PRK08063, PRK08063, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|236210 PRK08267, PRK08267, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180411 PRK06123, PRK06123, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187583 cd05322, SDH_SDR_c_like, Sorbitol 6-phosphate dehydrogenase (SDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236116 PRK07856, PRK07856, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235925 PRK07067, PRK07067, sorbitol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|132250 TIGR03206, benzo_BadH, 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|168186 PRK05693, PRK05693, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187638 cd08933, RDH_SDR_c, retinal dehydrogenase-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|177895 PLN02253, PLN02253, xanthoxin dehydrogenase Back     alignment and domain information
>gnl|CDD|184025 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180818 PRK07062, PRK07062, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|182531 PRK10538, PRK10538, malonic semialdehyde reductase; Provisional Back     alignment and domain information
>gnl|CDD|181605 PRK08993, PRK08993, 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|236207 PRK08261, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180993 PRK07478, PRK07478, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181113 PRK07775, PRK07775, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187615 cd05357, PR_SDR_c, pteridine reductase (PR), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|212497 cd11731, Lin1944_like_SDR_c, Lin1944 and related proteins, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187596 cd05337, BKR_1_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR), subgroup 1, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187635 cd08930, SDR_c8, classical (c) SDR, subgroup 8 Back     alignment and domain information
>gnl|CDD|235910 PRK07024, PRK07024, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187646 cd08942, RhlG_SDR_c, RhlG and related beta-ketoacyl reductases, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187535 cd02266, SDR, Short-chain dehydrogenases/reductases (SDR) Back     alignment and domain information
>gnl|CDD|236209 PRK08265, PRK08265, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181585 PRK08936, PRK08936, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181044 PRK07577, PRK07577, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|226476 COG3967, DltE, Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|212492 cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|171822 PRK12938, PRK12938, acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|187641 cd08936, CR_SDR_c, Porcine peroxisomal carbonyl reductase like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187606 cd05348, BphB-like_SDR_c, cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase (BphB)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180408 PRK06114, PRK06114, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236094 PRK07774, PRK07774, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181518 PRK08643, PRK08643, acetoin reductase; Validated Back     alignment and domain information
>gnl|CDD|187595 cd05334, DHPR_SDR_c_like, dihydropteridine reductase (DHPR), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235703 PRK06125, PRK06125, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181225 PRK08085, PRK08085, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187636 cd08931, SDR_c9, classical (c) SDR, subgroup 9 Back     alignment and domain information
>gnl|CDD|187599 cd05340, Ycik_SDR_c, Escherichia coli K-12 YCIK-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181120 PRK07792, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|222222 pfam13561, adh_short_C2, Enoyl-(Acyl carrier protein) reductase Back     alignment and domain information
>gnl|CDD|187589 cd05328, 3alpha_HSD_SDR_c, alpha hydroxysteroid dehydrogenase (3alpha_HSD), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187621 cd05363, SDH_SDR_c, Sorbitol dehydrogenase (SDH), classical (c) SDR Back     alignment and domain information
>gnl|CDD|166421 PLN02780, PLN02780, ketoreductase/ oxidoreductase Back     alignment and domain information
>gnl|CDD|183718 PRK12746, PRK12746, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|182051 PRK09730, PRK09730, putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|212496 cd11730, Tthb094_like_SDR_c, Tthb094 and related proteins, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|135765 PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235816 PRK06500, PRK06500, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183714 PRK12742, PRK12742, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|235853 PRK06701, PRK06701, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187613 cd05355, SDR_c1, classical (c) SDR, subgroup 1 Back     alignment and domain information
>gnl|CDD|183716 PRK12744, PRK12744, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236040 PRK07523, PRK07523, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187654 cd08951, DR_C-13_KR_SDR_c_like, daunorubicin C-13 ketoreductase (KR), classical (c)-like SDRs Back     alignment and domain information
>gnl|CDD|187607 cd05349, BKR_2_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP]reductase (BKR), subgroup 2, classical (c) SDR Back     alignment and domain information
>gnl|CDD|180773 PRK06949, PRK06949, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180766 PRK06940, PRK06940, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235739 PRK06200, PRK06200, 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187663 cd09762, HSDL2_SDR_c, human hydroxysteroid dehydrogenase-like protein 2 (HSDL2), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|135631 PRK05867, PRK05867, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183719 PRK12747, PRK12747, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187656 cd08953, KR_2_SDR_x, ketoreductase (KR), subgroup 2, complex (x) SDRs Back     alignment and domain information
>gnl|CDD|187627 cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reductase (TER) and 2,4-dienoyl-CoA reductase (DECR), atypical (a) SDR Back     alignment and domain information
>gnl|CDD|181198 PRK08017, PRK08017, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|181324 PRK08251, PRK08251, short chain dehydrogenase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 182
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 99.98
COG0300265 DltE Short-chain dehydrogenases of various substra 99.97
KOG1205|consensus282 99.97
KOG1201|consensus300 99.95
PRK08339263 short chain dehydrogenase; Provisional 99.95
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.95
PRK06398258 aldose dehydrogenase; Validated 99.95
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 99.95
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 99.94
KOG1200|consensus256 99.94
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 99.94
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 99.94
PRK07063260 short chain dehydrogenase; Provisional 99.94
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 99.94
PRK06139 330 short chain dehydrogenase; Provisional 99.94
PRK05876275 short chain dehydrogenase; Provisional 99.94
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 99.94
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 99.94
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.93
PRK07062265 short chain dehydrogenase; Provisional 99.93
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 99.93
PRK08589272 short chain dehydrogenase; Validated 99.93
PRK06114254 short chain dehydrogenase; Provisional 99.93
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 99.93
PRK07791286 short chain dehydrogenase; Provisional 99.93
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 99.93
PRK07478254 short chain dehydrogenase; Provisional 99.93
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 99.93
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 99.93
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 99.93
PRK06179270 short chain dehydrogenase; Provisional 99.93
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.93
PRK05867253 short chain dehydrogenase; Provisional 99.93
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.93
PRK08303305 short chain dehydrogenase; Provisional 99.93
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 99.93
PRK07097265 gluconate 5-dehydrogenase; Provisional 99.92
PLN02730303 enoyl-[acyl-carrier-protein] reductase 99.92
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 99.92
PRK08085254 gluconate 5-dehydrogenase; Provisional 99.92
PRK08862227 short chain dehydrogenase; Provisional 99.92
PRK05872296 short chain dehydrogenase; Provisional 99.92
PRK05993277 short chain dehydrogenase; Provisional 99.92
PLN02253280 xanthoxin dehydrogenase 99.92
PRK08265261 short chain dehydrogenase; Provisional 99.92
KOG1610|consensus322 99.92
PRK08278273 short chain dehydrogenase; Provisional 99.92
PRK05855582 short chain dehydrogenase; Validated 99.92
PRK06182273 short chain dehydrogenase; Validated 99.92
PRK07825273 short chain dehydrogenase; Provisional 99.92
PRK07523255 gluconate 5-dehydrogenase; Provisional 99.92
PRK07109 334 short chain dehydrogenase; Provisional 99.92
KOG0725|consensus270 99.92
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 99.92
PRK07856252 short chain dehydrogenase; Provisional 99.92
PRK07985294 oxidoreductase; Provisional 99.92
PRK07831262 short chain dehydrogenase; Provisional 99.92
PRK06523260 short chain dehydrogenase; Provisional 99.92
PRK06180277 short chain dehydrogenase; Provisional 99.92
PRK09242257 tropinone reductase; Provisional 99.92
PRK12747252 short chain dehydrogenase; Provisional 99.92
PRK08340259 glucose-1-dehydrogenase; Provisional 99.92
PRK06172253 short chain dehydrogenase; Provisional 99.92
PRK08277278 D-mannonate oxidoreductase; Provisional 99.91
PRK08643256 acetoin reductase; Validated 99.91
PRK05650270 short chain dehydrogenase; Provisional 99.91
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 99.91
PRK08936261 glucose-1-dehydrogenase; Provisional 99.91
PRK06483236 dihydromonapterin reductase; Provisional 99.91
PRK12743256 oxidoreductase; Provisional 99.91
PRK07024257 short chain dehydrogenase; Provisional 99.91
PRK07677252 short chain dehydrogenase; Provisional 99.91
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.91
PRK05599246 hypothetical protein; Provisional 99.91
PRK08263275 short chain dehydrogenase; Provisional 99.91
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 99.91
PRK07067257 sorbitol dehydrogenase; Provisional 99.91
PRK06128300 oxidoreductase; Provisional 99.91
PRK07035252 short chain dehydrogenase; Provisional 99.91
PRK06484520 short chain dehydrogenase; Validated 99.91
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 99.91
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 99.91
PRK12935247 acetoacetyl-CoA reductase; Provisional 99.91
PRK12938246 acetyacetyl-CoA reductase; Provisional 99.91
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 99.91
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 99.91
PRK06194287 hypothetical protein; Provisional 99.91
KOG4169|consensus261 99.91
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 99.91
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.91
PRK05717255 oxidoreductase; Validated 99.91
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 99.9
PRK08267260 short chain dehydrogenase; Provisional 99.9
PRK06124256 gluconate 5-dehydrogenase; Provisional 99.9
PRK06841255 short chain dehydrogenase; Provisional 99.9
PRK08226263 short chain dehydrogenase; Provisional 99.9
PRK06125259 short chain dehydrogenase; Provisional 99.9
PRK12824245 acetoacetyl-CoA reductase; Provisional 99.9
PRK06484 520 short chain dehydrogenase; Validated 99.9
PRK07454241 short chain dehydrogenase; Provisional 99.9
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 99.9
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 99.9
TIGR02415254 23BDH acetoin reductases. One member of this famil 99.9
PRK05866293 short chain dehydrogenase; Provisional 99.9
PRK06482276 short chain dehydrogenase; Provisional 99.9
KOG1209|consensus289 99.9
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 99.9
PRK07069251 short chain dehydrogenase; Validated 99.9
PRK07576264 short chain dehydrogenase; Provisional 99.9
PLN02780320 ketoreductase/ oxidoreductase 99.9
KOG1210|consensus331 99.89
PRK06138252 short chain dehydrogenase; Provisional 99.89
PRK05693274 short chain dehydrogenase; Provisional 99.89
PRK09134258 short chain dehydrogenase; Provisional 99.89
PRK07814263 short chain dehydrogenase; Provisional 99.89
PLN00015308 protochlorophyllide reductase 99.89
PRK07832272 short chain dehydrogenase; Provisional 99.89
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.89
PRK08628258 short chain dehydrogenase; Provisional 99.89
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.89
PRK07890258 short chain dehydrogenase; Provisional 99.89
PRK12939250 short chain dehydrogenase; Provisional 99.89
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 99.89
PRK12744257 short chain dehydrogenase; Provisional 99.89
PRK12937245 short chain dehydrogenase; Provisional 99.89
PRK07904253 short chain dehydrogenase; Provisional 99.89
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 99.89
PRK06914280 short chain dehydrogenase; Provisional 99.89
PRK06500249 short chain dehydrogenase; Provisional 99.89
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 99.89
PRK07578199 short chain dehydrogenase; Provisional 99.89
PRK07775274 short chain dehydrogenase; Provisional 99.89
PRK09072263 short chain dehydrogenase; Provisional 99.89
PRK06123248 short chain dehydrogenase; Provisional 99.89
PRK08251248 short chain dehydrogenase; Provisional 99.89
PRK08213259 gluconate 5-dehydrogenase; Provisional 99.88
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 99.88
PRK10538248 malonic semialdehyde reductase; Provisional 99.88
PRK06701290 short chain dehydrogenase; Provisional 99.88
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 99.88
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 99.88
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.88
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 99.88
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 99.88
PRK06947248 glucose-1-dehydrogenase; Provisional 99.88
PRK05854313 short chain dehydrogenase; Provisional 99.88
KOG1207|consensus245 99.88
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.88
PRK07577234 short chain dehydrogenase; Provisional 99.88
PRK06198260 short chain dehydrogenase; Provisional 99.88
PRK09186256 flagellin modification protein A; Provisional 99.87
PRK08703239 short chain dehydrogenase; Provisional 99.87
PRK05875276 short chain dehydrogenase; Provisional 99.87
PRK06197306 short chain dehydrogenase; Provisional 99.87
PRK06949258 short chain dehydrogenase; Provisional 99.87
PRK06057255 short chain dehydrogenase; Provisional 99.87
PRK12827249 short chain dehydrogenase; Provisional 99.87
PRK06940275 short chain dehydrogenase; Provisional 99.87
PRK07774250 short chain dehydrogenase; Provisional 99.87
KOG1611|consensus249 99.87
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.87
PRK07102243 short chain dehydrogenase; Provisional 99.87
PRK07201657 short chain dehydrogenase; Provisional 99.87
PRK07023243 short chain dehydrogenase; Provisional 99.87
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 99.87
PRK12746254 short chain dehydrogenase; Provisional 99.87
PRK06196315 oxidoreductase; Provisional 99.86
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.86
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 99.86
PRK05884223 short chain dehydrogenase; Provisional 99.86
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.86
COG1028251 FabG Dehydrogenases with different specificities ( 99.86
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.86
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 99.86
PRK06181263 short chain dehydrogenase; Provisional 99.86
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 99.86
PRK12428241 3-alpha-hydroxysteroid dehydrogenase; Provisional 99.86
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.86
PRK06924251 short chain dehydrogenase; Provisional 99.86
PRK06101240 short chain dehydrogenase; Provisional 99.85
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 99.85
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 99.85
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.85
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 99.85
PRK07326237 short chain dehydrogenase; Provisional 99.85
PRK07074257 short chain dehydrogenase; Provisional 99.85
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.85
PRK09009235 C factor cell-cell signaling protein; Provisional 99.85
PRK12742237 oxidoreductase; Provisional 99.84
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.84
PRK08264238 short chain dehydrogenase; Validated 99.84
PRK07453322 protochlorophyllide oxidoreductase; Validated 99.84
PRK07041230 short chain dehydrogenase; Provisional 99.84
PRK08324681 short chain dehydrogenase; Validated 99.84
PRK09291257 short chain dehydrogenase; Provisional 99.83
PRK12828239 short chain dehydrogenase; Provisional 99.83
PRK07060245 short chain dehydrogenase; Provisional 99.83
PRK12829264 short chain dehydrogenase; Provisional 99.83
PRK09135249 pteridine reductase; Provisional 99.83
PRK08017256 oxidoreductase; Provisional 99.82
KOG1208|consensus314 99.82
PRK08177225 short chain dehydrogenase; Provisional 99.82
KOG1014|consensus312 99.82
KOG1204|consensus253 99.8
KOG1199|consensus260 99.77
PRK12367245 short chain dehydrogenase; Provisional 99.76
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.76
PRK06953222 short chain dehydrogenase; Provisional 99.75
PRK07806248 short chain dehydrogenase; Provisional 99.75
PRK08219227 short chain dehydrogenase; Provisional 99.74
COG0623259 FabI Enoyl-[acyl-carrier-protein] 99.73
smart00822180 PKS_KR This enzymatic domain is part of bacterial 99.7
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 99.69
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 99.63
PRK07424406 bifunctional sterol desaturase/short chain dehydro 99.63
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 99.43
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 99.4
KOG1478|consensus341 99.37
PRK10217 355 dTDP-glucose 4,6-dehydratase; Provisional 99.33
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 99.32
PLN02653 340 GDP-mannose 4,6-dehydratase 99.31
COG1088 340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 99.31
PLN02572 442 UDP-sulfoquinovose synthase 99.29
TIGR01472 343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 99.28
PRK13656398 trans-2-enoyl-CoA reductase; Provisional 99.26
COG1087 329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 99.23
PLN00198 338 anthocyanidin reductase; Provisional 99.18
PRK10084 352 dTDP-glucose 4,6 dehydratase; Provisional 99.15
PLN02240 352 UDP-glucose 4-epimerase 99.15
PRK06720169 hypothetical protein; Provisional 99.14
PLN03209 576 translocon at the inner envelope of chloroplast su 99.14
PLN02214 342 cinnamoyl-CoA reductase 99.13
PRK10675 338 UDP-galactose-4-epimerase; Provisional 99.11
PLN02896 353 cinnamyl-alcohol dehydrogenase 99.11
TIGR01181 317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 99.08
PLN02650 351 dihydroflavonol-4-reductase 99.07
PLN02986 322 cinnamyl-alcohol dehydrogenase family protein 99.06
KOG4022|consensus236 99.05
TIGR01179 328 galE UDP-glucose-4-epimerase. This enzyme intercon 99.01
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 99.0
KOG1371|consensus 343 98.97
PLN02583297 cinnamoyl-CoA reductase 98.97
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 98.97
TIGR03466 328 HpnA hopanoid-associated sugar epimerase. The sequ 98.96
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 98.94
PF08643299 DUF1776: Fungal family of unknown function (DUF177 98.94
PRK11150 308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 98.87
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 98.82
PLN02427 386 UDP-apiose/xylose synthase 98.8
PLN02260 668 probable rhamnose biosynthetic enzyme 98.79
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 98.77
PLN02695 370 GDP-D-mannose-3',5'-epimerase 98.76
PRK09987 299 dTDP-4-dehydrorhamnose reductase; Provisional 98.72
TIGR01214 287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 98.71
KOG1502|consensus 327 98.68
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 98.66
PLN02725 306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 98.66
PLN02686367 cinnamoyl-CoA reductase 98.64
TIGR02197 314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 98.64
PRK11908 347 NAD-dependent epimerase/dehydratase family protein 98.57
COG0451 314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 98.57
PF04321 286 RmlD_sub_bind: RmlD substrate binding domain; Inte 98.56
PRK08125 660 bifunctional UDP-glucuronic acid decarboxylase/UDP 98.55
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 98.55
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases 98.53
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 98.46
TIGR01746 367 Thioester-redct thioester reductase domain. It has 98.41
TIGR02114227 coaB_strep phosphopantothenate--cysteine ligase, s 98.41
PLN02206 442 UDP-glucuronate decarboxylase 98.37
PLN02166 436 dTDP-glucose 4,6-dehydratase 98.32
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 98.31
PLN02778298 3,5-epimerase/4-reductase 98.25
KOG0747|consensus 331 98.21
COG1089 345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 98.19
PLN02996 491 fatty acyl-CoA reductase 98.18
PLN02260668 probable rhamnose biosynthetic enzyme 98.12
PRK05865 854 hypothetical protein; Provisional 98.09
CHL00194 317 ycf39 Ycf39; Provisional 97.96
PRK07201 657 short chain dehydrogenase; Provisional 97.94
COG3320 382 Putative dehydrogenase domain of multifunctional n 97.68
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 97.54
KOG1202|consensus 2376 97.43
KOG1430|consensus 361 97.38
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 97.24
PLN02503 605 fatty acyl-CoA reductase 2 97.1
PRK06732229 phosphopantothenate--cysteine ligase; Validated 97.01
PRK12320 699 hypothetical protein; Provisional 96.7
TIGR01777 292 yfcH conserved hypothetical protein TIGR01777. Thi 96.65
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.62
KOG1429|consensus 350 96.46
PRK08309177 short chain dehydrogenase; Provisional 96.41
TIGR03649 285 ergot_EASG ergot alkaloid biosynthesis protein, AF 96.23
KOG1431|consensus 315 95.6
PLN00016 378 RNA-binding protein; Provisional 95.24
COG4982 866 3-oxoacyl-[acyl-carrier protein] 95.17
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 95.04
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 94.4
KOG2865|consensus 391 93.66
COG2910211 Putative NADH-flavin reductase [General function p 93.33
COG1090 297 Predicted nucleoside-diphosphate sugar epimerase [ 93.24
TIGR00521390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 92.69
KOG2774|consensus 366 91.6
KOG1221|consensus 467 91.43
PLN00106 323 malate dehydrogenase 85.94
PRK09620229 hypothetical protein; Provisional 82.54
KOG1372|consensus 376 80.16
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
Probab=99.98  E-value=2.5e-31  Score=190.98  Aligned_cols=161  Identities=22%  Similarity=0.250  Sum_probs=146.4

Q ss_pred             cccccccccceeccCCCC-------CCC-ceeEEEEccCCCHHHHHHHHHHHHh-cCCccEEEEcccCCCCCCcccCCHH
Q psy5462           4 DRTTGHIHGILFIPWCLP-------TKT-HVAVYFKADVSDKAEIKKLNENVRK-IGYVDILINNAGIVASSSVLAHTDH   74 (182)
Q Consensus         4 ~~l~~~g~~v~~~~~~~~-------~~~-~~~~~~~~D~s~~~~~~~~~~~~~~-~~~id~li~~ag~~~~~~~~~~~~~   74 (182)
                      ++|.+.|+.+...++..+       +.+ +.+..+..|++|.++++.+++.+.+ |+++|+||||||....+++.+.+.+
T Consensus        24 ~~l~~~G~~vvl~aRR~drL~~la~~~~~~~~~~~~~DVtD~~~~~~~i~~~~~~~g~iDiLvNNAGl~~g~~~~~~~~~  103 (246)
T COG4221          24 RALAEAGAKVVLAARREERLEALADEIGAGAALALALDVTDRAAVEAAIEALPEEFGRIDILVNNAGLALGDPLDEADLD  103 (246)
T ss_pred             HHHHHCCCeEEEEeccHHHHHHHHHhhccCceEEEeeccCCHHHHHHHHHHHHHhhCcccEEEecCCCCcCChhhhCCHH
Confidence            678888998888875543       233 6799999999999999999999999 9999999999999988999999999


Q ss_pred             HHHHHHHHHhHHHHHHHHHHhHHHHhCCCCeEEEEeccccccccCCCchhhhhHHHHHHHHHHHHhhhCCCccceeeeCC
Q psy5462          75 EIERIMDVNLMSNIKMVREFLPDMLENNTGHIVCISSIAALTAAVNVSAYFASKYGVTENHPSIKCFSGYMLWGTTVTTP  154 (182)
Q Consensus        75 ~~~~~~~~n~~~~~~l~~~~~~~l~~~~~~~ii~iss~~~~~~~~~~~~y~~sKaa~~~~~~~la~e~~~~~~~i~v~~~  154 (182)
                      +|+.|+++|+.|.++.+++++|.|.+++.|.||++||++|.+++|+...|+++|+++..|++.|+.|+....+.++...|
T Consensus       104 dw~~Mid~Ni~G~l~~~~avLP~m~~r~~G~IiN~~SiAG~~~y~~~~vY~ATK~aV~~fs~~LR~e~~g~~IRVt~I~P  183 (246)
T COG4221         104 DWDRMIDTNVKGLLNGTRAVLPGMVERKSGHIINLGSIAGRYPYPGGAVYGATKAAVRAFSLGLRQELAGTGIRVTVISP  183 (246)
T ss_pred             HHHHHHHHHHHHHHHHHHHhhhHHHhcCCceEEEeccccccccCCCCccchhhHHHHHHHHHHHHHHhcCCCeeEEEecC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999987788888899


Q ss_pred             Cccccccccc
Q psy5462         155 LRSVTILYQR  164 (182)
Q Consensus       155 ~~~~~~~~~~  164 (182)
                      +...+.....
T Consensus       184 G~v~~~~~s~  193 (246)
T COG4221         184 GLVETTEFST  193 (246)
T ss_pred             ceecceeccc
Confidence            9886654444



>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>KOG1205|consensus Back     alignment and domain information
>KOG1201|consensus Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG1200|consensus Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1610|consensus Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0725|consensus Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>KOG4169|consensus Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1209|consensus Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>KOG1210|consensus Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1207|consensus Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1611|consensus Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>KOG1208|consensus Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1014|consensus Back     alignment and domain information
>KOG1204|consensus Back     alignment and domain information
>KOG1199|consensus Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>KOG1478|consensus Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>KOG4022|consensus Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>KOG1371|consensus Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>PF08643 DUF1776: Fungal family of unknown function (DUF1776); InterPro: IPR013952 This is a fungal protein of unknown function Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>KOG1502|consensus Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>KOG0747|consensus Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>KOG1202|consensus Back     alignment and domain information
>KOG1430|consensus Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>PRK06732 phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG1429|consensus Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>KOG1431|consensus Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>COG4982 3-oxoacyl-[acyl-carrier protein] Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>KOG2865|consensus Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>KOG2774|consensus Back     alignment and domain information
>KOG1221|consensus Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PRK09620 hypothetical protein; Provisional Back     alignment and domain information
>KOG1372|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
1yb1_A272 Crystal Structure Of Human 17-Beta-Hydroxysteroid D 6e-14
3pgx_A280 Crystal Structure Of A Putative Carveol Dehydrogena 5e-11
2q2q_A255 Structure Of D-3-Hydroxybutyrate Dehydrogenase From 5e-11
3enn_A249 2.1a Crystal Structure Of GlucoseRIBITOL DEHYDROGEN 7e-11
3emk_A246 2.5a Crystal Structure Of GlucoseRIBITOL DEHYDROGEN 9e-11
3oec_A317 Crystal Structure Of Carveol Dehydrogenase From Myc 9e-11
3tjr_A301 Crystal Structure Of A Rv0851c Ortholog Short Chain 9e-11
1wmb_A260 Crystal Structure Of Nad Dependent D-3-Hydroxybutyl 3e-10
2ztm_A260 T190s Mutant Of D-3-Hydroxybutyrate Dehydrogenase L 3e-10
2ztu_A260 T190a Mutant Of D-3-Hydroxybutyrate Dehydrogenase C 3e-10
2bd0_A244 Chlorobium Tepidum Sepiapterin Reductase Complexed 6e-10
1a27_A289 Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 C 1e-09
1fdw_A 327 Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 M 1e-09
1fdu_A 327 Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 M 1e-09
1fds_A 327 Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 C 1e-09
1equ_A 327 Type 1 17-Beta Hydroxysteroid Dehydrogenase Equilin 1e-09
2cfc_A250 Structural Basis For Stereo Selectivity In The (R)- 2e-09
3grp_A266 2.1 Angstrom Crystal Structure Of 3-Ketoacyl-(Acyl- 2e-09
3sj7_A252 Structure Of Beta-Ketoacetyl-Coa Reductase (Fabg) F 3e-09
1iol_A 327 Estrogenic 17-beta Hydroxysteroid Dehydrogenase Com 5e-09
3gvc_A277 Crystal Structure Of Probable Short-Chain Dehydroge 5e-09
3cxr_A291 Crystal Structure Of Gluconate 5-Dehydrogase From S 5e-09
2jap_A247 Clavulanic Acid Dehydrogenase: Structural And Bioch 6e-09
3tfo_A264 Crystal Structure Of A Putative 3-Oxoacyl-(Acyl-Car 6e-09
2d1y_A256 Crystal Structure Of Tt0321 From Thermus Thermophil 9e-09
2o23_A265 The Structure Of Wild-Type Human Hadh2 (17beta-Hydr 1e-08
1u7t_A261 Crystal Structure Of AbadHSD10 WITH A BOUND INHIBIT 1e-08
1so8_A261 Abeta-bound Human Abad Structure [also Known As 3-h 1e-08
2c07_A285 Oxoacyl-Acp Reductase Of Plasmodium Falciparum Leng 1e-08
2yz7_A260 X-Ray Analyses Of 3-Hydroxybutyrate Dehydrogenase F 1e-08
1nff_A260 Crystal Structure Of Rv2002 Gene Product From Mycob 1e-08
3vtz_A269 Structure Of Thermoplasma Volcanium Aldohexose Dehy 2e-08
3uf0_A273 Crystal Structure Of A Putative Nad(P) Dependent Gl 2e-08
3f9i_A249 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 2e-08
4fn4_A254 Short-chain Nad(h)-dependent Dehydrogenase/reductas 4e-08
3gk3_A269 Crystal Structure Of Acetoacetyl-Coa Reductase From 4e-08
3osu_A246 Crystal Structure Of The 3-Oxoacyl-Acyl Carrier Pro 4e-08
3m1a_A281 The Crystal Structure Of A Short-Chain Dehydrogenas 6e-08
1vl8_A267 Crystal Structure Of Gluconate 5-dehydrogenase (tm0 8e-08
1nfr_A260 Rv2002 Gene Product From Mycobacterium Tuberculosis 9e-08
3rku_A287 Substrate Fingerprint And The Structure Of Nadp+ De 1e-07
1i01_A244 Crystal Structure Of Beta-Ketoacyl [acyl Carrier Pr 1e-07
3v2h_A281 The Crystal Structure Of D-Beta-Hydroxybutyrate Deh 1e-07
3rkr_A262 Crystal Structure Of A Metagenomic Short-Chain Oxid 2e-07
3csd_B281 Actinorhodin Polyketide Ketoreductase Mutant P94l B 2e-07
2rhr_B277 P94l Actinorhodin Ketordeuctase Mutant, With Nadph 2e-07
2dtd_A264 Structure Of Thermoplasma Acidophilum Aldohexose De 3e-07
2zk7_A257 Structure Of A C-Terminal Deletion Mutant Of Thermo 3e-07
2nm0_A253 Crystal Structure Of Sco1815: A Beta-Ketoacyl-Acyl 3e-07
2jah_A247 Biochemical And Structural Analysis Of The Clavulan 3e-07
4dc0_A281 Crystal Structure Of F189w Actinorhodin Polyketide 3e-07
1q7c_A244 The Structure Of Betaketoacyl-[acp] Reductase Y151f 3e-07
3uve_A286 Crystal Structure Of Carveol Dehydrogenase ((+)-Tra 4e-07
4dc1_A281 Crystal Structure Of Y202f Actinorhodin Polyketide 4e-07
1w4z_A281 Structure Of Actinorhodin Polyketide (Actiii) Reduc 4e-07
2rh4_A277 Actinorhodin Ketoreductase, Actkr, With Nadph And I 4e-07
2ag5_A246 Crystal Structure Of Human Dhrs6 Length = 246 4e-07
1iy8_A267 Crystal Structure Of Levodione Reductase Length = 2 4e-07
1x7g_A261 Actinorhodin Polyketide Ketoreductase, Act Kr, With 5e-07
4dbz_A281 Crystal Structure Of V151l Actinorhodin Polyketide 6e-07
3ezl_A256 Crystal Structure Of Acetyacetyl-Coa Reductase From 8e-07
1uay_A242 Crystal Structure Of Type Ii 3-Hydroxyacyl-Coa Dehy 9e-07
4hp8_A247 Crystal Structure Of A Putative 2-Deoxy-D-Gluconate 9e-07
3rsh_A251 Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein)reduc 1e-06
3tzh_A251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 1e-06
4imr_A275 Crystal Structure Of 3-oxoacyl (acyl-carrier-protei 1e-06
2hsd_A253 The Refined Three-Dimensional Structure Of 3alpha,2 1e-06
3ftp_A270 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 1e-06
1hdc_A254 Mechanism Of Inhibition Of 3alpha,20beta-Hydroxyste 1e-06
4dml_A269 3-Oxoacyl-[acyl-Carrier-Protein] Reductase From Syn 1e-06
3s55_A281 Crystal Structure Of A Putative Short-Chain Dehydro 1e-06
4ibo_A271 Crystal Structure Of A Putative Gluconate Dehydroge 1e-06
3t4x_A267 Short Chain DehydrogenaseREDUCTASE FAMILY OXIDOREDU 1e-06
2hq1_A247 Crystal Structure Of Orf 1438 A Putative GlucoseRIB 2e-06
1ae1_A273 Tropinone Reductase-I Complex With Nadp Length = 27 2e-06
1edo_A244 The X-Ray Structure Of Beta-Keto Acyl Carrier Prote 2e-06
3p19_A266 Improved Nadph-Dependent Blue Fluorescent Protein L 2e-06
3oml_A 613 Structure Of Full-Length Peroxisomal Multifunctiona 2e-06
2et6_A604 (3r)-Hydroxyacyl-Coa Dehydrogenase Domain Of Candid 2e-06
3lf1_A265 Apo Structure Of The Short Chain Oxidoreductase Q9h 2e-06
3tzc_A251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 3e-06
2cf2_E226 Architecture Of Mammalian Fatty Acid Synthase Lengt 3e-06
3nug_A247 Crystal Structure Of Wild Type Tetrameric Pyridoxal 3e-06
2bel_A283 Structure Of Human 11-Beta-Hydroxysteroid Dehydroge 3e-06
2ph3_A245 Crystal Structure Of 3-oxoacyl-[acyl Carrier Protei 3e-06
2irw_A264 Human 11-Beta-Hydroxysteroid Dehydrogenase (Hsd1) W 4e-06
3ch6_A286 Crystal Structure Of 11beta-Hsd1 Double Mutant (L26 4e-06
3t7c_A299 Crystal Structure Of Carveol Dehydrogenase From Myc 5e-06
2rbe_A275 The Discovery Of 2-Anilinothiazolones As 11beta-Hsd 5e-06
2ilt_A275 Human 11-Beta-Hydroxysteroid Dehydrogenase (Hsd1) W 5e-06
1xu7_A286 Crystal Structure Of The Interface Open Conformatio 5e-06
4bb6_A292 Free-Wilson And Structural Approaches To Co-Optimis 5e-06
3d5q_A272 Crystal Structure Of 11b-Hsd1 In Complex With Triaz 5e-06
3pdj_A273 Crystal Structure Of Human 11-Beta-Hydroxysteroid D 5e-06
3gmd_A264 Structure-Based Design Of 7-Azaindole-Pyrrolidines 6e-06
4hfr_A272 Human 11beta-Hydroxysteroid Dehydrogenase Type 1 In 6e-06
3o38_A266 Crystal Structure Of A Short Chain Dehydrogenase Fr 6e-06
4bb5_A292 Free-Wilson And Structural Approaches To Co-Optimis 6e-06
3tzk_A251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 6e-06
1y5m_A276 The Crystal Structure Of Murine 11b-Hydroxysteroid 7e-06
2gdz_A267 Crystal Structure Of 15-Hydroxyprostaglandin Dehydr 7e-06
2ehd_A234 Crystal Structure Analysis Of Oxidoreductase Length 1e-05
3u09_A251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 1e-05
2uvd_A246 The Crystal Structure Of A 3-Oxoacyl-(Acyl Carrier 1e-05
3u5t_A267 The Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Pr 1e-05
2b4q_A276 Pseudomonas Aeruginosa RhlgNADP ACTIVE-Site Complex 1e-05
3tsc_A277 Crystal Structure Of Short Chain Dehydrogenase Map_ 1e-05
2bgk_A278 X-Ray Structure Of Apo-Secoisolariciresinol Dehydro 1e-05
2ew8_A249 Crystal Structure Of The (s)-specific 1-phenylethan 2e-05
3sx2_A278 Crystal Structure Of A Putative 3-Ketoacyl-(Acyl-Ca 2e-05
1e6w_A260 Rat Brain 3-Hydroxyacyl-Coa Dehydrogenase Binary Co 2e-05
3ged_A247 Fingerprint And Structural Analysis Of A Apo Scor E 2e-05
1e3s_A261 Rat Brain 3-Hydroxyacyl-Coa Dehydrogenase Binary Co 2e-05
1e3w_A261 Rat Brain 3-Hydroxyacyl-Coa Dehydrogenase Binary Co 2e-05
3asu_A248 Crystal Structure Of Serine Dehydrogenase From Esch 2e-05
3o4r_A261 Crystal Structure Of Human DehydrogenaseREDUCTASE ( 2e-05
1xq1_A266 X-Ray Structure Of Putative Tropinone Reducatse Fro 2e-05
3ndr_A247 Crystal Structure Of Tetrameric Pyridoxal 4-Dehydro 2e-05
3m1l_A432 Crystal Strucutre Of A C-Terminal Trunacted Mutant 2e-05
3q6i_A446 Crystal Structure Of Fabg4 And Coenzyme Binary Comp 2e-05
3lls_A475 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 2e-05
4fw8_A454 Crystal Structure Of Fabg4 Complexed With Coenzyme 2e-05
3ai1_A263 The Crystal Structure Of L-Sorbose Reductase From G 3e-05
3v1t_C462 Crystal Structure Of A Putative Ketoacyl Reductase 3e-05
3a28_C258 Crystal Structure Of L-2,3-Butanediol Dehydrogenase 3e-05
4g81_D255 Crystal Structure Of A Hexonate Dehydrogenase Ortho 3e-05
3uwr_A286 Crystal Structure Of Carveol Dehydrogenase From Myc 3e-05
2pnf_A248 Structure Of Aquifex Aeolicus Fabg 3-oxoacyl-(acyl- 5e-05
1geg_A256 Cryatal Structure Analysis Of Meso-2,3-Butanediol D 6e-05
4dqx_A277 Crystal Structure Of A Short Chain Dehydrogenase Fr 6e-05
3ai3_A263 The Crystal Structure Of L-Sorbose Reductase From G 7e-05
3itd_A270 Crystal Structure Of An Inactive 17beta-Hydroxyster 8e-05
3pk0_A262 Crystal Structure Of Short-Chain DehydrogenaseREDUC 9e-05
3op4_A248 Crystal Structure Of Putative 3-Ketoacyl-(Acyl-Carr 1e-04
2hrb_A274 Crystal Structure Of Human Carbonyl Reductase 3, Co 1e-04
1nxq_A251 Crystal Structure Of R-Alcohol Dehydrogenase (Radh) 1e-04
1zjy_A251 Structure Of R-Specific Alcohol Dehydrogenase (Muta 1e-04
3ioy_A319 Structure Of Putative Short-Chain Dehydrogenase (Sa 1e-04
4b79_A242 The Aeropath Project And Pseudomonas Aeruginosa Hig 2e-04
3ucx_A264 The Structure Of A Short Chain Dehydrogenase From M 2e-04
3is3_A270 Crystal Structure Of 17beta-Hydroxysteroid Dehydrog 2e-04
1xg5_A279 Structure Of Human Putative Dehydrogenase Mgc4172 I 3e-04
2zat_A260 Crystal Structure Of A Mammalian Reductase Length = 3e-04
1wma_A276 Crystal Structure Of Human Cbr1 In Complex With Hyd 3e-04
2pfg_A276 Crystal Structure Of Human Cbr1 In Complex With Big 3e-04
1spx_A278 Crystal Structure Of Glucose Dehydrogenase Of Caeno 4e-04
3i4f_A264 Structure Of Putative 3-oxoacyl-reductase From Baci 4e-04
4gkb_A258 Crystal Structure Of A Short Chain Dehydrogenase Ho 4e-04
2fwm_X250 Crystal Structure Of E. Coli Enta, A 2,3-Dihydrodih 4e-04
1ahi_A255 7 Alpha-Hydroxysteroid Dehydrogenase Complexed With 5e-04
1zbq_A327 Crystal Structure Of Human 17-beta-hydroxysteroid D 6e-04
1xkq_A280 Crystal Structure Of Short-Chain DehydrogenaseREDUC 6e-04
3kvo_A346 Crystal Structure Of The Catalytic Domain Of Human 6e-04
4iin_A271 Crystal Structure Of A Putative 3-Oxoacyl-[acyl-Car 6e-04
3sju_A279 Hedamycin Polyketide Ketoreductase Bound To Nadph L 7e-04
4e3z_A272 Crystal Structure Of A Oxidoreductase From Rhizobiu 7e-04
3un1_A260 Crystal Structure Of An Oxidoreductase From Sinorhi 8e-04
>pdb|1YB1|A Chain A, Crystal Structure Of Human 17-Beta-Hydroxysteroid Dehydrogenase Type Xi Length = 272 Back     alignment and structure

Iteration: 1

Score = 73.6 bits (179), Expect = 6e-14, Method: Compositional matrix adjust. Identities = 39/110 (35%), Positives = 66/110 (60%), Gaps = 1/110 (0%) Query: 30 FKADVSDKAEIKKLNENVR-KIGYVDILINNAGIVASSSVLAHTDHEIERIMDVNLMSNI 88 F D S++ +I + V+ +IG V IL+NNAG+V +S + A D +IE+ +VN++++ Sbjct: 85 FVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHF 144 Query: 89 KMVREFLPDMLENNTGHIVCISSIAALTAAVNVSAYFASKYGVTENHPSI 138 + FLP M +NN GHIV ++S A + + AY +SK+ H ++ Sbjct: 145 WTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTL 194
>pdb|3PGX|A Chain A, Crystal Structure Of A Putative Carveol Dehydrogenase From Mycobacterium Paratuberculosis Bound To Nicotinamide Adenine Dinucleotide Length = 280 Back     alignment and structure
>pdb|2Q2Q|A Chain A, Structure Of D-3-Hydroxybutyrate Dehydrogenase From Pseudomonas Putida Length = 255 Back     alignment and structure
>pdb|3ENN|A Chain A, 2.1a Crystal Structure Of GlucoseRIBITOL DEHYDROGENASE FROM BRUCELLA Melitensis (P43212) Length = 249 Back     alignment and structure
>pdb|3EMK|A Chain A, 2.5a Crystal Structure Of GlucoseRIBITOL DEHYDROGENASE From Brucella Melitensis Length = 246 Back     alignment and structure
>pdb|3OEC|A Chain A, Crystal Structure Of Carveol Dehydrogenase From Mycobacterium Thermoresistibile Length = 317 Back     alignment and structure
>pdb|3TJR|A Chain A, Crystal Structure Of A Rv0851c Ortholog Short Chain Dehydrogenase From Mycobacterium Paratuberculosis Length = 301 Back     alignment and structure
>pdb|1WMB|A Chain A, Crystal Structure Of Nad Dependent D-3-Hydroxybutylate Dehydrogenase Length = 260 Back     alignment and structure
>pdb|2ZTM|A Chain A, T190s Mutant Of D-3-Hydroxybutyrate Dehydrogenase Length = 260 Back     alignment and structure
>pdb|2ZTU|A Chain A, T190a Mutant Of D-3-Hydroxybutyrate Dehydrogenase Complexed With Nad+ Length = 260 Back     alignment and structure
>pdb|2BD0|A Chain A, Chlorobium Tepidum Sepiapterin Reductase Complexed With Nadp And Sepiapterin Length = 244 Back     alignment and structure
>pdb|1A27|A Chain A, Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 C-Terminal Deletion Mutant Complexed With Estradiol And Nadp+ Length = 289 Back     alignment and structure
>pdb|1FDW|A Chain A, Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 Mutant H221q Complexed With Estradiol Length = 327 Back     alignment and structure
>pdb|1FDU|A Chain A, Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 Mutant H221l Complexed With Estradiol And Nadp+ Length = 327 Back     alignment and structure
>pdb|1FDS|A Chain A, Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 Complexed With 17- Beta-Estradiol Length = 327 Back     alignment and structure
>pdb|1EQU|A Chain A, Type 1 17-Beta Hydroxysteroid Dehydrogenase Equilin Complexed With Nadp+ Length = 327 Back     alignment and structure
>pdb|2CFC|A Chain A, Structural Basis For Stereo Selectivity In The (R)- And (S)- Hydroxypropylethane Thiosulfonate Dehydrogenases Length = 250 Back     alignment and structure
>pdb|3GRP|A Chain A, 2.1 Angstrom Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Bartonella Henselae Length = 266 Back     alignment and structure
>pdb|3SJ7|A Chain A, Structure Of Beta-Ketoacetyl-Coa Reductase (Fabg) From Staphylococcus Aureus Complex With Nadph Length = 252 Back     alignment and structure
>pdb|1IOL|A Chain A, Estrogenic 17-beta Hydroxysteroid Dehydrogenase Complexed 17-beta- Estradiol Length = 327 Back     alignment and structure
>pdb|3GVC|A Chain A, Crystal Structure Of Probable Short-Chain Dehydrogenase- Reductase From Mycobacterium Tuberculosis Length = 277 Back     alignment and structure
>pdb|3CXR|A Chain A, Crystal Structure Of Gluconate 5-Dehydrogase From Streptococcus Suis Type 2 Length = 291 Back     alignment and structure
>pdb|2JAP|A Chain A, Clavulanic Acid Dehydrogenase: Structural And Biochemical Analysis Of The Final Step In The Biosynthesis Of The Beta- Lactamase Inhibitor Clavulanic Acid Length = 247 Back     alignment and structure
>pdb|3TFO|A Chain A, Crystal Structure Of A Putative 3-Oxoacyl-(Acyl-Carrier-Protein) Reductase From Sinorhizobium Meliloti Length = 264 Back     alignment and structure
>pdb|2D1Y|A Chain A, Crystal Structure Of Tt0321 From Thermus Thermophilus Hb8 Length = 256 Back     alignment and structure
>pdb|2O23|A Chain A, The Structure Of Wild-Type Human Hadh2 (17beta-Hydroxysteroid Dehydrogenase Type 10) Bound To Nad+ At 1.2 A Length = 265 Back     alignment and structure
>pdb|1U7T|A Chain A, Crystal Structure Of AbadHSD10 WITH A BOUND INHIBITOR Length = 261 Back     alignment and structure
>pdb|1SO8|A Chain A, Abeta-bound Human Abad Structure [also Known As 3-hydroxyacyl-coa Dehydrogenase Type Ii (type Ii Hadh), Endoplasmic Reticulum- Associated Amyloid Beta-peptide Binding Protein (erab)] Length = 261 Back     alignment and structure
>pdb|2C07|A Chain A, Oxoacyl-Acp Reductase Of Plasmodium Falciparum Length = 285 Back     alignment and structure
>pdb|2YZ7|A Chain A, X-Ray Analyses Of 3-Hydroxybutyrate Dehydrogenase From Alcaligenes Faecalis Length = 260 Back     alignment and structure
>pdb|1NFF|A Chain A, Crystal Structure Of Rv2002 Gene Product From Mycobacterium Tuberculosis Length = 260 Back     alignment and structure
>pdb|3VTZ|A Chain A, Structure Of Thermoplasma Volcanium Aldohexose Dehydrogenase Length = 269 Back     alignment and structure
>pdb|3UF0|A Chain A, Crystal Structure Of A Putative Nad(P) Dependent Gluconate 5- Dehydrogenase From Beutenbergia Cavernae(Efi Target Efi-502044) With Bound Nadp (Low Occupancy) Length = 273 Back     alignment and structure
>pdb|3F9I|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase Rickettsia Prowazekii Length = 249 Back     alignment and structure
>pdb|4FN4|A Chain A, Short-chain Nad(h)-dependent Dehydrogenase/reductase From Sulfolobus Acidocaldarius Length = 254 Back     alignment and structure
>pdb|3GK3|A Chain A, Crystal Structure Of Acetoacetyl-Coa Reductase From Burkholderia Pseudomallei 1710b Length = 269 Back     alignment and structure
>pdb|3OSU|A Chain A, Crystal Structure Of The 3-Oxoacyl-Acyl Carrier Protein Reductase, Fabg, From Staphylococcus Aureus Length = 246 Back     alignment and structure
>pdb|3M1A|A Chain A, The Crystal Structure Of A Short-Chain Dehydrogenase From Streptomyces Avermitilis To 2a Length = 281 Back     alignment and structure
>pdb|1VL8|A Chain A, Crystal Structure Of Gluconate 5-dehydrogenase (tm0441) From Thermotoga Maritima At 2.07 A Resolution Length = 267 Back     alignment and structure
>pdb|1NFR|A Chain A, Rv2002 Gene Product From Mycobacterium Tuberculosis Length = 260 Back     alignment and structure
>pdb|3RKU|A Chain A, Substrate Fingerprint And The Structure Of Nadp+ Dependent Serine Dehydrogenase From Saccharomyces Cerevisiae Complexed With Nadp+ Length = 287 Back     alignment and structure
>pdb|1I01|A Chain A, Crystal Structure Of Beta-Ketoacyl [acyl Carrier Protein] Reductase From E. Coli. Length = 244 Back     alignment and structure
>pdb|3V2H|A Chain A, The Crystal Structure Of D-Beta-Hydroxybutyrate Dehydrogenase From Sinorhizobium Meliloti Length = 281 Back     alignment and structure
>pdb|3RKR|A Chain A, Crystal Structure Of A Metagenomic Short-Chain Oxidoreductase (Sdr) In Complex With Nadp Length = 262 Back     alignment and structure
>pdb|3CSD|B Chain B, Actinorhodin Polyketide Ketoreductase Mutant P94l Bound To Nadph And The Inhibitor Emodin Length = 281 Back     alignment and structure
>pdb|2RHR|B Chain B, P94l Actinorhodin Ketordeuctase Mutant, With Nadph And Inhibitor Emodin Length = 277 Back     alignment and structure
>pdb|2DTD|A Chain A, Structure Of Thermoplasma Acidophilum Aldohexose Dehydrogenase (aldt) In Ligand-free Form Length = 264 Back     alignment and structure
>pdb|2ZK7|A Chain A, Structure Of A C-Terminal Deletion Mutant Of Thermoplasma Acidophilum Aldohexose Dehydrogenase (Aldt) Length = 257 Back     alignment and structure
>pdb|2NM0|A Chain A, Crystal Structure Of Sco1815: A Beta-Ketoacyl-Acyl Carrier Protein Reductase From Streptomyces Coelicolor A3(2) Length = 253 Back     alignment and structure
>pdb|2JAH|A Chain A, Biochemical And Structural Analysis Of The Clavulanic Acid Dehydeogenase (Cad) From Streptomyces Clavuligerus Length = 247 Back     alignment and structure
>pdb|4DC0|A Chain A, Crystal Structure Of F189w Actinorhodin Polyketide Ketoreductase With Nadph Length = 281 Back     alignment and structure
>pdb|1Q7C|A Chain A, The Structure Of Betaketoacyl-[acp] Reductase Y151f Mutant In Complex With Nadph Fragment Length = 244 Back     alignment and structure
>pdb|3UVE|A Chain A, Crystal Structure Of Carveol Dehydrogenase ((+)-Trans-Carveol Dehydrogenase) From Mycobacterium Avium Length = 286 Back     alignment and structure
>pdb|4DC1|A Chain A, Crystal Structure Of Y202f Actinorhodin Polyketide Ketoreductase With Nadph Length = 281 Back     alignment and structure
>pdb|1W4Z|A Chain A, Structure Of Actinorhodin Polyketide (Actiii) Reductase Length = 281 Back     alignment and structure
>pdb|2RH4|A Chain A, Actinorhodin Ketoreductase, Actkr, With Nadph And Inhibitor Emodin Length = 277 Back     alignment and structure
>pdb|2AG5|A Chain A, Crystal Structure Of Human Dhrs6 Length = 246 Back     alignment and structure
>pdb|1IY8|A Chain A, Crystal Structure Of Levodione Reductase Length = 267 Back     alignment and structure
>pdb|1X7G|A Chain A, Actinorhodin Polyketide Ketoreductase, Act Kr, With Nadp Bound Length = 261 Back     alignment and structure
>pdb|4DBZ|A Chain A, Crystal Structure Of V151l Actinorhodin Polyketide Ketoreductase With Nadph Length = 281 Back     alignment and structure
>pdb|3EZL|A Chain A, Crystal Structure Of Acetyacetyl-Coa Reductase From Burkholderia Pseudomallei 1710b Length = 256 Back     alignment and structure
>pdb|1UAY|A Chain A, Crystal Structure Of Type Ii 3-Hydroxyacyl-Coa Dehydrogenase From Thermus Thermophilus Hb8 Length = 242 Back     alignment and structure
>pdb|4HP8|A Chain A, Crystal Structure Of A Putative 2-Deoxy-D-Gluconate 3-Dehydrogenase From Agrobacterium Tumefaciens (Target Efi-506435) With Bound Nadp Length = 247 Back     alignment and structure
>pdb|3RSH|A Chain A, Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein)reductase (Fabg) From Vibrio Cholerae O1 Complexed With Nadp+ (Space Group P62) Length = 251 Back     alignment and structure
>pdb|3TZH|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(F187a) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|4IMR|A Chain A, Crystal Structure Of 3-oxoacyl (acyl-carrier-protein) Reductase (target Efi-506442) From Agrobacterium Tumefaciens C58 With Nadp Bound Length = 275 Back     alignment and structure
>pdb|2HSD|A Chain A, The Refined Three-Dimensional Structure Of 3alpha,20beta- Hydroxysteroid Dehydrogenase And Possible Roles Of The Residues Conserved In Short-Chain Dehydrogenases Length = 253 Back     alignment and structure
>pdb|3FTP|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Burkholderia Pseudomallei At 2.05 A Resolution Length = 270 Back     alignment and structure
>pdb|1HDC|A Chain A, Mechanism Of Inhibition Of 3alpha,20beta-Hydroxysteroid Dehydrogenase By A Licorice-Derived Steroidal Inhibitor Length = 254 Back     alignment and structure
>pdb|4DML|A Chain A, 3-Oxoacyl-[acyl-Carrier-Protein] Reductase From Synechococcus Elongatus Pcc 7942 Length = 269 Back     alignment and structure
>pdb|3S55|A Chain A, Crystal Structure Of A Putative Short-Chain DehydrogenaseREDUCTASE From Mycobacterium Abscessus Bound To Nad Length = 281 Back     alignment and structure
>pdb|4IBO|A Chain A, Crystal Structure Of A Putative Gluconate Dehydrogenase From Agrobacterium Tumefaciens (Target Efi-506446) Length = 271 Back     alignment and structure
>pdb|3T4X|A Chain A, Short Chain DehydrogenaseREDUCTASE FAMILY OXIDOREDUCTASE FROM Bacillus Anthracis Str. Ames Ancestor Length = 267 Back     alignment and structure
>pdb|2HQ1|A Chain A, Crystal Structure Of Orf 1438 A Putative GlucoseRIBITOL Dehydrogenase From Clostridium Thermocellum Length = 247 Back     alignment and structure
>pdb|1AE1|A Chain A, Tropinone Reductase-I Complex With Nadp Length = 273 Back     alignment and structure
>pdb|1EDO|A Chain A, The X-Ray Structure Of Beta-Keto Acyl Carrier Protein Reductase From Brassica Napus Complexed With Nadp+ Length = 244 Back     alignment and structure
>pdb|3P19|A Chain A, Improved Nadph-Dependent Blue Fluorescent Protein Length = 266 Back     alignment and structure
>pdb|3OML|A Chain A, Structure Of Full-Length Peroxisomal Multifunctional Enzyme Type 2 From Drosophila Melanogaster Length = 613 Back     alignment and structure
>pdb|2ET6|A Chain A, (3r)-Hydroxyacyl-Coa Dehydrogenase Domain Of Candida Tropicalis Peroxisomal Multifunctional Enzyme Type 2 Length = 604 Back     alignment and structure
>pdb|3LF1|A Chain A, Apo Structure Of The Short Chain Oxidoreductase Q9hya2 From Pseudomonas Aeruginosa Pao1 Containing An Atypical Catalytic Center Length = 265 Back     alignment and structure
>pdb|3TZC|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(Y155f) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|2CF2|E Chain E, Architecture Of Mammalian Fatty Acid Synthase Length = 226 Back     alignment and structure
>pdb|3NUG|A Chain A, Crystal Structure Of Wild Type Tetrameric Pyridoxal 4-Dehydrogenase From Mesorhizobium Loti Length = 247 Back     alignment and structure
>pdb|2BEL|A Chain A, Structure Of Human 11-Beta-Hydroxysteroid Dehydrogenase In Complex With Nadp And Carbenoxolone Length = 283 Back     alignment and structure
>pdb|2PH3|A Chain A, Crystal Structure Of 3-oxoacyl-[acyl Carrier Protein] Reductase Ttha0415 From Thermus Thermophilus Length = 245 Back     alignment and structure
>pdb|2IRW|A Chain A, Human 11-Beta-Hydroxysteroid Dehydrogenase (Hsd1) With Nadp And Adamantane Ether Inhibitor Length = 264 Back     alignment and structure
>pdb|3CH6|A Chain A, Crystal Structure Of 11beta-Hsd1 Double Mutant (L262r, F278e) Complexed With (3,3-Dimethylpiperidin-1-Yl)(6-(3- Fluoro-4-Methylphenyl)pyridin-2-Yl)methanone Length = 286 Back     alignment and structure
>pdb|3T7C|A Chain A, Crystal Structure Of Carveol Dehydrogenase From Mycobacterium Avium Bound To Nad Length = 299 Back     alignment and structure
>pdb|2RBE|A Chain A, The Discovery Of 2-Anilinothiazolones As 11beta-Hsd1 Inhibitors Length = 275 Back     alignment and structure
>pdb|2ILT|A Chain A, Human 11-Beta-Hydroxysteroid Dehydrogenase (Hsd1) With Nadp And Adamantane Sulfone Inhibitor Length = 275 Back     alignment and structure
>pdb|1XU7|A Chain A, Crystal Structure Of The Interface Open Conformation Of Tetrameric 11b-hsd1 Length = 286 Back     alignment and structure
>pdb|4BB6|A Chain A, Free-Wilson And Structural Approaches To Co-Optimising Human And Rodent Isoform Potency For 11b-Hydroxysteroid Dehydrogenase Type 1 11b-Hsd1 Inhibitors Length = 292 Back     alignment and structure
>pdb|3D5Q|A Chain A, Crystal Structure Of 11b-Hsd1 In Complex With Triazole Inhibitor Length = 272 Back     alignment and structure
>pdb|3PDJ|A Chain A, Crystal Structure Of Human 11-Beta-Hydroxysteroid Dehydrogenase 1 (11b-Hsd1) In Complex With 4,4-Disubstituted Cyclohexylbenzamide Inhibitor Length = 273 Back     alignment and structure
>pdb|3GMD|A Chain A, Structure-Based Design Of 7-Azaindole-Pyrrolidines As Inhibitors Of 11beta-Hydroxysteroid-Dehydrogenase Type I Length = 264 Back     alignment and structure
>pdb|4HFR|A Chain A, Human 11beta-Hydroxysteroid Dehydrogenase Type 1 In Complex With An Orally Bioavailable Acidic Inhibitor Azd4017. Length = 272 Back     alignment and structure
>pdb|3O38|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase From Mycobacterium Smegmatis Length = 266 Back     alignment and structure
>pdb|4BB5|A Chain A, Free-Wilson And Structural Approaches To Co-Optimising Human And Rodent Isoform Potency For 11b-Hydroxysteroid Dehydrogenase Type 1 11b-Hsd1 Inhibitors Length = 292 Back     alignment and structure
>pdb|3TZK|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(G92a) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|1Y5M|A Chain A, The Crystal Structure Of Murine 11b-Hydroxysteroid Dehydrogenase: An Important Therapeutic Target For Diabetes Length = 276 Back     alignment and structure
>pdb|2GDZ|A Chain A, Crystal Structure Of 15-Hydroxyprostaglandin Dehydrogenase Type1, Complexed With Nad+ Length = 267 Back     alignment and structure
>pdb|2EHD|A Chain A, Crystal Structure Analysis Of Oxidoreductase Length = 234 Back     alignment and structure
>pdb|3U09|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(G92d) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|2UVD|A Chain A, The Crystal Structure Of A 3-Oxoacyl-(Acyl Carrier Protein) Reductase From Bacillus Anthracis (Ba3989) Length = 246 Back     alignment and structure
>pdb|3U5T|A Chain A, The Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protein] Reductase From Sinorhizobium Meliloti Length = 267 Back     alignment and structure
>pdb|2B4Q|A Chain A, Pseudomonas Aeruginosa RhlgNADP ACTIVE-Site Complex Length = 276 Back     alignment and structure
>pdb|3TSC|A Chain A, Crystal Structure Of Short Chain Dehydrogenase Map_2410 From Mycobacterium Paratuberculosis Bound To Nad Length = 277 Back     alignment and structure
>pdb|2BGK|A Chain A, X-Ray Structure Of Apo-Secoisolariciresinol Dehydrogenase Length = 278 Back     alignment and structure
>pdb|2EW8|A Chain A, Crystal Structure Of The (s)-specific 1-phenylethanol Dehydrogenase Of The Denitrifying Bacterium Strain Ebn1 Length = 249 Back     alignment and structure
>pdb|3SX2|A Chain A, Crystal Structure Of A Putative 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Mycobacterium Paratuberculosis In Complex With Nad Length = 278 Back     alignment and structure
>pdb|1E6W|A Chain A, Rat Brain 3-Hydroxyacyl-Coa Dehydrogenase Binary Complex With Nadh And Estradiol Length = 260 Back     alignment and structure
>pdb|3GED|A Chain A, Fingerprint And Structural Analysis Of A Apo Scor Enzyme From Clostridium Thermocellum Length = 247 Back     alignment and structure
>pdb|1E3S|A Chain A, Rat Brain 3-Hydroxyacyl-Coa Dehydrogenase Binary Complex With Nadh Length = 261 Back     alignment and structure
>pdb|1E3W|A Chain A, Rat Brain 3-Hydroxyacyl-Coa Dehydrogenase Binary Complex With Nadh And 3-Keto Butyrate Length = 261 Back     alignment and structure
>pdb|3ASU|A Chain A, Crystal Structure Of Serine Dehydrogenase From Escherichia Coli Length = 248 Back     alignment and structure
>pdb|3O4R|A Chain A, Crystal Structure Of Human DehydrogenaseREDUCTASE (SDR FAMILY) MEMBER 4 (Dhrs4) Length = 261 Back     alignment and structure
>pdb|1XQ1|A Chain A, X-Ray Structure Of Putative Tropinone Reducatse From Arabidopsis Thaliana Gene At1g07440 Length = 266 Back     alignment and structure
>pdb|3NDR|A Chain A, Crystal Structure Of Tetrameric Pyridoxal 4-Dehydrogenase From Mesorhizobium Loti Length = 247 Back     alignment and structure
>pdb|3M1L|A Chain A, Crystal Strucutre Of A C-Terminal Trunacted Mutant Of A Putative Ketoacyl Reductase (Fabg4) From Mycobacterium Tuberculosis H37rv At 2.5 Angstrom Resolution Length = 432 Back     alignment and structure
>pdb|3Q6I|A Chain A, Crystal Structure Of Fabg4 And Coenzyme Binary Complex Length = 446 Back     alignment and structure
>pdb|3LLS|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Mycobacterium Tuberculosis Length = 475 Back     alignment and structure
>pdb|4FW8|A Chain A, Crystal Structure Of Fabg4 Complexed With Coenzyme Nadh Length = 454 Back     alignment and structure
>pdb|3AI1|A Chain A, The Crystal Structure Of L-Sorbose Reductase From Gluconobacter Frateurii Complexed With Nadph And L-Sorbose Reveals The Structure Bases Of Its Catalytic Mechanism And High Substrate Selectivity Length = 263 Back     alignment and structure
>pdb|3V1T|C Chain C, Crystal Structure Of A Putative Ketoacyl Reductase (Fabg4) From Mycobacterium Tuberculosis H37rv At 1.9 Angstrom Resolution Length = 462 Back     alignment and structure
>pdb|3A28|C Chain C, Crystal Structure Of L-2,3-Butanediol Dehydrogenase Length = 258 Back     alignment and structure
>pdb|4G81|D Chain D, Crystal Structure Of A Hexonate Dehydrogenase Ortholog (Target Efi- 506402 From Salmonella Enterica, Unliganded Structure Length = 255 Back     alignment and structure
>pdb|3UWR|A Chain A, Crystal Structure Of Carveol Dehydrogenase From Mycobacterium Avium Strain 104 Length = 286 Back     alignment and structure
>pdb|2PNF|A Chain A, Structure Of Aquifex Aeolicus Fabg 3-oxoacyl-(acyl-carrier Protein) Reductase Length = 248 Back     alignment and structure
>pdb|1GEG|A Chain A, Cryatal Structure Analysis Of Meso-2,3-Butanediol Dehydrogenase Length = 256 Back     alignment and structure
>pdb|4DQX|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase From Rhizobium Etli Cfn 42 Length = 277 Back     alignment and structure
>pdb|3AI3|A Chain A, The Crystal Structure Of L-Sorbose Reductase From Gluconobacter Frateurii Complexed With Nadph And L-Sorbose Length = 263 Back     alignment and structure
>pdb|3ITD|A Chain A, Crystal Structure Of An Inactive 17beta-Hydroxysteroid Dehydrogenase (Y167f Mutated Form) From Fungus Cochliobolus Lunatus Length = 270 Back     alignment and structure
>pdb|3PK0|A Chain A, Crystal Structure Of Short-Chain DehydrogenaseREDUCTASE SDR FROM Mycobacterium Smegmatis Length = 262 Back     alignment and structure
>pdb|3OP4|A Chain A, Crystal Structure Of Putative 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Vibrio Cholerae O1 Biovar Eltor Str. N16961 In Complex With Nadp+ Length = 248 Back     alignment and structure
>pdb|2HRB|A Chain A, Crystal Structure Of Human Carbonyl Reductase 3, Complexed With Nadp+ Length = 274 Back     alignment and structure
>pdb|1NXQ|A Chain A, Crystal Structure Of R-Alcohol Dehydrogenase (Radh) (Apoenyzme) From Lactobacillus Brevis Length = 251 Back     alignment and structure
>pdb|1ZJY|A Chain A, Structure Of R-Specific Alcohol Dehydrogenase (Mutant G37d) From Lactobacillus Brevis In Complex With Phenylethanol And Nadh Length = 251 Back     alignment and structure
>pdb|3IOY|A Chain A, Structure Of Putative Short-Chain Dehydrogenase (Saro_0793) From Novosphingobium Aromaticivorans Length = 319 Back     alignment and structure
>pdb|4B79|A Chain A, The Aeropath Project And Pseudomonas Aeruginosa High-throughput Crystallographic Studies For Assessment Of Potential Targets In Early Stage Drug Discovery. Length = 242 Back     alignment and structure
>pdb|3UCX|A Chain A, The Structure Of A Short Chain Dehydrogenase From Mycobacterium Smegmatis Length = 264 Back     alignment and structure
>pdb|3IS3|A Chain A, Crystal Structure Of 17beta-Hydroxysteroid Dehydrogenase (Apo Form) From Fungus Cochliobolus Lunatus Length = 270 Back     alignment and structure
>pdb|1XG5|A Chain A, Structure Of Human Putative Dehydrogenase Mgc4172 In Complex With Nadp Length = 279 Back     alignment and structure
>pdb|2ZAT|A Chain A, Crystal Structure Of A Mammalian Reductase Length = 260 Back     alignment and structure
>pdb|1WMA|A Chain A, Crystal Structure Of Human Cbr1 In Complex With Hydroxy-pp Length = 276 Back     alignment and structure
>pdb|2PFG|A Chain A, Crystal Structure Of Human Cbr1 In Complex With Bigf2 Length = 276 Back     alignment and structure
>pdb|1SPX|A Chain A, Crystal Structure Of Glucose Dehydrogenase Of Caenorhabditis Elegans In The Apo-Form Length = 278 Back     alignment and structure
>pdb|3I4F|A Chain A, Structure Of Putative 3-oxoacyl-reductase From Bacillus Thuringiensis Length = 264 Back     alignment and structure
>pdb|4GKB|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase Homolog (Target Efi- 505321) From Burkholderia Multivorans, Unliganded Structure Length = 258 Back     alignment and structure
>pdb|2FWM|X Chain X, Crystal Structure Of E. Coli Enta, A 2,3-Dihydrodihydroxy Benzoate Dehydrogenase Length = 250 Back     alignment and structure
>pdb|1AHI|A Chain A, 7 Alpha-Hydroxysteroid Dehydrogenase Complexed With Nadh And 7-Oxo Glycochenodeoxycholic Acid Length = 255 Back     alignment and structure
>pdb|1ZBQ|A Chain A, Crystal Structure Of Human 17-beta-hydroxysteroid Dehydrogenase Type 4 In Complex With Nad Length = 327 Back     alignment and structure
>pdb|1XKQ|A Chain A, Crystal Structure Of Short-Chain DehydrogenaseREDUCTASE OF Unknown Function From Caenorhabditis Elegans With Cofactor Length = 280 Back     alignment and structure
>pdb|3KVO|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Hydroxysteroid Dehydrogenase Like 2 (Hsdl2) Length = 346 Back     alignment and structure
>pdb|4IIN|A Chain A, Crystal Structure Of A Putative 3-Oxoacyl-[acyl-Carrier Protein]reductase From Helicobacter Pylori 26695 Complexed With Nad+ Length = 271 Back     alignment and structure
>pdb|3SJU|A Chain A, Hedamycin Polyketide Ketoreductase Bound To Nadph Length = 279 Back     alignment and structure
>pdb|4E3Z|A Chain A, Crystal Structure Of A Oxidoreductase From Rhizobium Etli Cfn 42 Length = 272 Back     alignment and structure
>pdb|3UN1|A Chain A, Crystal Structure Of An Oxidoreductase From Sinorhizobium Meliloti 1021 Length = 260 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 2e-41
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 3e-30
3tjr_A301 Short chain dehydrogenase; structural genomics, se 3e-30
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 4e-29
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 4e-28
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 1e-27
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 4e-27
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 7e-27
4dqx_A277 Probable oxidoreductase protein; structural genomi 8e-27
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 2e-26
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 2e-26
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 2e-26
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 3e-26
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 3e-26
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 4e-26
1nff_A260 Putative oxidoreductase RV2002; directed evolution 6e-26
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 1e-25
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 1e-25
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 2e-25
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 2e-25
4e4y_A244 Short chain dehydrogenase family protein; structur 2e-25
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 2e-25
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 3e-25
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 3e-25
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 4e-25
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 4e-25
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 5e-25
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 6e-25
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 6e-25
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 7e-25
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 9e-25
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 1e-24
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 1e-24
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 2e-24
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 2e-24
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 2e-24
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 2e-24
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 2e-24
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 2e-24
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 2e-24
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 3e-24
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 4e-24
3tsc_A277 Putative oxidoreductase; structural genomics, seat 4e-24
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 4e-24
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 5e-24
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 5e-24
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 6e-24
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 7e-24
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 7e-24
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 7e-24
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 8e-24
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 8e-24
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 1e-23
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 1e-23
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 1e-23
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 2e-23
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 2e-23
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 2e-23
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 2e-23
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 2e-23
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 3e-23
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 3e-23
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 3e-23
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 3e-23
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 8e-23
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 9e-23
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 1e-22
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 1e-22
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 1e-22
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 2e-22
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 2e-22
1xq1_A266 Putative tropinone reducatse; structural genomics, 2e-22
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 2e-22
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 2e-22
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 2e-22
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 2e-22
3tox_A280 Short chain dehydrogenase; structural genomics, PS 3e-22
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 3e-22
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 4e-22
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 4e-22
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 5e-22
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 6e-22
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 6e-22
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 8e-22
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 8e-22
4eso_A255 Putative oxidoreductase; NADP, structural genomics 9e-22
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 1e-21
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 1e-21
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 1e-21
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 1e-21
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 2e-21
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 2e-21
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 3e-21
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 3e-21
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 3e-21
3cxt_A291 Dehydrogenase with different specificities; rossma 3e-21
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 3e-21
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 5e-21
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 6e-21
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 7e-21
3gem_A260 Short chain dehydrogenase; structural genomics, AP 8e-21
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 2e-20
3e03_A274 Short chain dehydrogenase; structural genomics, PS 2e-20
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 2e-20
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 2e-20
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 2e-20
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 3e-20
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 4e-20
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 4e-20
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 4e-20
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 4e-20
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 4e-20
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 5e-20
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 5e-20
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 6e-20
3edm_A259 Short chain dehydrogenase; structural genomics, ox 7e-20
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 1e-19
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 2e-19
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 2e-19
3imf_A257 Short chain dehydrogenase; structural genomics, in 2e-19
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 2e-19
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 2e-19
1spx_A278 Short-chain reductase family member (5L265); paral 3e-19
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 3e-19
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 4e-19
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 5e-19
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 6e-19
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 9e-19
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 1e-18
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 1e-18
1xkq_A280 Short-chain reductase family member (5D234); parra 2e-18
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 2e-18
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 2e-18
1xhl_A297 Short-chain dehydrogenase/reductase family member 4e-18
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 4e-18
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 7e-18
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 9e-18
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 1e-17
3rih_A293 Short chain dehydrogenase or reductase; structural 2e-17
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 2e-17
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 4e-17
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 6e-17
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 8e-17
1ooe_A236 Dihydropteridine reductase; structural genomics, P 8e-17
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 1e-16
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 1e-16
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 1e-16
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 1e-16
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 2e-16
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 2e-16
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 2e-16
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 3e-16
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 3e-16
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 3e-16
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 3e-16
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 4e-16
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 4e-16
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 5e-16
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 6e-16
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 6e-16
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 6e-16
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 9e-16
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 1e-15
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 1e-15
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 2e-15
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 2e-15
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 2e-15
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 3e-15
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 5e-15
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 6e-15
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 6e-15
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 6e-15
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 7e-15
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 9e-15
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 9e-15
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 4e-14
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 3e-13
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 5e-13
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 5e-13
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 1e-12
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 2e-12
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 2e-12
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 4e-12
3qlj_A322 Short chain dehydrogenase; structural genomics, se 9e-12
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 1e-11
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 9e-08
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Length = 272 Back     alignment and structure
 Score =  139 bits (352), Expect = 2e-41
 Identities = 38/106 (35%), Positives = 62/106 (58%), Gaps = 1/106 (0%)

Query: 27  AVYFKADVSDKAEIKKLNENVRK-IGYVDILINNAGIVASSSVLAHTDHEIERIMDVNLM 85
              F  D S++ +I    + V+  IG V IL+NNAG+V +S + A  D +IE+  +VN++
Sbjct: 82  VHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVL 141

Query: 86  SNIKMVREFLPDMLENNTGHIVCISSIAALTAAVNVSAYFASKYGV 131
           ++    + FLP M +NN GHIV ++S A   +   + AY +SK+  
Sbjct: 142 AHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAA 187


>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Length = 319 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Length = 301 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Length = 286 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Length = 263 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Length = 252 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Length = 269 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Length = 250 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Length = 277 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} Length = 235 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Length = 265 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Length = 264 Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Length = 277 Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Length = 246 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Length = 260 Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Length = 207 Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Length = 266 Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Length = 255 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Length = 260 Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Length = 244 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Length = 273 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Length = 254 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Length = 245 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Length = 251 Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} Length = 273 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Length = 267 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Length = 234 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Length = 260 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Length = 260 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} Length = 271 Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Length = 254 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Length = 264 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Length = 260 Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Length = 254 Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Length = 250 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Length = 254 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Length = 258 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Length = 281 Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} Length = 277 Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Length = 281 Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Length = 230 Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Length = 262 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Length = 254 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Length = 261 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Length = 253 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Length = 255 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Length = 261 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} Length = 280 Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} PDB: 3uwr_A* Length = 286 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Length = 259 Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} Length = 235 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Length = 279 Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Length = 248 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Length = 244 Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Length = 249 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} Length = 264 Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Length = 287 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Length = 281 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Length = 266 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Length = 270 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Length = 262 Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Length = 273 Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Length = 299 Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Length = 255 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Length = 266 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Length = 278 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Length = 258 Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} Length = 281 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Length = 280 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Length = 260 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Length = 272 Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Length = 259 Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Length = 317 Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Length = 327 Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Length = 252 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Length = 250 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Length = 255 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Length = 253 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Length = 251 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Length = 263 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Length = 256 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Length = 272 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} Length = 247 Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Length = 283 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Length = 346 Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Length = 247 Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Length = 254 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Length = 260 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Length = 260 Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Length = 285 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Length = 274 Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Length = 202 Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Length = 262 Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Length = 324 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Length = 270 Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Length = 276 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Length = 274 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Length = 272 Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Length = 267 Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Length = 239 Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} PDB: 3gdf_A Length = 267 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Length = 283 Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Length = 259 Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Length = 258 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Length = 260 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Length = 279 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Length = 257 Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Length = 244 Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Length = 271 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 278 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Length = 276 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Length = 280 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} Length = 287 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Length = 278 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Length = 277 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} Length = 262 Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Length = 279 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 280 Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Length = 257 Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 242 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 297 Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Length = 255 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Length = 247 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Length = 241 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Length = 263 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Length = 293 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Length = 302 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Length = 249 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Length = 277 Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Length = 281 Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 236 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Length = 303 Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Length = 257 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Length = 276 Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} Length = 256 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Length = 265 Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Length = 269 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 245 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Length = 265 Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} PDB: 3rsh_A* 3rro_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Length = 248 Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Length = 247 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} Length = 247 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Length = 266 Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Length = 270 Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Length = 244 Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Length = 269 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} Length = 249 Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Length = 246 Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} PDB: 3sj7_A* Length = 246 Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Length = 294 Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Length = 247 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Length = 285 Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Length = 253 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Length = 248 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} Length = 264 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Length = 288 Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Length = 319 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Length = 264 Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Length = 613 Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Length = 245 Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3q6i_A* 3m1l_A Length = 454 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Length = 291 Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Length = 255 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Length = 276 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Length = 291 Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Length = 328 Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Length = 257 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Length = 322 Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 250 Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} Length = 311 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query182
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 100.0
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 100.0
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 100.0
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 99.98
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 99.97
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 99.97
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 99.97
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 99.97
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 99.96
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 99.96
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 99.96
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 99.96
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 99.96
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 99.96
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.96
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 99.96
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 99.96
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 99.96
3tsc_A277 Putative oxidoreductase; structural genomics, seat 99.96
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 99.96
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 99.96
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 99.96
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 99.96
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 99.96
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 99.96
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 99.96
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 99.96
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 99.96
4dqx_A277 Probable oxidoreductase protein; structural genomi 99.96
3rih_A293 Short chain dehydrogenase or reductase; structural 99.96
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 99.96
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 99.96
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 99.96
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 99.96
3imf_A257 Short chain dehydrogenase; structural genomics, in 99.96
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 99.96
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 99.96
3e03_A274 Short chain dehydrogenase; structural genomics, PS 99.96
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 99.96
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 99.96
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 99.96
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 99.96
3tox_A280 Short chain dehydrogenase; structural genomics, PS 99.96
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 99.96
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 99.96
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 99.96
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 99.96
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 99.96
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 99.96
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 99.96
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 99.96
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 99.95
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 99.95
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 99.95
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 99.95
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 99.95
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 99.95
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 99.95
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 99.95
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 99.95
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 99.95
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 99.95
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 99.95
3tjr_A301 Short chain dehydrogenase; structural genomics, se 99.95
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 99.95
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.95
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 99.95
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 99.95
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 99.95
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 99.95
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 99.95
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 99.95
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 99.95
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.95
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 99.95
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 99.95
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 99.95
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 99.95
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 99.95
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 99.95
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 99.95
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 99.95
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 99.95
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 99.95
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 99.95
3cxt_A291 Dehydrogenase with different specificities; rossma 99.95
4eso_A255 Putative oxidoreductase; NADP, structural genomics 99.95
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.95
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 99.95
3gem_A260 Short chain dehydrogenase; structural genomics, AP 99.95
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 99.95
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 99.95
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 99.95
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.95
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 99.95
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.95
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 99.95
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 99.95
1nff_A260 Putative oxidoreductase RV2002; directed evolution 99.95
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 99.95
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.95
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 99.95
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 99.95
3edm_A259 Short chain dehydrogenase; structural genomics, ox 99.95
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 99.95
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.95
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 99.95
1spx_A278 Short-chain reductase family member (5L265); paral 99.94
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 99.94
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 99.94
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 99.94
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 99.94
4e4y_A244 Short chain dehydrogenase family protein; structur 99.94
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 99.94
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 99.94
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 99.94
3qlj_A322 Short chain dehydrogenase; structural genomics, se 99.94
1xkq_A280 Short-chain reductase family member (5D234); parra 99.94
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 99.94
1xhl_A297 Short-chain dehydrogenase/reductase family member 99.94
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.94
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 99.94
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 99.94
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 99.94
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 99.94
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 99.94
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 99.94
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 99.94
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 99.94
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 99.94
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 99.94
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 99.94
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 99.94
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 99.94
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 99.94
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 99.94
1ooe_A236 Dihydropteridine reductase; structural genomics, P 99.94
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 99.94
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 99.94
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 99.94
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 99.94
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 99.94
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 99.94
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 99.94
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 99.94
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.93
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 99.93
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 99.93
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 99.93
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 99.93
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 99.93
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 99.93
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 99.93
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 99.93
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 99.93
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 99.93
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 99.93
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.93
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 99.93
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 99.93
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 99.93
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 99.93
1xq1_A266 Putative tropinone reducatse; structural genomics, 99.93
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 99.93
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 99.93
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 99.93
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 99.93
3lt0_A329 Enoyl-ACP reductase; triclosan, triclosan variant, 99.93
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 99.93
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 99.93
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 99.93
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 99.93
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 99.93
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 99.93
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 99.93
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 99.93
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 99.92
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 99.92
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 99.92
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 99.92
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 99.92
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 99.92
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 99.92
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.92
3zu3_A405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 99.92
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 99.92
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 99.92
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 99.92
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 99.92
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 99.92
3s8m_A 422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 99.92
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 99.91
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 99.91
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 99.91
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 99.91
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 99.91
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 99.91
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 99.91
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 99.91
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 99.9
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 99.9
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 99.9
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 99.9
4eue_A418 Putative reductase CA_C0462; TER, biofuel, synthet 99.89
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 99.89
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 99.89
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 99.88
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 99.88
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 99.88
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 99.88
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 99.87
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 99.87
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 99.87
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 99.86
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 99.84
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 99.82
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 99.81
3slk_A795 Polyketide synthase extender module 2; rossmann fo 99.81
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 99.8
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 99.8
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 99.79
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 99.75
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.73
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 99.71
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 99.71
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 99.63
2pk3_A 321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 99.58
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 99.58
1kew_A 361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 99.55
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 99.55
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 99.54
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 99.53
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 99.53
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 99.51
1gy8_A 397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 99.51
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 99.5
2hun_A 336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 99.5
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 99.5
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 99.5
2p5y_A 311 UDP-glucose 4-epimerase; TTHA0591, structural geno 99.48
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 99.46
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 99.46
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 99.45
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 99.45
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 99.45
1udb_A 338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 99.45
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 99.45
2hrz_A 342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 99.44
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 99.44
4ggo_A401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 99.43
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 99.43
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 99.43
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 99.42
1r6d_A 337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 99.41
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 99.41
1oc2_A 348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 99.41
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 99.4
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 99.4
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 99.38
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 99.38
3ehe_A 313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 99.38
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 99.37
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 99.37
3ko8_A 312 NAD-dependent epimerase/dehydratase; isomerase, UD 99.36
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 99.36
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 99.35
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 99.34
3ajr_A 317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 99.34
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 99.34
2yy7_A 312 L-threonine dehydrogenase; thermolabIle, flavobact 99.3
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 99.3
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 99.28
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 99.27
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 99.27
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 99.25
2p4h_X 322 Vestitone reductase; NADPH-dependent reductase, is 99.25
1xq6_A253 Unknown protein; structural genomics, protein stru 99.25
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 99.25
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 99.24
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 99.23
2x6t_A 357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 99.23
4f6c_A 427 AUSA reductase domain protein; thioester reductase 99.23
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 99.2
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 99.2
1e6u_A 321 GDP-fucose synthetase; epimerase/reductase, SDR, R 99.19
2rh8_A 338 Anthocyanidin reductase; flavonoids, rossmann fold 99.18
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 99.16
4b8w_A 319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 99.16
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrola 99.14
1n2s_A 299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 99.13
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 99.1
2b69_A 343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 99.09
1eq2_A 310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 99.09
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 99.06
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 99.0
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 99.0
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 98.99
2jl1_A 287 Triphenylmethane reductase; oxidoreductase, biorem 98.89
4f6l_B 508 AUSA reductase domain protein; thioester reductase 98.88
3vps_A 321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 98.71
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 98.7
2zcu_A 286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 98.68
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 98.61
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 98.58
2v6g_A 364 Progesterone 5-beta-reductase; tyrosine-dependent 98.51
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 98.4
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 98.31
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 98.25
3e48_A 289 Putative nucleoside-diphosphate-sugar epimerase; a 98.19
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 98.16
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 98.07
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 98.03
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 98.03
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 97.94
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 97.87
4b4o_A 298 Epimerase family protein SDR39U1; isomerase; HET: 96.96
1y7t_A 327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 96.73
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 95.3
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 94.7
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 88.28
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 82.49
1b8p_A 329 Protein (malate dehydrogenase); oxidoreductase; 1. 81.75
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 81.06
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
Probab=100.00  E-value=8e-35  Score=215.22  Aligned_cols=161  Identities=25%  Similarity=0.259  Sum_probs=143.6

Q ss_pred             cccccccccceeccCC----------CCCCCceeEEEEccCCCHHHHHHHHHHHHh-cCCccEEEEcccCCC-CCCcccC
Q psy5462           4 DRTTGHIHGILFIPWC----------LPTKTHVAVYFKADVSDKAEIKKLNENVRK-IGYVDILINNAGIVA-SSSVLAH   71 (182)
Q Consensus         4 ~~l~~~g~~v~~~~~~----------~~~~~~~~~~~~~D~s~~~~~~~~~~~~~~-~~~id~li~~ag~~~-~~~~~~~   71 (182)
                      ++|.++|+.|...+..          +...+.++.+++||++|+++++++++.+.+ ||+||+||||||... ..++.++
T Consensus        25 ~~la~~Ga~Vv~~~~~~~~~~~~~~~i~~~g~~~~~~~~Dvt~~~~v~~~~~~~~~~~G~iDiLVNNAGi~~~~~~~~~~  104 (254)
T 4fn4_A           25 KKFALNDSIVVAVELLEDRLNQIVQELRGMGKEVLGVKADVSKKKDVEEFVRRTFETYSRIDVLCNNAGIMDGVTPVAEV  104 (254)
T ss_dssp             HHHHHTTCEEEEEESCHHHHHHHHHHHHHTTCCEEEEECCTTSHHHHHHHHHHHHHHHSCCCEEEECCCCCCTTCCGGGC
T ss_pred             HHHHHcCCEEEEEECCHHHHHHHHHHHHhcCCcEEEEEccCCCHHHHHHHHHHHHHHcCCCCEEEECCcccCCCCChhhC
Confidence            4677888888877633          234578899999999999999999999999 999999999999875 4779999


Q ss_pred             CHHHHHHHHHHHhHHHHHHHHHHhHHHHhCCCCeEEEEeccccccccCCCchhhhhHHHHHHHHHHHHhhhCCCccceee
Q psy5462          72 TDHEIERIMDVNLMSNIKMVREFLPDMLENNTGHIVCISSIAALTAAVNVSAYFASKYGVTENHPSIKCFSGYMLWGTTV  151 (182)
Q Consensus        72 ~~~~~~~~~~~n~~~~~~l~~~~~~~l~~~~~~~ii~iss~~~~~~~~~~~~y~~sKaa~~~~~~~la~e~~~~~~~i~v  151 (182)
                      +.++|++++++|+.++++++|+++|+|++++.|+||++||.++..+.++...|+++|+|+.+|+|+||.|+++.++.++.
T Consensus       105 ~~e~~~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IVnisS~~g~~~~~~~~~Y~asKaal~~ltr~lA~ela~~gIrVN~  184 (254)
T 4fn4_A          105 SDELWERVLAVNLYSAFYSSRAVIPIMLKQGKGVIVNTASIAGIRGGFAGAPYTVAKHGLIGLTRSIAAHYGDQGIRAVA  184 (254)
T ss_dssp             CHHHHHHHHHHHTHHHHHHHHHHHHHHHHHTCEEEEEECCGGGTCSSSSCHHHHHHHHHHHHHHHHHHHHHGGGTEEEEE
T ss_pred             CHHHHHHHHHHHhHHHHHHHHHHHHHHHHcCCcEEEEEechhhcCCCCCChHHHHHHHHHHHHHHHHHHHhhhhCeEEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999977666666


Q ss_pred             eCCCccccccccc
Q psy5462         152 TTPLRSVTILYQR  164 (182)
Q Consensus       152 ~~~~~~~~~~~~~  164 (182)
                      ++|++..|++...
T Consensus       185 V~PG~i~T~~~~~  197 (254)
T 4fn4_A          185 VLPGTVKTNIGLG  197 (254)
T ss_dssp             EEECSBCSSCTTS
T ss_pred             EEeCCCCCccccc
Confidence            6888888876544



>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 182
d2d1ya1248 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {T 7e-24
d1xg5a_257 c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC41 3e-22
d1yb1a_244 c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase 7e-22
d1gz6a_302 c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase do 5e-21
d2ew8a1247 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenas 5e-20
d1xq1a_259 c.2.1.2 (A:) Tropinone reductase {Thale cress (Ara 6e-18
d1zk4a1251 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase 6e-18
d1spxa_264 c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nemato 2e-17
d1hxha_253 c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydroge 1e-16
d2ae2a_259 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 1e-16
d1wmaa1275 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydrox 1e-16
d1cyda_242 c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus muscul 2e-16
d1bdba_276 c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehy 2e-16
d2gdza1254 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrog 5e-16
d1hdca_254 c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydr 1e-15
d1ydea1250 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 1e-15
d2bd0a1240 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase 4e-15
d1xkqa_272 c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorh 1e-14
d1sbya1254 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase 2e-14
d1edoa_244 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 4e-14
d1pr9a_244 c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapie 2e-13
d2bgka1268 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol de 3e-13
d2ag5a1245 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR fami 7e-13
d2c07a1251 c.2.1.2 (A:54-304) beta-keto acyl carrier protein 2e-12
d1ae1a_258 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 6e-12
d1ulsa_242 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 1e-11
d1q7ba_243 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 1e-11
d1ja9a_259 c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reduc 7e-11
d1uaya_241 c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogena 1e-10
d1xu9a_269 c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1e-10
d1uzma1237 c.2.1.2 (A:9-245) beta-keto acyl carrier protein r 1e-10
d1iy8a_258 c.2.1.2 (A:) Levodione reductase {Corynebacterium 1e-10
d1xhla_274 c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorh 3e-10
d1h5qa_260 c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Aga 4e-10
d1vl8a_251 c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga 5e-10
d1zmta1252 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Ag 9e-10
d1nffa_244 c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycob 1e-09
d1yo6a1250 c.2.1.2 (A:1-250) Putative carbonyl reductase snif 1e-09
d1jtva_285 c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroi 2e-09
d1ulua_256 c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermoph 2e-09
d1yxma1297 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA re 6e-09
d1zema1260 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconoba 2e-08
d1x1ta1260 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydroge 5e-08
d1g0oa_272 c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase 1e-07
d2rhca1257 c.2.1.2 (A:5-261) beta-keto acyl carrier protein r 2e-07
d1fmca_255 c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase 3e-07
d1o5ia_234 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 5e-07
d1fjha_257 c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase 1e-06
d1luaa1191 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopter 1e-06
d1w6ua_294 c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondr 1e-06
d1oaaa_259 c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus mus 2e-06
d1dhra_236 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 4e-06
d1geea_261 c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megat 6e-06
d2a4ka1241 c.2.1.2 (A:2-242) beta-keto acyl carrier protein r 7e-06
d1gega_255 c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Kl 9e-06
d1k2wa_256 c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter s 3e-05
d1mxha_266 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 6e-05
d2o23a1248 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydr 6e-05
d1ooea_235 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 4e-04
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Length = 248 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Hypothetical protein TTHA0369
species: Thermus thermophilus [TaxId: 274]
 Score = 91.8 bits (228), Expect = 7e-24
 Identities = 34/106 (32%), Positives = 55/106 (51%), Gaps = 1/106 (0%)

Query: 27  AVYFKADVSDKAEIKKL-NENVRKIGYVDILINNAGIVASSSVLAHTDHEIERIMDVNLM 85
             +F+ D+ D+ E  +   E    +G VD+L+NNA I A  S L     E  R+++VNL 
Sbjct: 50  GAFFQVDLEDERERVRFVEEAAYALGRVDVLVNNAAIAAPGSALTVRLPEWRRVLEVNLT 109

Query: 86  SNIKMVREFLPDMLENNTGHIVCISSIAALTAAVNVSAYFASKYGV 131
           + + +      +M +   G IV ++S+  L A    +AY ASK G+
Sbjct: 110 APMHLSALAAREMRKVGGGAIVNVASVQGLFAEQENAAYNASKGGL 155


>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Length = 257 Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 302 Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Length = 247 Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 259 Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Length = 251 Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 264 Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 253 Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Length = 259 Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Length = 276 Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Length = 254 Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 250 Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Length = 240 Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Length = 272 Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Length = 254 Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Length = 244 Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Length = 268 Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 251 Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Length = 258 Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Length = 242 Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Length = 243 Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 259 Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 237 Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Length = 258 Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Length = 274 Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Length = 260 Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 251 Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Length = 252 Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 244 Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Length = 250 Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Length = 256 Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Length = 260 Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Length = 260 Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 272 Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Length = 257 Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Length = 255 Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Length = 234 Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 257 Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Length = 191 Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 259 Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 236 Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Length = 261 Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Length = 255 Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 256 Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Length = 266 Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 235 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query182
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 100.0
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 100.0
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 100.0
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 100.0
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 100.0
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 100.0
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 100.0
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 100.0
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 100.0
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 100.0
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 99.98
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 99.98
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 99.98
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 99.98
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 99.98
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 99.98
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 99.98
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 99.97
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 99.97
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 99.97
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 99.97
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 99.97
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 99.97
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 99.97
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 99.97
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 99.97
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 99.97
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 99.96
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 99.96
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 99.96
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 99.96
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 99.96
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 99.96
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 99.96
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 99.96
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 99.96
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 99.96
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 99.95
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 99.95
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 99.95
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 99.95
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 99.95
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 99.95
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 99.94
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 99.94
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 99.94
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 99.94
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 99.94
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 99.93
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 99.93
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 99.92
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 99.92
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 99.92
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 99.92
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 99.9
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 99.9
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 99.89
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 99.87
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 99.84
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 99.83
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 99.83
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 99.78
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 99.78
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 99.76
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 99.75
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 99.54
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 99.33
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.23
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.19
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.01
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 99.01
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 98.99
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 98.98
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 98.81
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 98.79
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.78
d1r6da_ 322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 98.78
d1e6ua_ 315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 98.76
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 98.72
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.69
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 98.61
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 98.61
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 98.56
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 98.56
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 98.54
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 98.26
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 98.22
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 98.22
d1n2sa_ 298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 98.16
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 97.69
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 97.56
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 97.31
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 97.03
d1eq2a_ 307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 96.84
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 95.04
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 91.89
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 90.17
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: (s)-1-phenylethanol dehydrogenase
species: Azoarcus sp. ebn1 [TaxId: 76114]
Probab=100.00  E-value=1.5e-33  Score=206.66  Aligned_cols=162  Identities=20%  Similarity=0.212  Sum_probs=140.7

Q ss_pred             cccccccccceeccCCCC--------CCCceeEEEEccCCCHHHHHHHHHHHHh-cCCccEEEEcccCCCCCCcccCCHH
Q psy5462           4 DRTTGHIHGILFIPWCLP--------TKTHVAVYFKADVSDKAEIKKLNENVRK-IGYVDILINNAGIVASSSVLAHTDH   74 (182)
Q Consensus         4 ~~l~~~g~~v~~~~~~~~--------~~~~~~~~~~~D~s~~~~~~~~~~~~~~-~~~id~li~~ag~~~~~~~~~~~~~   74 (182)
                      ++|.+.|+.|.+.+....        ..+.++.++.||++|+++++++++.+.+ ||++|++|||||.....++.+.+.+
T Consensus        23 ~~la~~Ga~V~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~~~~~~~~~~G~iDilVnnAG~~~~~~~~~~~~e  102 (247)
T d2ew8a1          23 ERFAVEGADIAIADLVPAPEAEAAIRNLGRRVLTVKCDVSQPGDVEAFGKQVISTFGRCDILVNNAGIYPLIPFDELTFE  102 (247)
T ss_dssp             HHHHHTTCEEEEEESSCCHHHHHHHHHTTCCEEEEECCTTCHHHHHHHHHHHHHHHSCCCEEEECCCCCCCCCGGGCCHH
T ss_pred             HHHHHCCCEEEEEECCchHHHHHHHHHcCCcEEEEEeeCCCHHHHHHHHHHHHHHcCCCCEEEECCCCCCCCChHhCCHH
Confidence            467788998888764332        3467899999999999999999999999 9999999999999988999999999


Q ss_pred             HHHHHHHHHhHHHHHHHHHHhHHHHhCCCCeEEEEeccccccccCCCchhhhhHHHHHHHHHHHHhhhCCCccceeeeCC
Q psy5462          75 EIERIMDVNLMSNIKMVREFLPDMLENNTGHIVCISSIAALTAAVNVSAYFASKYGVTENHPSIKCFSGYMLWGTTVTTP  154 (182)
Q Consensus        75 ~~~~~~~~n~~~~~~l~~~~~~~l~~~~~~~ii~iss~~~~~~~~~~~~y~~sKaa~~~~~~~la~e~~~~~~~i~v~~~  154 (182)
                      +|+.++++|+.++++++|+++|+|++++.|+||++||.++..+.+....|+++|+|+.+|+|+||.|+++.++.++..+|
T Consensus       103 ~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~Iv~isS~~~~~~~~~~~~Y~asKaal~~ltk~lA~ela~~gIrVN~I~P  182 (247)
T d2ew8a1         103 QWKKTFEINVDSGFLMAKAFVPGMKRNGWGRIINLTSTTYWLKIEAYTHYISTKAANIGFTRALASDLGKDGITVNAIAP  182 (247)
T ss_dssp             HHHHHHHHHTHHHHHHHHHHHHHHHHHTCEEEEEECCGGGGSCCSSCHHHHHHHHHHHHHHHHHHHHHGGGTEEEEEEEE
T ss_pred             HhhhhheeehhhhhHHHHHHHhHHHhcCCCCccccccchhcccCcccccchhhhccHHHHHHHHHHHhcccCeEEEEEee
Confidence            99999999999999999999999999989999999999999999999999999999999999999999977666666688


Q ss_pred             Ccccccccccc
Q psy5462         155 LRSVTILYQRS  165 (182)
Q Consensus       155 ~~~~~~~~~~~  165 (182)
                      ++..|++.+..
T Consensus       183 G~i~T~~~~~~  193 (247)
T d2ew8a1         183 SLVRTATTEAS  193 (247)
T ss_dssp             CCC--------
T ss_pred             CCCCCcccccc
Confidence            88888776543



>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure