Psyllid ID: psy6011

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------39
MSIVVAEVETKIVVVPNSKYGAEKHQLCREMNPGPLVWCASWVVGYSLEHGGRLEGSRGVDAPYAVIVFIHGESYEWNAGNHYDGSVLASSGHIIFVSINYRLGILGFLKTQTGHTQSGNWAVSDVIAALEWIKINIASFGGDPTRITLFGHDTGAALVNIVLLTPSVKGLFHRVTLLSGSILSPWSFVHDPDSIRSNVADQLGCTLSDNLAPCLRTHTLASLLQVNLTPPRFLAGFGPHLFTDPNVALEKAGDNFVTTPLMAGVVTTESYLNFNANDIQYGFEEDQRNRVLRLTDDQRVQYLLSKLSGSALTVCSGIPPIGSNYQTIWNLLVDRYEDKRALASSYIDQIIKTYVRNAYVYHLNEIFSTIRNEYTDWDKNNNRLWSGR
ccEEEEEEEcEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccccccccccccHHHHccccEEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccEEcccHHHHHHHHHHHcccccccHHHHHHccccccccccccccHHHHHHHHHHHcccccccHHHHHHccccHHHHHcccccccccccccccccccccHHHHHHHccccccccEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcccccccccccccccccccccccccc
cEEEEccccccEEEEEEcccccccccccccccccccccccccccccEEEEEEEEcccccccccccEEEEEccccccccccccHccHHHHHHHccEEEEcccccHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHcEEEEEEEEEEEcHHHHHHHHHHHcHHHHccccEEEEEccccccccccEccHHHHHHHHHHHHccccccHHHHHHHcccHHHHHHHccccccccccccccccccccHHHHHHccccccccEEEEEEccccEEEEEccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHcccccccHHHHHHHHHHHHcccccHcHHHHHHHHHHccccEEEEEEEccccHHcccccccccccccccccc
MSIVVAEVETKIVVvpnskygaekhqlcremnpgplvwCASWVVgyslehggrlegsrgvdapyAVIVFIHGesyewnagnhydgsvlassGHIIFVSINYRLGILGFLktqtghtqsgnwAVSDVIAALEWIKINIasfggdptritlfghdTGAALVNIVLLTPSVKGLFHRVTLlsgsilspwsfvhdpdsirsnvadqlgctlsdnlapclrTHTLASLLqvnltpprflagfgphlftdpnvalekagdnfvttplmaGVVTTESYlnfnandiqygfeedqrnrvlrltDDQRVQYLLSKLsgsaltvcsgippigsnyQTIWNLLVDRYEDKRALASSYIDQIIKTYVRNAYVYHLNEIFSTIRNEYtdwdknnnrlwsgr
msivvaevetkivvvpnskygaeKHQLCREMNPGPLVWCASWVVGYSLEHGGRLEGSRGVDAPYAVIVFIHGESYEWNAGNHYDGSVLASSGHIIFVSINYRLGILGFLKTQTGHTQSGNWAVSDVIAALEWIKINIASFGGDPTRITLFGHDTGAALVNIVLLTPSVKGLFHRVTLLSGSILSPWSFVHDPDSIRSNVADQLGCTLSDNLAPCLRTHTLASLLQVNLTPPRFLAGFGPHLFTDPNVALEKAGDNFVTTPLMAGVVTTESYLNFNANDIQYGFEEDQRNRVLRLTDDQRVQYLLSKLSGSALTVCSGIPPIGSNYQTIWNLLVDRYEDKRALASSYIDQIIKTYVRNAYVYHLNEIFSTirneytdwdknnnrlwsgr
MSivvaevetkivvvPNSKYGAEKHQLCREMNPGPLVWCASWVVGYSLEHGGRLEGSRGVDAPYAVIVFIHGESYEWNAGNHYDGSVLASSGHIIFVSINYRLGILGFLKTQTGHTQSGNWAVSDVIAALEWIKINIASFGGDPTRITLFGHDTGAALVNIVLLTPSVKGLFHRVTLLSGSILSPWSFVHDPDSIRSNVADQLGCTLSDNLAPCLRTHTLASLLQVNLTPPRFLAGFGPHLFTDPNVALEKAGDNFVTTPLMAGVVTTESYLNFNANDIQYGFEEDQRNRVLRLTDDQRVQYLLSKLSGSALTVCSGIPPIGSNYQTIWNLLVDRYEDKRALASSYIDQIIKTYVRNAYVYHLNEIFSTIRNEYTDWDKNNNRLWSGR
**IVVAEVETKIVVVPNSKYGAEKHQLCREMNPGPLVWCASWVVGYSLEHGGRLEGSRGVDAPYAVIVFIHGESYEWNAGNHYDGSVLASSGHIIFVSINYRLGILGFLKTQTGHTQSGNWAVSDVIAALEWIKINIASFGGDPTRITLFGHDTGAALVNIVLLTPSVKGLFHRVTLLSGSILSPWSFVHDPDSIRSNVADQLGCTLSDNLAPCLRTHTLASLLQVNLTPPRFLAGFGPHLFTDPNVALEKAGDNFVTTPLMAGVVTTESYLNFNANDIQYGFEEDQRNRVLRLTDDQRVQYLLSKLSGSALTVCSGIPPIGSNYQTIWNLLVDRYEDKRALASSYIDQIIKTYVRNAYVYHLNEIFSTIRNEYTDWDKN********
*****AEVETKIVVVPNSKYGAEKHQLCREMNPGPLVWCASWVVGYSLEH**********DAPYAVIVFIHGESYEWNAGNHYDGSVLASSGHIIFVSINYRLGILGFLKTQTGHTQSGNWAVSDVIAALEWIKINIASFGGDPTRITLFGHDTGAALVNIVLLTPSVKGLFHRVTLLSGSILSPWSFVHDPDSIRSNVADQLGCTLSDNLAPCLRTHTLASLLQVNLTPPRFLAGFGPHLFTDPNVALEKAGDNFVTTPLMAGVVTTESYLNFNANDIQYGFEEDQRNRVLRLTDDQRVQYLLSKLSGSALTVCSGIPPIGSNYQTIWNLLVDRYEDKRALASSYIDQIIKTYVRNAYVYHLNEIFSTIRNEYTDWDKNN**L****
MSIVVAEVETKIVVVPNSKYGAEKHQLCREMNPGPLVWCASWVVGYSLEHGGRLEGSRGVDAPYAVIVFIHGESYEWNAGNHYDGSVLASSGHIIFVSINYRLGILGFLKTQTGHTQSGNWAVSDVIAALEWIKINIASFGGDPTRITLFGHDTGAALVNIVLLTPSVKGLFHRVTLLSGSILSPWSFVHDPDSIRSNVADQLGCTLSDNLAPCLRTHTLASLLQVNLTPPRFLAGFGPHLFTDPNVALEKAGDNFVTTPLMAGVVTTESYLNFNANDIQYGFEEDQRNRVLRLTDDQRVQYLLSKLSGSALTVCSGIPPIGSNYQTIWNLLVDRYEDKRALASSYIDQIIKTYVRNAYVYHLNEIFSTIRNEYTDWDKNNNRLWSGR
MSIVVAEVETKIVVVPNSKYGAEKHQLCREMNPGPLVWCASWVVGYSLEHGGRLEGSRGVDAPYAVIVFIHGESYEWNAGNHYDGSVLASSGHIIFVSINYRLGILGFLKTQTGHTQSGNWAVSDVIAALEWIKINIASFGGDPTRITLFGHDTGAALVNIVLLTPSVKGLFHRVTLLSGSILSPWSFVHDPDSIRSNVADQLGCTLSDNLAPCLRTHTLASLLQVNLTPPRFLAGFGPHLFTDPNVALEKAGDNFVTTPLMAGVVTTESYLNFNANDIQYGFEEDQRNRVLRLTDDQRVQYLLSKLSGSALTVCSGIPPIGSNYQTIWNLLVDRYEDKRALASSYIDQIIKTYVRNAYVYHLNEIFSTIRNEYTDW***********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIVVAEVETKIVVVPNSKYGAEKHQLCREMNPGPLVWCASWVVGYSLEHGGRLEGSRGVDAPYAVIVFIHGESYEWNAGNHYDGSVLASSGHIIFVSINYRLGILGFLKTQTGHTQSGNWAVSDVIAALEWIKINIASFGGDPTRITLFGHDTGAALVNIVLLTPSVKGLFHRVTLLSGSILSPWSFVHDPDSIRSNVADQLGCTLSDNLAPCLRTHTLASLLQVNLTPPRFLAGFGPHLFTDPNVALEKAGDNFVTTPLMAGVVTTESYLNFNANDIQYGFEEDQRNRVLRLTDDQRVQYLLSKLSGSALTVCSGIPPIGSNYQTIWNLLVDRYEDKRALASSYIDQIIKTYVRNAYVYHLNEIFSTIRNEYTDWDKNNNRLWSGR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query388 2.2.26 [Sep-21-2011]
Q8N0W4 816 Neuroligin-4, X-linked OS yes N/A 0.507 0.241 0.396 2e-36
Q62889 848 Neuroligin-3 OS=Rattus no yes N/A 0.507 0.232 0.405 3e-36
Q9NZ94 848 Neuroligin-3 OS=Homo sapi no N/A 0.507 0.232 0.400 3e-36
Q8BYM5 825 Neuroligin-3 OS=Mus muscu yes N/A 0.507 0.238 0.405 3e-36
Q8NFZ3 816 Neuroligin-4, Y-linked OS yes N/A 0.507 0.241 0.391 6e-36
Q9XTG1 798 Neuroligin-1 OS=Caenorhab yes N/A 0.646 0.314 0.329 7e-36
Q99K10 843 Neuroligin-1 OS=Mus muscu no N/A 0.546 0.251 0.385 2e-35
Q8N2Q7 840 Neuroligin-1 OS=Homo sapi no N/A 0.528 0.244 0.388 6e-35
Q62765 843 Neuroligin-1 OS=Rattus no no N/A 0.528 0.243 0.388 8e-35
Q69ZK9 836 Neuroligin-2 OS=Mus muscu no N/A 0.440 0.204 0.413 3e-32
>sp|Q8N0W4|NLGNX_HUMAN Neuroligin-4, X-linked OS=Homo sapiens GN=NLGN4X PE=1 SV=1 Back     alignment and function desciption
 Score =  153 bits (386), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 82/207 (39%), Positives = 122/207 (58%), Gaps = 10/207 (4%)

Query: 66  VIVFIHGESYEWNAGNHYDGSVLASSGHIIFVSINYRLGILGFLKTQTGHTQSGNWAVSD 125
           V+V+IHG SY    GN  DGS+LAS G++I ++INYRLGILGFL T       GN+ + D
Sbjct: 168 VMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGFLST-GDQAAKGNYGLLD 226

Query: 126 VIAALEWIKINIASFGGDPTRITLFGHDTGAALVNIVLLTPSVKGLFHRVTLLSGSILSP 185
            I AL WI+ N+ +FGGDP R+T+FG   GA+ V+++ L+   +GLF +  + SG+ LS 
Sbjct: 227 QIQALRWIEENVGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSS 286

Query: 186 WSFVHDPDSIRSNVADQLGCTLSD--NLAPCLRTHTLASLLQVNLTPPRFLAGFGP---- 239
           W+  + P      +AD++GC + D  ++  CLR      L+Q  +TP  +   FGP    
Sbjct: 287 WAVNYQPAKYTRILADKVGCNMLDTTDMVECLRNKNYKELIQQTITPATYHIAFGPVIDG 346

Query: 240 -HLFTDPNVALEKAGDNFVTTPLMAGV 265
             +  DP + +E+    F+   +M GV
Sbjct: 347 DVIPDDPQILMEQG--EFLNYDIMLGV 371
Putative neuronal cell surface protein involved in cell-cell-interactions.
Homo sapiens (taxid: 9606)
>sp|Q62889|NLGN3_RAT Neuroligin-3 OS=Rattus norvegicus GN=Nlgn3 PE=1 SV=1 Back     alignment and function description
>sp|Q9NZ94|NLGN3_HUMAN Neuroligin-3 OS=Homo sapiens GN=NLGN3 PE=1 SV=2 Back     alignment and function description
>sp|Q8BYM5|NLGN3_MOUSE Neuroligin-3 OS=Mus musculus GN=Nlgn3 PE=1 SV=2 Back     alignment and function description
>sp|Q8NFZ3|NLGNY_HUMAN Neuroligin-4, Y-linked OS=Homo sapiens GN=NLGN4Y PE=2 SV=1 Back     alignment and function description
>sp|Q9XTG1|NLGN1_CAEEL Neuroligin-1 OS=Caenorhabditis elegans GN=nlg-1 PE=1 SV=1 Back     alignment and function description
>sp|Q99K10|NLGN1_MOUSE Neuroligin-1 OS=Mus musculus GN=Nlgn1 PE=1 SV=2 Back     alignment and function description
>sp|Q8N2Q7|NLGN1_HUMAN Neuroligin-1 OS=Homo sapiens GN=NLGN1 PE=1 SV=2 Back     alignment and function description
>sp|Q62765|NLGN1_RAT Neuroligin-1 OS=Rattus norvegicus GN=Nlgn1 PE=1 SV=1 Back     alignment and function description
>sp|Q69ZK9|NLGN2_MOUSE Neuroligin-2 OS=Mus musculus GN=Nlgn2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query388
345498298 861 PREDICTED: neuroligin-4, X-linked [Nason 0.682 0.307 0.476 3e-82
350396176 850 PREDICTED: neuroligin-1-like [Bombus imp 0.682 0.311 0.489 1e-77
340719151 850 PREDICTED: neuroligin-1-like [Bombus ter 0.682 0.311 0.489 1e-77
170050937421 conserved hypothetical protein [Culex qu 0.734 0.676 0.441 3e-74
158300767 792 AGAP011916-PA [Anopheles gambiae str. PE 0.675 0.330 0.433 6e-74
403182819 542 AAEL017095-PA, partial [Aedes aegypti] 0.682 0.488 0.426 2e-72
224809495 850 neuroligin 5 [Apis mellifera] gi|2223548 0.682 0.311 0.462 4e-71
380012247 812 PREDICTED: neuroligin-4, Y-linked-like [ 0.682 0.326 0.462 5e-71
383848803 850 PREDICTED: neuroligin-1-like [Megachile 0.613 0.28 0.558 3e-69
157104438 812 neuroligin, putative [Aedes aegypti] gi| 0.724 0.346 0.413 1e-62
>gi|345498298|ref|XP_001606858.2| PREDICTED: neuroligin-4, X-linked [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  311 bits (798), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 160/336 (47%), Positives = 207/336 (61%), Gaps = 71/336 (21%)

Query: 56  GSRGVDAPYAVIVFIHGESYEWNAGNHYDGSVLASSGHIIFVSINYRLGILGFLKTQ--- 112
           G+RG++APYAVIV++HGES+EW  GN YDGSVLAS+GH+I +++NYRLGILGFL+T+   
Sbjct: 166 GARGLEAPYAVIVYVHGESFEWGTGNIYDGSVLASAGHVIVITLNYRLGILGFLRTKPIT 225

Query: 113 --TGHTQSGNWAVSDVIAALEWIKINIASFGGDPTRITLFGHDTGAALVNIVLLTPSVKG 170
             T    SGN A+ D+  AL W++ NI +FGGDPTR+TL GHDTGAALVN +LL P  KG
Sbjct: 226 ESTDSVMSGNLALHDIALALTWVRENIGAFGGDPTRVTLMGHDTGAALVNYILLAPFAKG 285

Query: 171 LFHRVTLLSGSILSPWSFVHDPDSIRSNVADQLGCTLS--DNLAPCLRTHTLASLLQVNL 228
           LFH + LLSGS LSPW+ +HDP+ +R  VA QL C     +++A CLR  +L +LL V L
Sbjct: 286 LFHNIVLLSGSALSPWASIHDPNDLRVQVAKQLDCRHENDEDIAECLRAVSLEALLGVEL 345

Query: 229 TPPRFLAGFGPHL-----FTDPNVALEKAGDNFVTTPLMAGVVTTESYLNFNANDIQYGF 283
              +F+   GP +       DP + +E+  D F+  PL+ GV T ESYL+FNANDIQYGF
Sbjct: 346 NEIKFMPSIGPSVPVDGSHPDPGLDMERLSDAFIKVPLILGVSTAESYLDFNANDIQYGF 405

Query: 284 EEDQRNRVLRLTDDQRVQYLLSKLSGSALTVCSGIPPIGSNYQTIWNLLVDRYEDKRALA 343
           EE           DQR                                            
Sbjct: 406 EE-----------DQR-------------------------------------------- 410

Query: 344 SSYIDQIIKTYVRNAYVYHLNEIFSTIRNEYTDWDK 379
               +++++T++RNAYVYHLNEIFS +RNEYTDWDK
Sbjct: 411 ----NRVLRTFIRNAYVYHLNEIFSAVRNEYTDWDK 442

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|350396176|ref|XP_003484467.1| PREDICTED: neuroligin-1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340719151|ref|XP_003398020.1| PREDICTED: neuroligin-1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|170050937|ref|XP_001861537.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167872414|gb|EDS35797.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|158300767|ref|XP_552325.3| AGAP011916-PA [Anopheles gambiae str. PEST] gi|157013319|gb|EAL38837.3| AGAP011916-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|403182819|gb|EJY57653.1| AAEL017095-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|224809495|ref|NP_001139211.1| neuroligin 5 [Apis mellifera] gi|222354856|gb|ACM48189.1| neuroligin 5 [Apis mellifera] Back     alignment and taxonomy information
>gi|380012247|ref|XP_003690197.1| PREDICTED: neuroligin-4, Y-linked-like [Apis florea] Back     alignment and taxonomy information
>gi|383848803|ref|XP_003700037.1| PREDICTED: neuroligin-1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|157104438|ref|XP_001648408.1| neuroligin, putative [Aedes aegypti] gi|108869198|gb|EAT33423.1| AAEL014303-PA [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query388
FB|FBgn0083963 1159 CG34127 [Drosophila melanogast 0.474 0.158 0.520 6e-62
FB|FBgn0031866 1248 neuroligin "neuroligin" [Droso 0.548 0.170 0.479 5.3e-59
FB|FBgn0083975 1281 CG34139 [Drosophila melanogast 0.502 0.152 0.444 3.9e-53
FB|FBgn0051146 1354 Nlg1 "Neuroligin 1" [Drosophil 0.592 0.169 0.403 1.1e-42
UNIPROTKB|E7EVK0513 NLGN3 "Neuroligin-3" [Homo sap 0.507 0.384 0.405 2.2e-40
UNIPROTKB|F1NGC1 609 NLGN4X "Uncharacterized protei 0.507 0.323 0.410 3.9e-40
UNIPROTKB|D2X2H2 836 nlgn4 "Neuroligin 4" [Gallus g 0.507 0.235 0.410 6.5e-39
ZFIN|ZDB-GENE-060526-197 846 nlgn3b "neuroligin 3b" [Danio 0.548 0.251 0.408 6.6e-39
ZFIN|ZDB-GENE-090918-2 828 nlgn2a "neuroligin 2a" [Danio 0.507 0.237 0.400 8.8e-39
UNIPROTKB|Q08DF0 808 NLGN3 "Uncharacterized protein 0.507 0.243 0.410 1.1e-38
FB|FBgn0083963 CG34127 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 465 (168.7 bits), Expect = 6.0e-62, Sum P(3) = 6.0e-62
 Identities = 101/194 (52%), Positives = 127/194 (65%)

Query:    56 GSRGVDAPYAVIVFIHGESYEWNAGNHYDGSVLASSGHIIFVSINYRLGILGFLKTQTGH 115
             GS G  A Y V+VF+HGESYEWN+GN YDGSVLAS G I+ V+INYRLG+LGFL   T  
Sbjct:   309 GS-GSPAKYPVLVFVHGESYEWNSGNPYDGSVLASYGQILVVTINYRLGVLGFLNANTDR 367

Query:   116 TQS--GNWAVSDVIAALEWIKINIASFGGDPTRITLFGHDTGAALVNIVLLTPSV-KGL- 171
                   N+ + D+IAAL W+K NIA+FGGDP  ITL GH TGAA V+ ++ + +V +GL 
Sbjct:   368 YSKLPANYGLMDIIAALHWLKENIAAFGGDPNSITLAGHGTGAACVHFLISSMAVPEGLL 427

Query:   172 FHRVTLLSGSILSPWSFVHDPDSIRSNVADQLGCTLSD----NLAPCLRTHTLASLLQVN 227
             F+R  L+SGS L+PWS V +P    + VA  + C  SD    +L  CLR  TL  LL V 
Sbjct:   428 FNRAILMSGSGLAPWSLVSNPAKYAAIVAHHVNCA-SDLPHAHLMKCLREKTLDQLLSVP 486

Query:   228 LTPPRFLAGFGPHL 241
             + PP F   FGP +
Sbjct:   487 IRPPEFGFAFGPSI 500
GO:0004091 "carboxylesterase activity" evidence=IKR;NAS
GO:0042043 "neurexin family protein binding" evidence=ISS;IBA
GO:0006911 "phagocytosis, engulfment" evidence=IMP
GO:0022008 "neurogenesis" evidence=IMP
GO:0009986 "cell surface" evidence=IBA
GO:0045202 "synapse" evidence=IBA
GO:0005887 "integral to plasma membrane" evidence=IBA
GO:0007416 "synapse assembly" evidence=IBA
GO:0004872 "receptor activity" evidence=IBA
FB|FBgn0031866 neuroligin "neuroligin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0083975 CG34139 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0051146 Nlg1 "Neuroligin 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E7EVK0 NLGN3 "Neuroligin-3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NGC1 NLGN4X "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|D2X2H2 nlgn4 "Neuroligin 4" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060526-197 nlgn3b "neuroligin 3b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090918-2 nlgn2a "neuroligin 2a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q08DF0 NLGN3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query388
pfam00135510 pfam00135, COesterase, Carboxylesterase family 4e-62
cd00312493 cd00312, Esterase_lipase, Esterases and lipases (i 8e-51
COG2272491 COG2272, PnbA, Carboxylesterase type B [Lipid meta 2e-37
COG0657312 COG0657, Aes, Esterase/lipase [Lipid metabolism] 6e-09
pfam03564146 pfam03564, DUF1759, Protein of unknown function (D 1e-07
pfam07859207 pfam07859, Abhydrolase_3, alpha/beta hydrolase fol 4e-04
COG1506620 COG1506, DAP2, Dipeptidyl aminopeptidases/acylamin 9e-04
>gnl|CDD|215741 pfam00135, COesterase, Carboxylesterase family Back     alignment and domain information 
 Score =  207 bits (529), Expect = 4e-62
 Identities = 87/242 (35%), Positives = 119/242 (49%), Gaps = 13/242 (5%)

Query: 63  PYAVIVFIHGESYEWNAGNH--YDGSVLASSGHIIFVSINYRLGILGFLKTQTGHTQSGN 120
              V+V+IHG  ++  + +   YDG  LA+S  ++ V+INYRLG LGFL T       GN
Sbjct: 99  KLPVMVWIHGGGFQSGSASLDDYDGPDLAASEDVVVVTINYRLGALGFLSTGDSEL-PGN 157

Query: 121 WAVSDVIAALEWIKINIASFGGDPTRITLFGHDTGAALVNIVLLTPSVKGLFHRVTLLSG 180
             + D + AL W+K NIA+FGGDP  +TLFG   GAA V+++LL+P+ +GLFHR  L+SG
Sbjct: 158 AGLLDQVLALRWVKDNIAAFGGDPDNVTLFGESAGAASVSLLLLSPASRGLFHRAILMSG 217

Query: 181 SILSPWSFVHDPDSIRSNVADQLGCTLSDN---LAPCLRTHTLASLLQVNLTPPRFLAGF 237
           S LSPW+   +P      +A  LGC   D+   L  CLR  +   LL   L     +  F
Sbjct: 218 SALSPWAITSNPRQRAKRLAKLLGCPGEDSSAELLECLRKKSAEELLDAQLLLLEEVGFF 277

Query: 238 ------GPHLFTDPNVALEKAGDNFVTTPLMAGVVTTESYLNFNANDIQYGFEEDQRNRV 291
                            L K+G  F   PL+ GV + E  L             +  N  
Sbjct: 278 PFGPVVDGDFLPKDPEELLKSG-WFNKVPLLIGVTSDEGLLFLAYVLPDPTELSELLNED 336

Query: 292 LR 293
             
Sbjct: 337 FL 338

Length = 510
>gnl|CDD|238191 cd00312, Esterase_lipase, Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>gnl|CDD|225181 COG2272, PnbA, Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|223730 COG0657, Aes, Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|202685 pfam03564, DUF1759, Protein of unknown function (DUF1759) Back     alignment and domain information
>gnl|CDD|219611 pfam07859, Abhydrolase_3, alpha/beta hydrolase fold Back     alignment and domain information
>gnl|CDD|224423 COG1506, DAP2, Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 388
PF00135535 COesterase: Carboxylesterase family The prints ent 100.0
KOG4389|consensus 601 100.0
COG2272491 PnbA Carboxylesterase type B [Lipid metabolism] 100.0
cd00312493 Esterase_lipase Esterases and lipases (includes fu 100.0
KOG1516|consensus545 100.0
KOG1515|consensus336 99.87
COG0657312 Aes Esterase/lipase [Lipid metabolism] 99.83
PRK10162318 acetyl esterase; Provisional 99.79
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 99.78
KOG4627|consensus270 99.31
KOG4388|consensus 880 99.15
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 99.13
PF10340374 DUF2424: Protein of unknown function (DUF2424); In 99.09
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 99.01
PLN00021313 chlorophyllase 98.88
PF10503220 Esterase_phd: Esterase PHB depolymerase 98.8
PRK10115686 protease 2; Provisional 98.79
PF12740259 Chlorophyllase2: Chlorophyllase enzyme; InterPro: 98.64
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 98.61
COG3509312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 98.61
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 98.56
KOG2281|consensus867 98.54
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 98.37
PRK10566249 esterase; Provisional 98.35
PLN02442283 S-formylglutathione hydrolase 98.35
KOG2100|consensus755 98.31
PLN02298330 hydrolase, alpha/beta fold family protein 98.31
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 98.28
PHA02857276 monoglyceride lipase; Provisional 98.2
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 98.15
PRK10439411 enterobactin/ferric enterobactin esterase; Provisi 98.15
PRK13604307 luxD acyl transferase; Provisional 98.15
PLN02385349 hydrolase; alpha/beta fold family protein 98.09
PRK11460232 putative hydrolase; Provisional 98.09
PRK10985324 putative hydrolase; Provisional 98.08
COG0400207 Predicted esterase [General function prediction on 98.04
COG4099387 Predicted peptidase [General function prediction o 98.03
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 98.03
COG0412236 Dienelactone hydrolase and related enzymes [Second 97.95
PF00756251 Esterase: Putative esterase; InterPro: IPR000801 T 97.92
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 97.92
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 97.91
KOG1552|consensus258 97.91
PLN02652395 hydrolase; alpha/beta fold family protein 97.89
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 97.87
KOG2564|consensus343 97.87
PRK05077414 frsA fermentation/respiration switch protein; Revi 97.84
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 97.81
PF03403379 PAF-AH_p_II: Platelet-activating factor acetylhydr 97.8
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 97.77
PF07224307 Chlorophyllase: Chlorophyllase; InterPro: IPR01082 97.74
PRK10673255 acyl-CoA esterase; Provisional 97.73
TIGR03611257 RutD pyrimidine utilization protein D. This protei 97.73
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 97.66
PLN02511388 hydrolase 97.65
PF05448320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 97.65
PRK00870302 haloalkane dehalogenase; Provisional 97.64
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 97.6
PLN02872395 triacylglycerol lipase 97.59
PLN02894402 hydrolase, alpha/beta fold family protein 97.58
PLN02965255 Probable pheophorbidase 97.56
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 97.55
PRK03204286 haloalkane dehalogenase; Provisional 97.52
PF00151331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 97.5
PLN02211273 methyl indole-3-acetate methyltransferase 97.49
KOG1455|consensus313 97.48
PLN02824294 hydrolase, alpha/beta fold family protein 97.47
PRK10749330 lysophospholipase L2; Provisional 97.47
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 97.34
KOG4391|consensus300 97.33
PF12715390 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 97.31
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 97.3
KOG3847|consensus399 97.29
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 97.27
PF02129272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 97.27
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 97.26
COG2267298 PldB Lysophospholipase [Lipid metabolism] 97.26
PRK06489360 hypothetical protein; Provisional 97.21
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 97.17
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 97.16
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 97.13
PRK10349256 carboxylesterase BioH; Provisional 97.1
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 97.08
PRK03592295 haloalkane dehalogenase; Provisional 97.08
COG3458321 Acetyl esterase (deacetylase) [Secondary metabolit 97.03
COG2819264 Predicted hydrolase of the alpha/beta superfamily 97.0
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 96.99
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 96.98
PF08538303 DUF1749: Protein of unknown function (DUF1749); In 96.94
TIGR03230442 lipo_lipase lipoprotein lipase. Members of this pr 96.9
PRK07581339 hypothetical protein; Validated 96.84
KOG1838|consensus409 96.79
COG2945210 Predicted hydrolase of the alpha/beta superfamily 96.73
COG4188365 Predicted dienelactone hydrolase [General function 96.71
KOG2237|consensus712 96.65
PRK05855 582 short chain dehydrogenase; Validated 96.65
PLN02578354 hydrolase 96.64
PLN02679360 hydrolase, alpha/beta fold family protein 96.64
COG0429345 Predicted hydrolase of the alpha/beta-hydrolase fo 96.63
PLN03084383 alpha/beta hydrolase fold protein; Provisional 96.54
PRK11071190 esterase YqiA; Provisional 96.52
KOG3101|consensus283 96.5
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 96.5
PF05577434 Peptidase_S28: Serine carboxypeptidase S28; InterP 96.47
COG1770682 PtrB Protease II [Amino acid transport and metabol 96.35
PRK08775343 homoserine O-acetyltransferase; Provisional 96.21
COG1647243 Esterase/lipase [General function prediction only] 96.16
COG2382299 Fes Enterochelin esterase and related enzymes [Ino 96.16
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 96.09
KOG4409|consensus365 95.96
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 95.95
KOG4178|consensus322 95.88
TIGR03502792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 95.69
TIGR01838532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 95.6
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 95.5
PRK00175379 metX homoserine O-acetyltransferase; Provisional 95.42
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 95.35
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 95.33
COG0627316 Predicted esterase [General function prediction on 95.31
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 94.9
KOG2382|consensus315 94.77
PF08840213 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term 94.76
PF11187224 DUF2974: Protein of unknown function (DUF2974); In 94.6
PRK07868 994 acyl-CoA synthetase; Validated 94.49
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 94.31
COG4757281 Predicted alpha/beta hydrolase [General function p 94.19
PF06342297 DUF1057: Alpha/beta hydrolase of unknown function 93.98
PRK06765389 homoserine O-acetyltransferase; Provisional 93.84
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 93.79
PF03283361 PAE: Pectinacetylesterase 93.78
PF11144403 DUF2920: Protein of unknown function (DUF2920); In 93.05
COG2936 563 Predicted acyl esterases [General function predict 92.99
KOG4840|consensus299 92.23
COG3150191 Predicted esterase [General function prediction on 92.14
PF05677365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 91.98
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 91.95
PTZ00472462 serine carboxypeptidase (CBP1); Provisional 91.77
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 91.66
COG1505648 Serine proteases of the peptidase family S9A [Amin 91.4
KOG3975|consensus301 91.27
PF07082250 DUF1350: Protein of unknown function (DUF1350); In 91.06
COG4782377 Uncharacterized protein conserved in bacteria [Fun 90.87
KOG3967|consensus297 90.18
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 90.13
COG1075336 LipA Predicted acetyltransferases and hydrolases w 89.88
PF09752348 DUF2048: Uncharacterized conserved protein (DUF204 89.66
KOG2112|consensus206 89.56
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 89.36
PRK04940180 hypothetical protein; Provisional 89.15
PF03583290 LIP: Secretory lipase ; InterPro: IPR005152 This e 89.02
COG3319257 Thioesterase domains of type I polyketide synthase 88.47
KOG2183|consensus492 87.89
PLN02408365 phospholipase A1 87.88
COG4814288 Uncharacterized protein with an alpha/beta hydrola 87.81
PF03959212 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 87.08
PF11339 581 DUF3141: Protein of unknown function (DUF3141); In 86.92
KOG1454|consensus326 86.58
KOG4667|consensus269 86.52
PF039918 Prion_octapep: Copper binding octapeptide repeat; 85.58
PLN02454414 triacylglycerol lipase 85.46
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 85.37
KOG2624|consensus403 85.33
PF06057192 VirJ: Bacterial virulence protein (VirJ); InterPro 84.76
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 84.66
KOG2182|consensus 514 84.38
PLN02733440 phosphatidylcholine-sterol O-acyltransferase 83.23
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 82.61
PF02450389 LCAT: Lecithin:cholesterol acyltransferase; InterP 80.64
PLN02324415 triacylglycerol lipase 80.3
PLN02571413 triacylglycerol lipase 80.21
>PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases Back     alignment and domain information 
Probab=100.00  E-value=3.1e-54  Score=442.70  Aligned_cols=361  Identities=29%  Similarity=0.442  Sum_probs=247.0

Q ss_pred             CcEEEccCCCCCCCccccccccCCCCcc-ccceeEe----------cc-----------cCCCCc---eeecCCCCCC--
Q psy6011          10 TKIVVVPNSKYGAEKHQLCREMNPGPLV-WCASWVV----------GY-----------SLEHGG---RLEGSRGVDA--   62 (388)
Q Consensus        10 ~~~~~~~~~~yg~~~~~~~~~~~p~~~~-~~~~~~~----------~~-----------~~~~~~---~~~~p~~~~~--   62 (388)
                      .++..+.+++|+.+|...+|+..|.+.. |......          ..           +..+++   -++.|.....  
T Consensus        44 ~~v~~f~gIpYA~pP~g~~Rf~~p~~~~~~~~~~~a~~~~~~C~Q~~~~~~~~~~~~~~~~sEDCL~LnI~~P~~~~~~~  123 (535)
T PF00135_consen   44 KGVYSFLGIPYAQPPVGELRFRPPQPPPPWSGVRDATKYGPACPQPPPPGPSPGFNPPVGQSEDCLYLNIYTPSNASSNS  123 (535)
T ss_dssp             CEEEEEEEEESSE---GGGTTS--EB--S-SSEEETBS---BESCECTTSSHHHCSHSSHBES---EEEEEEETSSSSTT
T ss_pred             cceEEEeCcccCCCCCCCcccccccccccchhhhhhhhcccccccccccccccccccccCCCchHHHHhhhhcccccccc
Confidence            5799999999999999999999998754 5544321          11           012232   4477876543  


Q ss_pred             CceEEEEEeCCCCCCCCC--CCCCcHHHHhcCCeEEEEecccccccccccCCCCCCCCCCchhHHHHHHHHHHHHhHHhc
Q psy6011          63 PYAVIVFIHGESYEWNAG--NHYDGSVLASSGHIIFVSINYRLGILGFLKTQTGHTQSGNWAVSDVIAALEWIKINIASF  140 (388)
Q Consensus        63 ~~Pv~v~ihGGg~~~g~~--~~~~~~~la~~~~~vvv~~~YRl~~~g~~~~~~~~~~~~n~~l~D~~~al~wv~~~i~~f  140 (388)
                      ++|||||||||||..|++  ..+++..++..+++|||++|||||++||+..++.....+|+||.||++||+||++||++|
T Consensus       124 ~lPV~v~ihGG~f~~G~~~~~~~~~~~~~~~~~vivVt~nYRlg~~Gfl~~~~~~~~~gN~Gl~Dq~~AL~WV~~nI~~F  203 (535)
T PF00135_consen  124 KLPVMVWIHGGGFMFGSGSFPPYDGASLAASKDVIVVTINYRLGAFGFLSLGDLDAPSGNYGLLDQRLALKWVQDNIAAF  203 (535)
T ss_dssp             SEEEEEEE--STTTSSCTTSGGGHTHHHHHHHTSEEEEE----HHHHH-BSSSTTSHBSTHHHHHHHHHHHHHHHHGGGG
T ss_pred             ccceEEEeecccccCCCcccccccccccccCCCEEEEEecccccccccccccccccCchhhhhhhhHHHHHHHHhhhhhc
Confidence            599999999999999999  467777777777899999999999999998865433359999999999999999999999


Q ss_pred             CCCCCCcEEeecCCcchhHHHHhhccccccccceeeeccCCcCCCCCCCCChhhHHHHHHHhhCCCCcc--chHHHHhcC
Q psy6011         141 GGDPTRITLFGHDTGAALVNIVLLTPSVKGLFHRVTLLSGSILSPWSFVHDPDSIRSNVADQLGCTLSD--NLAPCLRTH  218 (388)
Q Consensus       141 ggdp~~i~l~G~SaG~~~~~~~~~~~~~~~l~~~~i~~Sg~~~~~~~~~~~~~~~~~~~a~~lgC~~~~--~~l~CLR~~  218 (388)
                      ||||+||||+||||||.++.+|++++..++||+|||+|||++++++..........+++++.+||....  ++++|||++
T Consensus       204 GGDp~~VTl~G~SAGa~sv~~~l~sp~~~~LF~raI~~SGs~~~~~~~~~~~~~~~~~la~~lgc~~~~~~~~l~cLR~~  283 (535)
T PF00135_consen  204 GGDPDNVTLFGQSAGAASVSLLLLSPSSKGLFHRAILQSGSALSPWATSENPEQQAQKLAKALGCDDSDSSDILECLRSL  283 (535)
T ss_dssp             TEEEEEEEEEEETHHHHHHHHHHHGGGGTTSBSEEEEES--TTSTTSSBSHHHHHHHHHHHHTTSTTSSHHHHHHHHHHS
T ss_pred             ccCCcceeeeeecccccccceeeeccccccccccccccccccccccccccccchhhhhhhhhhccccccccchhhhhhhh
Confidence            999999999999999999999999999999999999999999988887666667789999999998754  789999999


Q ss_pred             CHHHHHhhccCC------Cc-ccccc-ccccCCChHHHHHHcCCCCCCccEEEeecCCccccccccchhccC--CCH---
Q psy6011         219 TLASLLQVNLTP------PR-FLAGF-GPHLFTDPNVALEKAGDNFVTTPLMAGVVTTESYLNFNANDIQYG--FEE---  285 (388)
Q Consensus       219 ~~~~L~~a~~~~------~~-f~p~~-gp~l~~~P~~~l~~~~~~f~~vPlliG~~~~Eg~~~~~~~~i~~g--~~~---  285 (388)
                      |+++|+++....      .. |.|++ |.+++++|..+++.  +++.+||+|+|+|++||..+.........  ..+   
T Consensus       284 ~~~~L~~a~~~~~~~~~~~~~f~PvvDg~~lp~~p~~~~~~--g~~~~vP~liG~t~~Eg~~~~~~~~~~~~~~~~~~~~  361 (535)
T PF00135_consen  284 PAEELLAAQNKLWPESGFFPPFGPVVDGDFLPDSPSELLKS--GRFNKVPLLIGSTSDEGSLFAPPSFSNNSESFSEILN  361 (535)
T ss_dssp             -HHHHHHHHHCCSTTSSSSSSSSBBEBSSSSSS-HHHHHHT--TTSTTSEEEEEEETBTTHHHHGTGSTTTSHSTSHHHH
T ss_pred             hccchhhhhhcccccccccccCCceecccccccCccccccc--cccceeeeecccccccchhhhccccccccccccccch
Confidence            999999875421      12 56765 67889999887764  46899999999999999864322111100  011   


Q ss_pred             ----HHHHhHhhcChhHHHHHHHHhhcccccccccCCCCCCCchHHHHHHHHHhccchhHHhH-HHHHHHHHhhcCccee
Q psy6011         286 ----DQRNRVLRLTDDQRVQYLLSKLSGSALTVCSGIPPIGSNYQTIWNLLVDRYEDKRALAS-SYIDQIIKTYVRNAYV  360 (388)
Q Consensus       286 ----~~~~~il~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~y~d~~~~a~-~~~~~~~~~~~~~~Y~  360 (388)
                          +....++....... . ....    ....|+..... .+... ...+.+.++|..+.++ ..+....++...++|.
T Consensus       362 ~~~~~~~~~~l~~~~~~~-~-~~~~----i~~~Y~~~~~~-~~~~~-~~~~~~~~sD~~f~~p~~~~~~~~~~~~~~vY~  433 (535)
T PF00135_consen  362 EDFEDLLPSLLPYYSSDS-R-IADA----IKEFYPDDPDP-NDSDS-RDRLAQLLSDIFFTCPARRAANHLASGGSPVYL  433 (535)
T ss_dssp             HHHHHHHHHHHTTCHHHH-H-HHHH----HHHHHSSTTST-THHHH-HHHHHHHHHHHHTHHHHHHHHHHHHHTTSCEEE
T ss_pred             hhHHHHHhhhhccccccc-c-cchh----hhccccccccc-cchhh-hHHHhhccCcceeeeccccccccccccccccce
Confidence                11112222111111 0 1111    11122222111 22232 3778899999999996 5666777888899999


Q ss_pred             eechhhhhhhhhccccCCCC
Q psy6011         361 YHLNEIFSTIRNEYTDWDKN  380 (388)
Q Consensus       361 Y~f~~~~~~~~~~yt~w~~~  380 (388)
                      |+|+..-.........|.++
T Consensus       434 Y~F~~~~~~~~~~~~~~~ga  453 (535)
T PF00135_consen  434 YRFDYPPPFIFSPDPPWRGA  453 (535)
T ss_dssp             EEEHHSSTTSTECSETTGTS
T ss_pred             eecccccccccccccccccc
Confidence            99998433333345555543

Among the different types are those which act on carboxylic esters (3.1.1 from EC). Carboxyl-esterases have been classified into three categories (A, B and C) on the basis of differential patterns of inhibition by organophosphates. The sequence of a number of type-B carboxylesterases indicates [, , ] that the majority are evolutionary related. As is the case for lipases and serine proteases, the catalytic apparatus of esterases involves three residues (catalytic triad): a serine, a glutamate or aspartate and a histidine.; PDB: 3B3Q_A 1CLE_B 1GQS_A 2VJD_A 1HBJ_A 2C5G_A 1U65_A 2WG1_A 1FSS_A 3M3D_A ....
>KOG4389|consensus Back     alignment and domain information
>COG2272 PnbA Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>KOG1516|consensus Back     alignment and domain information
>KOG1515|consensus Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>KOG4627|consensus Back     alignment and domain information
>KOG4388|consensus Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>KOG2281|consensus Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>KOG2100|consensus Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>KOG1552|consensus Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>KOG2564|consensus Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>KOG1455|consensus Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>KOG4391|consensus Back     alignment and domain information
>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>KOG3847|consensus Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>KOG1838|consensus Back     alignment and domain information
>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>COG4188 Predicted dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>KOG2237|consensus Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>KOG3101|consensus Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>COG2382 Fes Enterochelin esterase and related enzymes [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>KOG4409|consensus Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>KOG4178|consensus Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>COG0627 Predicted esterase [General function prediction only] Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>KOG2382|consensus Back     alignment and domain information
>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PF03283 PAE: Pectinacetylesterase Back     alignment and domain information
>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function Back     alignment and domain information
>COG2936 Predicted acyl esterases [General function prediction only] Back     alignment and domain information
>KOG4840|consensus Back     alignment and domain information
>COG3150 Predicted esterase [General function prediction only] Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>COG1505 Serine proteases of the peptidase family S9A [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3975|consensus Back     alignment and domain information
>PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants Back     alignment and domain information
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3967|consensus Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function Back     alignment and domain information
>KOG2112|consensus Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PRK04940 hypothetical protein; Provisional Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG2183|consensus Back     alignment and domain information
>PLN02408 phospholipase A1 Back     alignment and domain information
>COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family Back     alignment and domain information
>PF11339 DUF3141: Protein of unknown function (DUF3141); InterPro: IPR024501 This family of proteins appears to be predominantly expressed in Proteobacteria Back     alignment and domain information
>KOG1454|consensus Back     alignment and domain information
>KOG4667|consensus Back     alignment and domain information
>PF03991 Prion_octapep: Copper binding octapeptide repeat; InterPro: IPR020949 Prion protein (PrP-c) [, , ] is a small glycoprotein found in high quantity in the brain of animals infected with certain degenerative neurological diseases, such as sheep scrapie and bovine spongiform encephalopathy (BSE), and the human dementias Creutzfeldt-Jacob disease (CJD) and Gerstmann-Straussler syndrome (GSS) Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>KOG2624|consensus Back     alignment and domain information
>PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>KOG2182|consensus Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>PLN02324 triacylglycerol lipase Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query388
3be8_A 588 Crystal Structure Of The Synaptic Protein Neuroligi 8e-38
3vkf_A 585 Crystal Structure Of Neurexin 1betaNEUROLIGIN 1 COM 4e-37
3b3q_A 577 Crystal Structure Of A Synaptic Adhesion Complex Le 5e-37
3biw_A 574 Crystal Structure Of The Neuroligin-1NEUREXIN-1beta 1e-36
3bl8_A 580 Crystal Structure Of The Extracellular Domain Of Ne 2e-33
1k4y_A534 Crystal Structure Of Rabbit Liver Carboxylesterase 5e-28
1jmy_A522 Truncated Recombinant Human Bile Salt Stimulated Li 2e-26
1f6w_A 533 Structure Of The Catalytic Domain Of Human Bile Sal 2e-26
1f8u_A 583 Crystal Structure Of Mutant E202q Of Human Acetylch 4e-26
2x8b_A 583 Crystal Structure Of Human Acetylcholinesterase Inh 5e-26
3lii_A540 Recombinant Human Acetylcholinesterase Length = 540 6e-26
1b41_A539 Human Acetylcholinesterase Complexed With Fasciculi 6e-26
4ey4_A542 Crystal Structure Of Recombinant Human Acetylcholin 7e-26
2bce_A 579 Cholesterol Esterase From Bos Taurus Length = 579 4e-25
1aql_A 532 Crystal Structure Of Bovine Bile-Salt Activated Lip 6e-25
1akn_A 579 Structure Of Bile-salt Activated Lipase Length = 57 6e-25
3k9b_A529 Crystal Structure Of Human Liver Carboxylesterase 1 7e-24
1mx1_A 548 Crystal Structure Of Human Liver Carboxylesterase I 8e-24
2dqy_A 542 Crystal Structure Of Human Carboxylesterase In Comp 8e-24
1ya4_A532 Crystal Structure Of Human Liver Carboxylesterase 1 9e-24
2wsl_A529 Aged Form Of Human Butyrylcholinesterase Inhibited 1e-23
1p0i_A529 Crystal Structure Of Human Butyryl Cholinesterase L 1e-23
2wil_A529 Aged Form Of Human Butyrylcholinesterase Inhibited 1e-23
2pm8_A 574 Crystal Structure Of Recombinant Full Length Human 1e-23
3o9m_A 574 Co-Crystallization Studies Of Full Length Recombina 1e-23
2xqf_A527 X-Ray Structure Of Human Butyrylcholinesterase Inhi 1e-23
2wif_A529 Aged Form Of Human Butyrylcholinesterase Inhibited 1e-23
2j4c_A529 Structure Of Human Butyrylcholinesterase In Complex 1e-23
2wid_A529 Nonaged Form Of Human Butyrylcholinesterase Inhibit 1e-23
4aqd_A531 Crystal Structure Of Fully Glycosylated Human Butyr 1e-23
4b0o_A529 Crystal Structure Of Soman-Aged Human Butyrylcholin 1e-23
3djy_A529 Nonaged Form Of Human Butyrylcholinesterase Inhibit 1e-23
2y1k_A529 Structure Of Human Butyrylcholinesterase Inhibited 1e-23
2xmb_A529 G117h Mutant Of Human Butyrylcholinesterase In Comp 1e-23
4axb_A527 Crystal Structure Of Soman-aged Human Butyrylcholin 1e-23
2ogt_A498 Crystal Structure Of The Geobacillus Stearothermoph 2e-23
2ogs_A498 Crystal Structure Of The Geobacillus Stearothermoph 2e-23
1qe3_A489 Pnb Esterase Length = 489 2e-22
1c7i_A489 Thermophylic Pnb Esterase Length = 489 2e-22
3dl7_A538 Aged Form Of Mouse Acetylcholinesterase Inhibited B 2e-22
2xud_A543 Crystal Structure Of The Y337a Mutant Of Mouse Acet 3e-22
2xuf_A544 Crystal Structure Of Mache-Y337a-Tz2pa6 Anti Comple 3e-22
1mah_A543 Fasciculin2-Mouse Acetylcholinesterase Complex Leng 4e-22
1maa_A547 Mouse Acetylcholinesterase Catalytic Domain, Glycos 4e-22
1ku6_A549 Fasciculin 2-Mouse Acetylcholinesterase Complex Len 4e-22
1n5m_A541 Crystal Structure Of The Mouse Acetylcholinesterase 4e-22
2c0p_A 548 Aged Form Of Mouse Acetylcholinesterase Inhibited B 4e-22
1c2o_A539 Electrophorus Electricus Acetylcholinesterase Lengt 4e-22
1c2b_A540 Electrophorus Electricus Acetylcholinesterase Lengt 4e-22
1q83_A 580 Crystal Structure Of The Mouse Acetylcholinesterase 4e-22
4a16_A 545 Structure Of Mouse Acetylcholinesterase Complex Wit 5e-22
1c7j_A489 Pnb Esterase 56c8 Length = 489 5e-22
2whp_B 548 Crystal Structure Of Acetylcholinesterase, Phosphon 5e-22
2jgf_A 548 Crystal Structure Of Mouse Acetylcholinesterase Inh 5e-22
2ha4_A543 Crystal Structure Of Mutant S203a Of Mouse Acetylch 5e-22
2jgj_A536 Crystal Structure Of Mouse Acetylcholinesterase Inh 9e-22
2jge_B533 Crystal Structure Of Mouse Acetylcholinesterase Inh 1e-21
2jgj_B535 Crystal Structure Of Mouse Acetylcholinesterase Inh 1e-21
3dl7_B534 Aged Form Of Mouse Acetylcholinesterase Inhibited B 1e-21
1som_A543 Torpedo Californica Acetylcholinesterase Inhibited 6e-21
1fss_A537 Acetylcholinesterase (E.C. 3.1.1.7) Complexed With 6e-21
3i6m_A534 3d Structure Of Torpedo Californica Acetylcholinest 6e-21
2cek_A535 Conformational Flexibility In The Peripheral Site O 6e-21
1gqr_A532 Acetylcholinesterase (E.C. 3.1.1.7) Complexed With 6e-21
1ut6_A537 Structure Of Acetylcholinesterase (E.C. 3.1.1.7) Co 6e-21
2w6c_X 586 Ache In Complex With A Bis-(-)-Nor-Meptazinol Deriv 6e-21
1eea_A534 Acetylcholinesterase Length = 534 7e-21
2c58_A537 Torpedo Californica Acetylcholinesterase In Complex 7e-21
2dfp_A534 X-Ray Structure Of Aged Di-Isopropyl-Phosphoro-Fluo 8e-21
3gel_A532 O-Methylphosphorylated Torpedo Acetylcholinesterase 8e-21
1thg_A544 1.8 Angstroms Refined Structure Of The Lipase From 6e-17
1dx4_A 585 Ache From Drosophila Melanogaster Complex With Tacr 1e-16
2fj0_A 551 Crystal Structure Of Juvenile Hormone Esterase From 2e-15
1ukc_A522 Crystal Structure Of Aspergillus Niger Esta Length 8e-13
1gz7_A534 Crystal Structure Of The Closed State Of Lipase 2 F 5e-12
1cle_A534 Structure Of Uncomplexed And Linoleate-Bound Candid 2e-11
1llf_A534 Cholesterol Esterase (Candida Cylindracea) Crystal 2e-11
1crl_A534 Insights Into Interfacial Activation From An 'open' 3e-11
1lpm_A549 A Structural Basis For The Chiral Preferences Of Li 4e-11
2hm7_A310 Crystal Structure Analysis Of The G84s Est2 Mutant 3e-07
1qz3_A310 Crystal Structure Of Mutant M211sR215L OF CARBOXYLE 2e-06
1evq_A310 The Crystal Structure Of The Thermophilic Carboxyle 5e-06
>pdb|3BE8|A Chain A, Crystal Structure Of The Synaptic Protein Neuroligin 4 Length = 588 Back     alignment and structure 
Iteration: 1

 Score =  154 bits (389), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 82/207 (39%), Positives = 122/207 (58%), Gaps = 10/207 (4%)
Query: 66  VIVFIHGESYEWNAGNHYDGSVLASSGHIIFVSINYRLGILGFLKTQTGHTQSGNWAVSD 125
           V+V+IHG SY    GN  DGS+LAS G++I ++INYRLGILGFL T       GN+ + D
Sbjct: 137 VMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGFLST-GDQAAKGNYGLLD 195
Query: 126 VIAALEWIKINIASFGGDPTRITLFGHDTGAALVNIVLLTPSVKGLFHRVTLLSGSILSP 185
            I AL WI+ N+ +FGGDP R+T+FG   GA+ V+++ L+   +GLF +  + SG+ LS 
Sbjct: 196 QIQALRWIEENVGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSS 255
Query: 186 WSFVHDPDSIRSNVADQLGCTLSD--NLAPCLRTHTLASLLQVNLTPPRFLAGFGP---- 239
           W+  + P      +AD++GC + D  ++  CLR      L+Q  +TP  +   FGP    
Sbjct: 256 WAVNYQPAKYTRILADKVGCNMLDTTDMVECLRNKNYKELIQQTITPATYHIAFGPVIDG 315
Query: 240 -HLFTDPNVALEKAGDNFVTTPLMAGV 265
             +  DP + +E+    F+   +M GV
Sbjct: 316 DVIPDDPQILMEQG--EFLNYDIMLGV 340
>pdb|3VKF|A Chain A, Crystal Structure Of Neurexin 1betaNEUROLIGIN 1 COMPLEX Length = 585 Back     alignment and structure
>pdb|3B3Q|A Chain A, Crystal Structure Of A Synaptic Adhesion Complex Length = 577 Back     alignment and structure
>pdb|3BIW|A Chain A, Crystal Structure Of The Neuroligin-1NEUREXIN-1beta Synaptic Adhesion Complex Length = 574 Back     alignment and structure
>pdb|3BL8|A Chain A, Crystal Structure Of The Extracellular Domain Of Neuroligin 2a From Mouse Length = 580 Back     alignment and structure
>pdb|1K4Y|A Chain A, Crystal Structure Of Rabbit Liver Carboxylesterase In Complex With 4- Piperidino-Piperidine Length = 534 Back     alignment and structure
>pdb|1JMY|A Chain A, Truncated Recombinant Human Bile Salt Stimulated Lipase Length = 522 Back     alignment and structure
>pdb|1F6W|A Chain A, Structure Of The Catalytic Domain Of Human Bile Salt Activated Lipase Length = 533 Back     alignment and structure
>pdb|1F8U|A Chain A, Crystal Structure Of Mutant E202q Of Human Acetylcholinesterase Complexed With Green Mamba Venom Peptide Fasciculin-ii Length = 583 Back     alignment and structure
>pdb|2X8B|A Chain A, Crystal Structure Of Human Acetylcholinesterase Inhibited By Aged Tabun And Complexed With Fasciculin-Ii Length = 583 Back     alignment and structure
>pdb|3LII|A Chain A, Recombinant Human Acetylcholinesterase Length = 540 Back     alignment and structure
>pdb|1B41|A Chain A, Human Acetylcholinesterase Complexed With Fasciculin-Ii, Glycosylated Protein Length = 539 Back     alignment and structure
>pdb|4EY4|A Chain A, Crystal Structure Of Recombinant Human Acetylcholinesterase In The Apo State Length = 542 Back     alignment and structure
>pdb|2BCE|A Chain A, Cholesterol Esterase From Bos Taurus Length = 579 Back     alignment and structure
>pdb|1AQL|A Chain A, Crystal Structure Of Bovine Bile-Salt Activated Lipase Complexed With Taurocholate Length = 532 Back     alignment and structure
>pdb|1AKN|A Chain A, Structure Of Bile-salt Activated Lipase Length = 579 Back     alignment and structure
>pdb|3K9B|A Chain A, Crystal Structure Of Human Liver Carboxylesterase 1 (Hce1) In Covalent Complex With The Nerve Agent Cyclosarin (Gf) Length = 529 Back     alignment and structure
>pdb|1MX1|A Chain A, Crystal Structure Of Human Liver Carboxylesterase In Complex With Tacrine Length = 548 Back     alignment and structure
>pdb|2DQY|A Chain A, Crystal Structure Of Human Carboxylesterase In Complex With Cholate And Palmitate Length = 542 Back     alignment and structure
>pdb|1YA4|A Chain A, Crystal Structure Of Human Liver Carboxylesterase 1 In Complex With Tamoxifen Length = 532 Back     alignment and structure
>pdb|2WSL|A Chain A, Aged Form Of Human Butyrylcholinesterase Inhibited By Tabun Analogue Ta4 Length = 529 Back     alignment and structure
>pdb|1P0I|A Chain A, Crystal Structure Of Human Butyryl Cholinesterase Length = 529 Back     alignment and structure
>pdb|2WIL|A Chain A, Aged Form Of Human Butyrylcholinesterase Inhibited By Tabun Analogue Ta5 Length = 529 Back     alignment and structure
>pdb|2PM8|A Chain A, Crystal Structure Of Recombinant Full Length Human Butyrylcholinesterase Length = 574 Back     alignment and structure
>pdb|3O9M|A Chain A, Co-Crystallization Studies Of Full Length Recombinant Bche With Cocaine Offers Insights Into Cocaine Detoxification Length = 574 Back     alignment and structure
>pdb|2XQF|A Chain A, X-Ray Structure Of Human Butyrylcholinesterase Inhibited By Racemic Vx Length = 527 Back     alignment and structure
>pdb|2WIF|A Chain A, Aged Form Of Human Butyrylcholinesterase Inhibited By Tabun Analogue Ta1 Length = 529 Back     alignment and structure
>pdb|2J4C|A Chain A, Structure Of Human Butyrylcholinesterase In Complex With 10mm Hgcl2 Length = 529 Back     alignment and structure
>pdb|2WID|A Chain A, Nonaged Form Of Human Butyrylcholinesterase Inhibited By Tabun Analogue Ta1 Length = 529 Back     alignment and structure
>pdb|4AQD|A Chain A, Crystal Structure Of Fully Glycosylated Human Butyrylcholinesterase Length = 531 Back     alignment and structure
>pdb|4B0O|A Chain A, Crystal Structure Of Soman-Aged Human Butyrylcholinesterase In Complex With Benzyl Pyridinium-4-Methyltrichloroacetimidate Length = 529 Back     alignment and structure
>pdb|3DJY|A Chain A, Nonaged Form Of Human Butyrylcholinesterase Inhibited By Tabun Length = 529 Back     alignment and structure
>pdb|2Y1K|A Chain A, Structure Of Human Butyrylcholinesterase Inhibited By Cbdp ( 12h Soak): Phosphoserine Adduct Length = 529 Back     alignment and structure
>pdb|2XMB|A Chain A, G117h Mutant Of Human Butyrylcholinesterase In Complex With Sulfate Length = 529 Back     alignment and structure
>pdb|4AXB|A Chain A, Crystal Structure Of Soman-aged Human Butyrylcholinesterase In Complex With 2-pam Length = 527 Back     alignment and structure
>pdb|2OGT|A Chain A, Crystal Structure Of The Geobacillus Stearothermophilus Carboxylesterase Est55 At Ph 6.8 Length = 498 Back     alignment and structure
>pdb|2OGS|A Chain A, Crystal Structure Of The Geobacillus Stearothermophilus Carboxylesterase Est55 At Ph 6.2 Length = 498 Back     alignment and structure
>pdb|1QE3|A Chain A, Pnb Esterase Length = 489 Back     alignment and structure
>pdb|1C7I|A Chain A, Thermophylic Pnb Esterase Length = 489 Back     alignment and structure
>pdb|2XUD|A Chain A, Crystal Structure Of The Y337a Mutant Of Mouse Acetylcholinesterase Length = 543 Back     alignment and structure
>pdb|2XUF|A Chain A, Crystal Structure Of Mache-Y337a-Tz2pa6 Anti Complex (1 Mth) Length = 544 Back     alignment and structure
>pdb|1MAH|A Chain A, Fasciculin2-Mouse Acetylcholinesterase Complex Length = 543 Back     alignment and structure
>pdb|1MAA|A Chain A, Mouse Acetylcholinesterase Catalytic Domain, Glycosylated Protein Length = 547 Back     alignment and structure
>pdb|1KU6|A Chain A, Fasciculin 2-Mouse Acetylcholinesterase Complex Length = 549 Back     alignment and structure
>pdb|1N5M|A Chain A, Crystal Structure Of The Mouse Acetylcholinesterase-Gallamine Complex Length = 541 Back     alignment and structure
>pdb|2C0P|A Chain A, Aged Form Of Mouse Acetylcholinesterase Inhibited By Tabun Length = 548 Back     alignment and structure
>pdb|1C2O|A Chain A, Electrophorus Electricus Acetylcholinesterase Length = 539 Back     alignment and structure
>pdb|1C2B|A Chain A, Electrophorus Electricus Acetylcholinesterase Length = 540 Back     alignment and structure
>pdb|1Q83|A Chain A, Crystal Structure Of The Mouse Acetylcholinesterase-Tz2pa6 Syn Complex Length = 580 Back     alignment and structure
>pdb|4A16|A Chain A, Structure Of Mouse Acetylcholinesterase Complex With Huprine Derivative Length = 545 Back     alignment and structure
>pdb|1C7J|A Chain A, Pnb Esterase 56c8 Length = 489 Back     alignment and structure
>pdb|2WHP|B Chain B, Crystal Structure Of Acetylcholinesterase, Phosphonylated By Sarin And In Complex With Hi-6 Length = 548 Back     alignment and structure
>pdb|2JGF|A Chain A, Crystal Structure Of Mouse Acetylcholinesterase Inhibited By Non-Aged Fenamiphos Length = 548 Back     alignment and structure
>pdb|2HA4|A Chain A, Crystal Structure Of Mutant S203a Of Mouse Acetylcholinesterase Complexed With Acetylcholine Length = 543 Back     alignment and structure
>pdb|1SOM|A Chain A, Torpedo Californica Acetylcholinesterase Inhibited By Nerve Agent Gd (Soman). Length = 543 Back     alignment and structure
>pdb|1FSS|A Chain A, Acetylcholinesterase (E.C. 3.1.1.7) Complexed With Fasciculin-Ii Length = 537 Back     alignment and structure
>pdb|3I6M|A Chain A, 3d Structure Of Torpedo Californica Acetylcholinesterase Complexed With N-Piperidinopropyl-Galanthamine Length = 534 Back     alignment and structure
>pdb|2CEK|A Chain A, Conformational Flexibility In The Peripheral Site Of Torpedo Californica Acetylcholinesterase Revealed By The Complex Structure With A Bifunctional Inhibitor Length = 535 Back     alignment and structure
>pdb|1GQR|A Chain A, Acetylcholinesterase (E.C. 3.1.1.7) Complexed With Rivastigmine Length = 532 Back     alignment and structure
>pdb|1UT6|A Chain A, Structure Of Acetylcholinesterase (E.C. 3.1.1.7) Complexed With N-9-(1',2',3',4'-Tetrahydroacridinyl)-1,8- Diaminooctane At 2.4 Angstroms Resolution. Length = 537 Back     alignment and structure
>pdb|2W6C|X Chain X, Ache In Complex With A Bis-(-)-Nor-Meptazinol Derivative Length = 586 Back     alignment and structure
>pdb|1EEA|A Chain A, Acetylcholinesterase Length = 534 Back     alignment and structure
>pdb|2C58|A Chain A, Torpedo Californica Acetylcholinesterase In Complex With 20mm Acetylthiocholine Length = 537 Back     alignment and structure
>pdb|2DFP|A Chain A, X-Ray Structure Of Aged Di-Isopropyl-Phosphoro-Fluoridate (Dfp) Bound To Acetylcholinesterase Length = 534 Back     alignment and structure
>pdb|3GEL|A Chain A, O-Methylphosphorylated Torpedo Acetylcholinesterase Obtained By Reaction With Methyl Paraoxon (Aged) Length = 532 Back     alignment and structure
>pdb|1THG|A Chain A, 1.8 Angstroms Refined Structure Of The Lipase From Geotrichum Candidum Length = 544 Back     alignment and structure
>pdb|1DX4|A Chain A, Ache From Drosophila Melanogaster Complex With Tacrine Derivative 9-(3-Phenylmethylamino)-1,2,3,4-Tetrahydroacridine Length = 585 Back     alignment and structure
>pdb|2FJ0|A Chain A, Crystal Structure Of Juvenile Hormone Esterase From Manduca Sexta, With Otfp Covalently Attached Length = 551 Back     alignment and structure
>pdb|1UKC|A Chain A, Crystal Structure Of Aspergillus Niger Esta Length = 522 Back     alignment and structure
>pdb|1GZ7|A Chain A, Crystal Structure Of The Closed State Of Lipase 2 From Candida Rugosa Length = 534 Back     alignment and structure
>pdb|1CLE|A Chain A, Structure Of Uncomplexed And Linoleate-Bound Candida Cylindracea Cholesterol Esterase Length = 534 Back     alignment and structure
>pdb|1LLF|A Chain A, Cholesterol Esterase (Candida Cylindracea) Crystal Structure At 1.4a Resolution Length = 534 Back     alignment and structure
>pdb|1CRL|A Chain A, Insights Into Interfacial Activation From An 'open' Structure Of Candida Rugosa Lipase Length = 534 Back     alignment and structure
>pdb|1LPM|A Chain A, A Structural Basis For The Chiral Preferences Of Lipases Length = 549 Back     alignment and structure
>pdb|2HM7|A Chain A, Crystal Structure Analysis Of The G84s Est2 Mutant Length = 310 Back     alignment and structure
>pdb|1QZ3|A Chain A, Crystal Structure Of Mutant M211sR215L OF CARBOXYLESTERASE Est2 Complexed With Hexadecanesulfonate Length = 310 Back     alignment and structure
>pdb|1EVQ|A Chain A, The Crystal Structure Of The Thermophilic Carboxylesterase Est2 From Alicyclobacillus Acidocaldarius Length = 310 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query388
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 4e-72
1dx4_A585 ACHE, acetylcholinesterase; hydrolase, serine este 1e-66
1ea5_A537 ACHE, acetylcholinesterase; hydrolase, serine hydr 4e-66
2h7c_A542 Liver carboxylesterase 1; enzyme, cholesteryl este 9e-65
2ha2_A543 ACHE, acetylcholinesterase; hydrolase fold, serine 7e-64
1p0i_A529 Cholinesterase; serine hydrolase, butyrate, hydrol 4e-63
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 3e-60
2ogt_A498 Thermostable carboxylesterase EST50; alpha/beta hy 3e-55
1qe3_A489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 5e-54
2fj0_A551 JuvenIle hormone esterase; manduca sexta, alpha-be 3e-53
1ukc_A522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 4e-49
1llf_A534 Lipase 3; candida cylindracea cholesterol esterase 5e-47
1thg_A544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 2e-46
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 1e-11
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 7e-11
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 2e-08
1vkh_A273 Putative serine hydrolase; structural genomics, jo 6e-08
3bjr_A283 Putative carboxylesterase; structural genomics, jo 2e-07
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 3e-07
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 4e-07
3h04_A275 Uncharacterized protein; protein with unknown func 5e-07
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 8e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 2e-06
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 3e-06
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 3e-06
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 4e-06
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 5e-06
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 7e-06
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 9e-06
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 4e-05
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 5e-05
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 2e-04
3ain_A323 303AA long hypothetical esterase; carboxylesterase 2e-04
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 3e-04
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 8e-04
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Length = 574 Back     alignment and structure
 Score =  235 bits (600), Expect = 4e-72
 Identities = 91/247 (36%), Positives = 126/247 (51%), Gaps = 10/247 (4%)

Query: 55  EGSRGVDAPYAVIVFIHGESYEWNAGNHYDGSVLASSGHIIFVSINYRLGILGFLKTQTG 114
           +  R    P  V+V+IHG SY    GN YDGSVLAS G++I +++NYRLG+LGFL T   
Sbjct: 122 DDIRDSGGPKPVMVYIHGGSYMEGTGNLYDGSVLASYGNVIVITVNYRLGVLGFLSTGDQ 181

Query: 115 HTQSGNWAVSDVIAALEWIKINIASFGGDPTRITLFGHDTGAALVNIVLLTP-SVKGLFH 173
               GN+ + D+I AL W   NI  FGGDP RIT+FG   G + VN++ L+  S KGLF 
Sbjct: 182 AA-KGNYGLLDLIQALRWTSENIGFFGGDPLRITVFGSGAGGSCVNLLTLSHYSEKGLFQ 240

Query: 174 RVTLLSGSILSPWSFVHDPDSIRSNVADQLGCTLSD--NLAPCLRTHTLASLLQVNLTPP 231
           R    SG+ LS W+    P      +A ++GC +SD   L  CL+      L+  ++ P 
Sbjct: 241 RAIAQSGTALSSWAVSFQPAKYARILATKVGCNVSDTVELVECLQKKPYKELVDQDVQPA 300

Query: 232 RFLAGFGP----HLFTDPNVALEKAGDNFVTTPLMAGVVTTESYLNF-NANDIQYGFEED 286
           R+   FGP     +  D    L + G+ F+   +M GV   E      N  D   G    
Sbjct: 301 RYHIAFGPVIDGDVIPDDPQILMEQGE-FLNYDIMLGVNQGEGLKFVENIVDSDDGVSAS 359

Query: 287 QRNRVLR 293
             +  + 
Sbjct: 360 DFDFAVS 366
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Length = 585 Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Length = 537 Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Length = 542 Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Length = 543 Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Length = 529 Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Length = 579 Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Length = 498 Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Length = 489 Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Length = 551 Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Length = 522 Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Length = 534 Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Length = 544 Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Length = 303 Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Length = 277 Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Length = 276 Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Length = 273 Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Length = 283 Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Length = 317 Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Length = 310 Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Length = 275 Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Length = 323 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Length = 262 Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Length = 311 Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Length = 290 Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Length = 274 Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Length = 326 Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Length = 311 Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Length = 223 Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Length = 361 Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Length = 337 Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Length = 323 Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Length = 346 Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Length = 365 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query388
1ea5_A537 ACHE, acetylcholinesterase; hydrolase, serine hydr 100.0
1p0i_A529 Cholinesterase; serine hydrolase, butyrate, hydrol 100.0
2ha2_A543 ACHE, acetylcholinesterase; hydrolase fold, serine 100.0
2h7c_A542 Liver carboxylesterase 1; enzyme, cholesteryl este 100.0
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 100.0
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 100.0
1dx4_A585 ACHE, acetylcholinesterase; hydrolase, serine este 100.0
2ogt_A498 Thermostable carboxylesterase EST50; alpha/beta hy 100.0
1ukc_A522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 100.0
1llf_A534 Lipase 3; candida cylindracea cholesterol esterase 100.0
2fj0_A551 JuvenIle hormone esterase; manduca sexta, alpha-be 100.0
1thg_A544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 100.0
1qe3_A489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 100.0
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 99.72
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 99.71
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 99.71
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 99.71
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 99.71
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 99.67
3ain_A323 303AA long hypothetical esterase; carboxylesterase 99.66
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 99.65
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 99.64
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 99.63
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 99.63
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 99.62
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 99.59
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 99.59
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 99.57
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 99.54
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 99.52
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 99.48
1vkh_A273 Putative serine hydrolase; structural genomics, jo 99.44
3bjr_A283 Putative carboxylesterase; structural genomics, jo 99.42
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 99.36
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 99.36
3h04_A275 Uncharacterized protein; protein with unknown func 99.28
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 99.12
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 99.11
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 99.06
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 99.02
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 99.02
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 98.99
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 98.98
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.98
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.97
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 98.95
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.94
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 98.94
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 98.94
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 98.92
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 98.89
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 98.88
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 98.88
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.87
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 98.84
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 98.83
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 98.82
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 98.81
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 98.81
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.81
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 98.8
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 98.8
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 98.8
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 98.79
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 98.79
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 98.78
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 98.78
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 98.77
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.76
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 98.76
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 98.76
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 98.75
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 98.74
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.74
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 98.7
3nuz_A398 Putative acetyl xylan esterase; structural genomic 98.69
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 98.69
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 98.68
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 98.68
3d59_A383 Platelet-activating factor acetylhydrolase; secret 98.68
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 98.67
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 98.66
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.66
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 98.64
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 98.63
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 98.62
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 98.62
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 98.58
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 98.57
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 98.53
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 98.52
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 98.52
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 98.5
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 98.5
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 98.47
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 98.43
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 98.43
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 98.42
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 98.42
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 98.4
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 98.4
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 98.4
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 98.38
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 98.36
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 98.33
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 98.33
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 98.32
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 98.29
3llc_A270 Putative hydrolase; structural genomics, joint cen 98.29
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 98.27
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 98.26
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 98.25
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 98.25
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 98.24
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 98.24
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 98.21
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 98.21
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 98.21
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 98.2
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 98.18
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 98.17
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 98.16
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 98.15
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 98.14
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 98.13
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 98.13
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 98.12
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 98.11
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 98.08
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 98.07
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 98.06
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 98.06
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 98.06
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 98.04
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 98.04
1rp1_A450 Pancreatic lipase related protein 1; hydrolase, li 98.04
1r3d_A264 Conserved hypothetical protein VC1974; structural 98.02
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 98.0
4f21_A246 Carboxylesterase/phospholipase family protein; str 97.99
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 97.98
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 97.97
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 97.96
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 97.95
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 97.94
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 97.94
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 97.94
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 97.94
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 97.92
1hpl_A449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 97.91
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 97.9
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 97.9
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 97.9
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 97.9
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 97.87
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 97.87
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 97.87
3pic_A375 CIP2; alpha/beta hydrolase fold, glucuronoyl ester 97.85
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 97.84
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 97.84
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 97.84
1bu8_A452 Protein (pancreatic lipase related protein 2); hyd 97.84
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 97.83
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 97.83
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 97.83
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 97.83
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 97.82
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 97.82
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 97.81
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 97.81
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 97.79
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 97.79
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 97.79
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 97.79
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 97.78
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 97.78
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 97.77
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 97.74
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 97.74
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 97.74
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 97.73
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 97.72
1w52_X452 Pancreatic lipase related protein 2; detergent, cl 97.72
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 97.71
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 97.71
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 97.71
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 97.71
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 97.7
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 97.7
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 97.7
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 97.7
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 97.69
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 97.67
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 97.67
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 97.65
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 97.64
4fle_A202 Esterase; structural genomics, PSI-biology, northe 97.62
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 97.62
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 97.61
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 97.61
1gpl_A432 RP2 lipase; serine esterase, hydrolase, lipid degr 97.59
3gff_A331 IROE-like serine hydrolase; NP_718593.1, structura 97.58
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 97.58
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 97.57
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 97.56
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 97.55
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 97.54
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 97.52
1iup_A282 META-cleavage product hydrolase; aromatic compound 97.52
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 97.52
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 97.49
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 97.49
4g4g_A433 4-O-methyl-glucuronoyl methylesterase; alpha/beta 97.48
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 96.62
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 97.47
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 97.45
3n2z_B446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 97.42
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 97.41
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 97.4
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 97.36
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 97.35
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 97.35
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 97.3
4fol_A299 FGH, S-formylglutathione hydrolase; D-type esteras 97.27
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 97.23
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 97.21
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 97.02
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 97.0
1kez_A300 Erythronolide synthase; polyketide synthase, modul 96.99
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 96.95
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 96.6
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 96.59
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 96.57
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 96.56
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 96.37
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 96.36
3lp5_A250 Putative cell surface hydrolase; structural genom 96.28
4ebb_A 472 Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2 96.19
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 96.15
2d81_A318 PHB depolymerase; alpha/beta hydrolase fold, circu 95.64
2dsn_A387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 95.51
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 95.43
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 95.41
3tej_A329 Enterobactin synthase component F; nonribosomal pe 94.98
2hih_A431 Lipase 46 kDa form; A1 phospholipase, phospholipid 94.9
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 94.07
2px6_A316 Thioesterase domain; thioesaterse domain, orlistat 94.01
1ivy_A452 Human protective protein; carboxypeptidase, serine 88.94
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 88.52
1cpy_A421 Serine carboxypeptidase; hydrolase (carboxypeptida 83.84
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 82.38
1ac5_A483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 82.1
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 81.15
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
Probab=100.00  E-value=2.2e-49  Score=405.29  Aligned_cols=348  Identities=24%  Similarity=0.379  Sum_probs=257.2

Q ss_pred             CcEEEccCCCCCCCccccccccCCCCcc-ccceeEec--------c------------------cCCCC---ceeecCCC
Q psy6011          10 TKIVVVPNSKYGAEKHQLCREMNPGPLV-WCASWVVG--------Y------------------SLEHG---GRLEGSRG   59 (388)
Q Consensus        10 ~~~~~~~~~~yg~~~~~~~~~~~p~~~~-~~~~~~~~--------~------------------~~~~~---~~~~~p~~   59 (388)
                      .++..+.+++|+.+|...+|+..|.|.. |.......        .                  ....+   ..++.|..
T Consensus        25 ~~v~~F~GIPYA~pPvG~lRF~~P~p~~~w~gv~dAt~~g~~C~Q~~~~~~~~~~~~~~~~~~~~~sedcl~lnv~~P~~  104 (537)
T 1ea5_A           25 SHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSGSEMWNPNREMSEDCLYLNIWVPSP  104 (537)
T ss_dssp             EEEEEEEEEECBCCCCGGGTTSCCCBCCCCSSEEECBSCCCBCCCCCCCSSTTCHHHHTTSCCSCBCSCCCEEEEEECSS
T ss_pred             ceEEEEcCCccCCCCCCCcCCCCCCCCCCCCCceecccCCCCCCCCCcccccccccccccCCCCCcCCcCCeEEEeccCC
Confidence            4688999999999999999999998754 55433210        0                  01122   24577776


Q ss_pred             CCCCceEEEEEeCCCCCCCCCCC--CCcHHHHhcCCeEEEEecccccccccccCCCCCCCCCCchhHHHHHHHHHHHHhH
Q psy6011          60 VDAPYAVIVFIHGESYEWNAGNH--YDGSVLASSGHIIFVSINYRLGILGFLKTQTGHTQSGNWAVSDVIAALEWIKINI  137 (388)
Q Consensus        60 ~~~~~Pv~v~ihGGg~~~g~~~~--~~~~~la~~~~~vvv~~~YRl~~~g~~~~~~~~~~~~n~~l~D~~~al~wv~~~i  137 (388)
                      ..+++|||||||||||..|+...  +++..|+.+.++|||++||||+++||+........++|+|+.||++||+||++||
T Consensus       105 ~~~~~Pv~v~iHGG~~~~g~~~~~~~~~~~la~~~~~vvv~~nYRlg~~Gf~~~~~~~~~~~n~gl~D~~~al~wv~~ni  184 (537)
T 1ea5_A          105 RPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHGSQEAPGNVGLLDQRMALQWVHDNI  184 (537)
T ss_dssp             CCSSEEEEEEECCSTTTCCCTTCGGGCTHHHHHHHTCEEEECCCCCHHHHHCCCTTCSSSCSCHHHHHHHHHHHHHHHHG
T ss_pred             CCCCCeEEEEECCCcccCCCCCCCccChHHHHhcCCEEEEEeccCccccccccCCCCCCCcCccccHHHHHHHHHHHHHH
Confidence            55789999999999999999875  7888998666699999999999999998744445789999999999999999999


Q ss_pred             HhcCCCCCCcEEeecCCcchhHHHHhhccccccccceeeeccCCcCCCCCCC--CChhhHHHHHHHhhCCCCc--cchHH
Q psy6011         138 ASFGGDPTRITLFGHDTGAALVNIVLLTPSVKGLFHRVTLLSGSILSPWSFV--HDPDSIRSNVADQLGCTLS--DNLAP  213 (388)
Q Consensus       138 ~~fggdp~~i~l~G~SaG~~~~~~~~~~~~~~~l~~~~i~~Sg~~~~~~~~~--~~~~~~~~~~a~~lgC~~~--~~~l~  213 (388)
                      ++|||||+||+|+|+||||++++.+++++..+++|+++|++||++.++|...  .........+++.+||...  +++++
T Consensus       185 ~~fggdp~~vtl~G~SaGg~~~~~~~~~~~~~~lf~~~i~~Sg~~~~~~~~~~~~~~~~~~~~~a~~lgc~~~~~~~~~~  264 (537)
T 1ea5_A          185 QFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAEGRRRAVELGRNLNCNLNSDEELIH  264 (537)
T ss_dssp             GGGTEEEEEEEEEEETHHHHHHHHHHHCHHHHTTCSEEEEESCCTTCTTSCBCHHHHHHHHHHHHHHTTCCCSSHHHHHH
T ss_pred             HHhCCCccceEEEecccHHHHHHHHHhCccchhhhhhheeccCCccCCccccCHHHHHHHHHHHHHHcCCCCCCHHHHHH
Confidence            9999999999999999999999999999888899999999999988777543  2234556789999999853  46799


Q ss_pred             HHhcCCHHHHHhhccC--------CCcccccc-ccccCCChHHHHHHcCCCCCCccEEEeecCCccccccccc------h
Q psy6011         214 CLRTHTLASLLQVNLT--------PPRFLAGF-GPHLFTDPNVALEKAGDNFVTTPLMAGVVTTESYLNFNAN------D  278 (388)
Q Consensus       214 CLR~~~~~~L~~a~~~--------~~~f~p~~-gp~l~~~P~~~l~~~~~~f~~vPlliG~~~~Eg~~~~~~~------~  278 (388)
                      |||++|+++|+++...        ...|.|++ |.+++++|..+++.  +++.+||+|+|+|++||.++....      +
T Consensus       265 cLr~~~~~~l~~a~~~~~~~~~~~~~~f~PvvDg~~lp~~p~~~~~~--g~~~~vp~liG~~~~Eg~~f~~~~~~~~~~~  342 (537)
T 1ea5_A          265 CLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNS--GNFKKTQILLGVNKDEGSFFLLYGAPGFSKD  342 (537)
T ss_dssp             HHHHSCHHHHHHHGGGGCSSSCSSCCSSCCBCCSSSSSSCHHHHHHH--TCSCCSCEEEEEETBTTHHHHHHHSTTCCTT
T ss_pred             HHhhCCHHHHHHHHhhhccccccccccceeeECcccCCcCHHHHHhc--CCCCCCCEEEeeecchhHHHHhhhccccccc
Confidence            9999999999877531        22466766 67899999988765  468999999999999997543210      0


Q ss_pred             hccCCCHHHHHhHh-hcChhHHHHHHHHhhcccccccccCCCCCCCchHHHHHHHHHhccchhHHh-HHHHHHHHHhhcC
Q psy6011         279 IQYGFEEDQRNRVL-RLTDDQRVQYLLSKLSGSALTVCSGIPPIGSNYQTIWNLLVDRYEDKRALA-SSYIDQIIKTYVR  356 (388)
Q Consensus       279 i~~g~~~~~~~~il-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~y~d~~~~a-~~~~~~~~~~~~~  356 (388)
                      ....++.+....++ ..++... +.....+    ...|+..... .+.......+.+.++|..+.+ ...+.+.+++.+.
T Consensus       343 ~~~~~~~~~~~~~~~~~~~~~~-~~~~~~i----~~~Y~~~~~~-~~~~~~~~~~~~~~~D~~f~~p~~~~a~~~a~~g~  416 (537)
T 1ea5_A          343 SESKISREDFMSGVKLSVPHAN-DLGLDAV----TLQYTDWMDD-NNGIKNRDGLDDIVGDHNVICPLMHFVNKYTKFGN  416 (537)
T ss_dssp             SCCCCCHHHHHHHHHHHSTTCC-HHHHHHH----HHHTCCTTST-TCHHHHHHHHHHHHHHHHTHHHHHHHHHHHHTTSS
T ss_pred             ccccCCHHHHHHHHHHHhhhhh-HHHHHHH----HHHhcCCCCC-CCHHHHHHHHHHHHhhHHhHhhHHHHHHHHHhcCC
Confidence            01122333332222 1121100 0000111    1122222111 233445667788899999999 5577788888889


Q ss_pred             cceeeechh
Q psy6011         357 NAYVYHLNE  365 (388)
Q Consensus       357 ~~Y~Y~f~~  365 (388)
                      ++|.|+|+.
T Consensus       417 ~vy~Y~F~~  425 (537)
T 1ea5_A          417 GTYLYFFNH  425 (537)
T ss_dssp             CEEEEEECC
T ss_pred             CcEEEEEec
Confidence            999999997
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>4g4g_A 4-O-methyl-glucuronoyl methylesterase; alpha/beta hydrolase, 3-layer alpha/beta/alpha sandwich, ROS fold, glucuronoyl esterase; 1.55A {Myceliophthora thermophila} PDB: 4g4i_A 4g4j_A* Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>4ebb_A Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2.00A {Homo sapiens} PDB: 3jyh_A* 3n0t_A* Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 388
d1dx4a_571 c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Dro 7e-21
d2h7ca1532 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase 7e-20
d2bcea_ 579 c.69.1.1 (A:) Bile-salt activated lipase (choleste 3e-17
d2ha2a1542 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mu 5e-17
d1ea5a_532 c.69.1.1 (A:) Acetylcholinesterase {Pacific electr 2e-15
d1qe3a_483 c.69.1.1 (A:) Thermophilic para-nitrobenzyl estera 6e-14
d1llfa_534 c.69.1.17 (A:) Type-B carboxylesterase/lipase {Can 1e-13
d1ukca_517 c.69.1.17 (A:) Esterase EstA {Aspergillus niger [T 4e-12
d1lzla_317 c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [Ta 7e-05
d1jjia_311 c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeogl 2e-04
d3c8da2246 c.69.1.2 (A:151-396) Enterochelin esterase, cataly 2e-04
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 571 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Acetylcholinesterase-like
domain: Acetylcholinesterase
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

 Score = 92.1 bits (227), Expect = 7e-21
 Identities = 58/283 (20%), Positives = 111/283 (39%), Gaps = 22/283 (7%)

Query: 47  SLEHGGRLEGSRGVDAPYAVIVFIHGESYEWNAGN--HYDGSVLASSGHIIFVSINYRLG 104
             +H       +       ++++I+G  +   +     Y+  ++A+ G++I  S  YR+G
Sbjct: 122 DTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLDIYNADIMAAVGNVIVASFQYRVG 181

Query: 105 ILGFL------KTQTGHTQSGNWAVSDVIAALEWIKINIASFGGDPTRITLFGHDTGAAL 158
             GFL       ++      GN  + D   A+ W+K N  +FGG+P  +TLFG   G++ 
Sbjct: 182 AFGFLHLAPEMPSEFAEEAPGNVGLWDQALAIRWLKDNAHAFGGNPEWMTLFGESAGSSS 241

Query: 159 VNIVLLTPSVKGLFHRVTLLSGSILSPWSFVHDPDSIR--------SNVADQLGCTLSDN 210
           VN  L++P  +GL  R  + SG++ +PWS +    ++          N    +  T   +
Sbjct: 242 VNAQLMSPVTRGLVKRGMMQSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAH 301

Query: 211 LAPCLRTHTLASLLQVNLTPPRFLAGFGPHLFTDPNVALEKAGDNFVTT-----PLMAGV 265
           +  C+R+    ++          +  F      D             T       ++ G 
Sbjct: 302 VMSCMRSVDAKTISVQQWNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMGN 361

Query: 266 VTTESYLNFNANDIQYGFEEDQRNRVLRLTDDQRVQYLLSKLS 308
           V  E    F   D    F++D    + R    + +  +  K +
Sbjct: 362 VRDEGTY-FLLYDFIDYFDKDDATALPRDKYLEIMNNIFGKAT 403
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Length = 532 Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Length = 579 Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Length = 542 Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Length = 532 Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Length = 483 Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Length = 534 Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Length = 517 Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Length = 317 Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 311 Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Length = 246 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query388
d1ea5a_532 Acetylcholinesterase {Pacific electric ray (Torped 100.0
d1p0ia_526 Butyryl cholinesterase {Human (Homo sapiens) [TaxI 100.0
d2ha2a1542 Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 100.0
d2h7ca1532 Mammalian carboxylesterase (liver carboxylesterase 100.0
d1llfa_534 Type-B carboxylesterase/lipase {Candida cylindrace 100.0
d1thga_544 Type-B carboxylesterase/lipase {Fungus (Geotrichum 100.0
d1qe3a_483 Thermophilic para-nitrobenzyl esterase (PNB estera 100.0
d1dx4a_571 Acetylcholinesterase {Fruit fly (Drosophila melano 100.0
d2bcea_ 579 Bile-salt activated lipase (cholesterol esterase) 100.0
d1ukca_517 Esterase EstA {Aspergillus niger [TaxId: 5061]} 100.0
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 99.83
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 99.83
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 99.8
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 99.79
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 99.77
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 99.61
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 99.34
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 99.26
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 99.18
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 98.87
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 98.83
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 98.78
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 98.7
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 98.68
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 98.67
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 98.65
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 98.53
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 98.52
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 98.52
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 98.45
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 98.36
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 98.32
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 98.31
d1ju3a2347 Bacterial cocaine esterase N-terminal domain {Rhod 98.26
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 98.26
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 98.19
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 98.19
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 98.18
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 98.18
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 98.16
d1r88a_267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 98.1
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 98.09
d2b9va2385 Alpha-amino acid ester hydrolase {Acetobacter past 98.03
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 98.02
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 97.99
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 97.97
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 97.97
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 97.96
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 97.96
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 97.89
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 97.88
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 97.87
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 97.83
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 97.82
d1rp1a2337 Pancreatic lipase, N-terminal domain {Dog (Canis f 97.81
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 97.81
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 97.79
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 97.76
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 97.74
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 97.71
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 97.71
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 97.68
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 97.67
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 97.66
d1pv1a_299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 97.66
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 97.62
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 97.61
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 97.61
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 97.6
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 97.58
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 97.57
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 97.55
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 97.53
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 97.53
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 97.36
d1lnsa3405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 97.23
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 97.22
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 97.17
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 97.13
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 97.05
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 96.63
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 96.52
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 96.31
d1ei9a_279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 96.15
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 95.99
d2d81a1318 Polyhydroxybutyrate depolymerase {Penicillium funi 95.54
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 94.77
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 94.57
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 94.3
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 93.4
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 93.19
d2vata1376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 91.73
d1ku0a_388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 85.03
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Acetylcholinesterase-like
domain: Acetylcholinesterase
species: Pacific electric ray (Torpedo californica) [TaxId: 7787]

Probab=100.00  E-value=4.5e-55  Score=445.27  Aligned_cols=358  Identities=23%  Similarity=0.362  Sum_probs=265.1

Q ss_pred             CcEEEccCCCCCCCccccccccCCCCc-cccceeEecc---c-----------------------CCCCc---eeecCCC
Q psy6011          10 TKIVVVPNSKYGAEKHQLCREMNPGPL-VWCASWVVGY---S-----------------------LEHGG---RLEGSRG   59 (388)
Q Consensus        10 ~~~~~~~~~~yg~~~~~~~~~~~p~~~-~~~~~~~~~~---~-----------------------~~~~~---~~~~p~~   59 (388)
                      .++..+.+++|+.+|...+|+..|.+. .|........   .                       ..+++   -++.|..
T Consensus        22 ~~v~~f~GIpyA~pP~G~~Rf~~p~~~~~w~~~~~at~~~~~C~Q~~~~~~~~~~~~~~~~~~~~~sEDCL~LnI~~P~~  101 (532)
T d1ea5a_          22 SHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSGSEMWNPNREMSEDCLYLNIWVPSP  101 (532)
T ss_dssp             EEEEEEEEEECBCCCCGGGTTSCCCBCCCCSSEEECBSCCCBCCCCCCCSSTTCHHHHTTSCCSCBCSCCCEEEEEECSS
T ss_pred             CcEEEEcccCCCCCCCCCCCCCCCCCCCCCCCceeCccCCCCCCCcCcccCcccccccccCCCCCcCccCCEEEEEeCCC
Confidence            468889999999999999999999865 4665443211   0                       11232   3478877


Q ss_pred             CCCCceEEEEEeCCCCCCCCCC--CCCcHHHHhcCCeEEEEecccccccccccCCCCCCCCCCchhHHHHHHHHHHHHhH
Q psy6011          60 VDAPYAVIVFIHGESYEWNAGN--HYDGSVLASSGHIIFVSINYRLGILGFLKTQTGHTQSGNWAVSDVIAALEWIKINI  137 (388)
Q Consensus        60 ~~~~~Pv~v~ihGGg~~~g~~~--~~~~~~la~~~~~vvv~~~YRl~~~g~~~~~~~~~~~~n~~l~D~~~al~wv~~~i  137 (388)
                      ..+++|||||||||||..|++.  .+++..++.++++|||++|||||++||+........+||+||+||++||+||++||
T Consensus       102 ~~~~lPV~v~ihGG~~~~g~~~~~~~~~~~~~~~~~vvvVt~nYRlg~~GFl~~~~~~~~~gN~Gl~Dq~~AL~WV~~nI  181 (532)
T d1ea5a_         102 RPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHGSQEAPGNVGLLDQRMALQWVHDNI  181 (532)
T ss_dssp             CCSSEEEEEEECCSTTTCCCTTCGGGCTHHHHHHHTCEEEECCCCCHHHHHCCCTTCSSSCSCHHHHHHHHHHHHHHHHG
T ss_pred             CCCCCcEEEEEEcCCcccccCCccccCcchhhcccCccEEEEeeccccccccccccccCCCCcccchhHHHHHHHHHHHH
Confidence            7788999999999999999886  47778877777899999999999999999876667899999999999999999999


Q ss_pred             HhcCCCCCCcEEeecCCcchhHHHHhhccccccccceeeeccCCcCCCCCCCCCh--hhHHHHHHHhhCCCCc--cchHH
Q psy6011         138 ASFGGDPTRITLFGHDTGAALVNIVLLTPSVKGLFHRVTLLSGSILSPWSFVHDP--DSIRSNVADQLGCTLS--DNLAP  213 (388)
Q Consensus       138 ~~fggdp~~i~l~G~SaG~~~~~~~~~~~~~~~l~~~~i~~Sg~~~~~~~~~~~~--~~~~~~~a~~lgC~~~--~~~l~  213 (388)
                      ++|||||+||||+|+||||.++.+|++++..++|||+||+|||++..++......  ......+++.++|...  .++++
T Consensus       182 ~~FGGDp~~VTl~G~SAGa~sv~~~~~sp~~~~lF~~aI~~Sg~~~~~~~~~~~~~~~~~~~~~a~~l~~~~~~~~~~l~  261 (532)
T d1ea5a_         182 QFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAEGRRRAVELGRNLNCNLNSDEELIH  261 (532)
T ss_dssp             GGGTEEEEEEEEEEETHHHHHHHHHHHCHHHHTTCSEEEEESCCTTCTTSCBCHHHHHHHHHHHHHHTTCCCSSHHHHHH
T ss_pred             HhhcCCccceEeeeecccccchhhhccCccchhhhhhheeecccccCcccccccHHHHHHHHHHHHHhhcccCCHHHHHH
Confidence            9999999999999999999999999999999999999999999998877655433  3345678999999864  46799


Q ss_pred             HHhcCCHHHHHhhccC--------CCcccccc-ccccCCChHHHHHHcCCCCCCccEEEeecCCcccccccc--c----h
Q psy6011         214 CLRTHTLASLLQVNLT--------PPRFLAGF-GPHLFTDPNVALEKAGDNFVTTPLMAGVVTTESYLNFNA--N----D  278 (388)
Q Consensus       214 CLR~~~~~~L~~a~~~--------~~~f~p~~-gp~l~~~P~~~l~~~~~~f~~vPlliG~~~~Eg~~~~~~--~----~  278 (388)
                      |||++++++|+++...        ...|.|++ |.+++++|..++++  +++.+||+|+|+|++||.++...  .    +
T Consensus       262 cLr~~~~~~L~~a~~~~~~~~~~~~~~f~PviDG~~lp~~p~~~~~~--g~~~~vPiliG~t~dEg~~f~~~~~~~~~~~  339 (532)
T d1ea5a_         262 CLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNS--GNFKKTQILLGVNKDEGSFFLLYGAPGFSKD  339 (532)
T ss_dssp             HHHHSCHHHHHHHGGGGCSSSCSSCCSSCCBCCSSSSSSCHHHHHHH--TCSCCSCEEEEEETBTTHHHHHHHSTTCCTT
T ss_pred             HHHcCCHHHHHHHHhccCcccccCCcccCCcccceecChhHHHHHhc--CCcccCceeeccccchhhhhhhhcccccccc
Confidence            9999999999887432        12466765 77899999988765  46899999999999999764211  0    0


Q ss_pred             hccCCCHHHHHhHh-hcCh---hHHHHHHHHhhcccccccccCCCCCCCchHHHHHHHHHhccchhHHh-HHHHHHHHHh
Q psy6011         279 IQYGFEEDQRNRVL-RLTD---DQRVQYLLSKLSGSALTVCSGIPPIGSNYQTIWNLLVDRYEDKRALA-SSYIDQIIKT  353 (388)
Q Consensus       279 i~~g~~~~~~~~il-~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~y~d~~~~a-~~~~~~~~~~  353 (388)
                      .......+.....+ ...+   +.....+.. .+       .... ...........+.+.++|..+.+ ...+.+.+++
T Consensus       340 ~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~-~y-------~~~~-~~~~~~~~~~~~~~l~tD~~f~~P~~~~a~~~a~  410 (532)
T d1ea5a_         340 SESKISREDFMSGVKLSVPHANDLGLDAVTL-QY-------TDWM-DDNNGIKNRDGLDDIVGDHNVICPLMHFVNKYTK  410 (532)
T ss_dssp             SCCCCCHHHHHHHHHHHSTTCCHHHHHHHHH-HT-------CCTT-STTCHHHHHHHHHHHHHHHHTHHHHHHHHHHHHT
T ss_pred             chhhccHHHHHHHHHHhccccchhHHHHHHH-Hh-------cccc-cCcchhhHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            11112222222211 1111   111111111 11       1111 12333456677888999999999 5577888889


Q ss_pred             hcCcceeeechhhhhhhhhccccCCCC
Q psy6011         354 YVRNAYVYHLNEIFSTIRNEYTDWDKN  380 (388)
Q Consensus       354 ~~~~~Y~Y~f~~~~~~~~~~yt~w~~~  380 (388)
                      .+.++|.|+|+..-  -...+++|.|+
T Consensus       411 ~~~~vy~Y~F~~~~--~~~~~~~~~Ga  435 (532)
T d1ea5a_         411 FGNGTYLYFFNHRA--SNLVWPEWMGV  435 (532)
T ss_dssp             TSSCEEEEEECCCC--TTCCSCGGGCS
T ss_pred             hcCCcceEEecccc--ccccCCCCCCc
Confidence            99999999999722  22334555554
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure