Psyllid ID: psy6850

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MGKGPNTSSSSSLNSFTSCKEKVLITTNVLARGIDVEQVTIVINFDMPIDMNGQADCETYLHRIGRTGRFGKCGIAINLVDEHSVGVLKDIEKHFGKKIELLDTEDIDDEGNFRNLTN
cccccHHHHHHHHHHHHcccccEEEEccccccccccccccEEEEccccccccccccccccccccccccccccccEEEEEEcccHHHHHHHHHHHHccccccccccccHHHHHHccccc
cccccHHHHHHHHHHHHccccEEEEEEEHHHccccccccEEEEEEccccccccccccHHHEEEEcccccccccEEEEEEEcHHHHHHHHHHHHHHHcccccccccccccHHHHccccc
mgkgpntssssslnsftsckekVLITTNVLargidveqVTIVINfdmpidmngqaDCETYLHRigrtgrfgkcgiainlvdehsvGVLKDIEKHFGKkielldtediddegnfrnltn
mgkgpntssssslnsftscKEKVLITTnvlargidveqVTIVINFDMPIDMNGQADCETYLHRIGRTGRFGKCGIAINLVDEHSVGVLKDIEKHFGKkielldtediddegnfrnltn
MGKGPntssssslnsftsCKEKVLITTNVLARGIDVEQVTIVINFDMPIDMNGQADCETYLHRIGRTGRFGKCGIAINLVDEHSVGVLKDIEKHFGKKielldtediddeGNFRNLTN
****************TSCKEKVLITTNVLARGIDVEQVTIVINFDMPIDMNGQADCETYLHRIGRTGRFGKCGIAINLVDEHSVGVLKDIEKHFGKKIELLDT**************
******T*SSSSLNSFTSCKEKVLITTNVLARGIDVEQVTIVINFDMPIDMNGQADCETYLHRIGRTGRFGKCGIAINLVDEHSVGVLKDIEKHFGKKIELLDTEDIDD**NF*****
***************FTSCKEKVLITTNVLARGIDVEQVTIVINFDMPIDMNGQADCETYLHRIGRTGRFGKCGIAINLVDEHSVGVLKDIEKHFGKKIELLDTEDIDDEGNFRNLTN
*******S*SSSLNSFTSCKEKVLITTNVLARGIDVEQVTIVINFDMPIDMNGQADCETYLHRIGRTGRFGKCGIAINLVDEHSVGVLKDIEKHFGKKIELLDTEDID**********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKGPNTSSSSSLNSFTSCKEKVLITTNVLARGIDVEQVTIVINFDMPIDMNGQADCETYLHRIGRTGRFGKCGIAINLVDEHSVGVLKDIEKHFGKKIELLDTEDIDDEGNFRNLTN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query118 2.2.26 [Sep-21-2011]
O61305460 DEAD-box helicase Dbp80 O yes N/A 0.822 0.210 0.673 1e-33
Q9UMR2479 ATP-dependent RNA helicas no N/A 0.847 0.208 0.623 1e-32
Q61655478 ATP-dependent RNA helicas yes N/A 0.847 0.209 0.623 2e-32
Q3ZBV2478 ATP-dependent RNA helicas yes N/A 0.847 0.209 0.623 2e-32
Q9NUU7478 ATP-dependent RNA helicas no N/A 0.847 0.209 0.623 2e-32
Q9DGP9483 ATP-dependent RNA helicas N/A N/A 0.932 0.227 0.545 3e-29
Q9QY15484 ATP-dependent RNA helicas no N/A 0.847 0.206 0.56 2e-27
Q9QY16483 ATP-dependent RNA helicas no N/A 0.847 0.207 0.56 2e-27
Q2TBP1483 ATP-dependent RNA helicas no N/A 0.847 0.207 0.56 3e-27
Q9UHL0483 ATP-dependent RNA helicas no N/A 0.847 0.207 0.55 5e-26
>sp|O61305|DDX19_DROME DEAD-box helicase Dbp80 OS=Drosophila melanogaster GN=Dbp80 PE=1 SV=1 Back     alignment and function desciption
 Score =  141 bits (355), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 83/98 (84%), Gaps = 1/98 (1%)

Query: 13  LNSFTSCKEKVLITTNVLARGIDVEQVTIVINFDMPIDMNGQADCETYLHRIGRTGRFGK 72
           L+ F S  EKVLITTN+L+RGID+EQ+ +V+NFD+P+D++G ADCETYLHRIGRTGRFGK
Sbjct: 357 LDRFRSGLEKVLITTNILSRGIDIEQLQVVVNFDLPVDLDGMADCETYLHRIGRTGRFGK 416

Query: 73  CGIAINLV-DEHSVGVLKDIEKHFGKKIELLDTEDIDD 109
            GIAINL+ DE ++ V  DIEKHF KKIE+L+T+  DD
Sbjct: 417 SGIAINLITDEKTMKVCSDIEKHFNKKIEVLNTDSADD 454
ATP-dependent RNA helicase involved in mRNA export from the nucleus.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q9UMR2|DD19B_HUMAN ATP-dependent RNA helicase DDX19B OS=Homo sapiens GN=DDX19B PE=1 SV=1 Back     alignment and function description
>sp|Q61655|DD19A_MOUSE ATP-dependent RNA helicase DDX19A OS=Mus musculus GN=Ddx19a PE=2 SV=2 Back     alignment and function description
>sp|Q3ZBV2|DD19A_BOVIN ATP-dependent RNA helicase DDX19A OS=Bos taurus GN=DDX19A PE=2 SV=1 Back     alignment and function description
>sp|Q9NUU7|DD19A_HUMAN ATP-dependent RNA helicase DDX19A OS=Homo sapiens GN=DDX19A PE=1 SV=1 Back     alignment and function description
>sp|Q9DGP9|DDX25_XENLA ATP-dependent RNA helicase DDX25 OS=Xenopus laevis GN=deadsouth PE=2 SV=1 Back     alignment and function description
>sp|Q9QY15|DDX25_MOUSE ATP-dependent RNA helicase DDX25 OS=Mus musculus GN=Ddx25 PE=1 SV=2 Back     alignment and function description
>sp|Q9QY16|DDX25_RAT ATP-dependent RNA helicase DDX25 OS=Rattus norvegicus GN=Ddx25 PE=1 SV=2 Back     alignment and function description
>sp|Q2TBP1|DDX25_BOVIN ATP-dependent RNA helicase DDX25 OS=Bos taurus GN=DDX25 PE=2 SV=1 Back     alignment and function description
>sp|Q9UHL0|DDX25_HUMAN ATP-dependent RNA helicase DDX25 OS=Homo sapiens GN=DDX25 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query118
66547453 475 PREDICTED: DEAD-box helicase Dbp80 [Apis 0.838 0.208 0.74 7e-35
383849834 475 PREDICTED: DEAD-box helicase Dbp80-like 0.838 0.208 0.73 7e-35
332019714 481 DEAD-box helicase Dbp80 [Acromyrmex echi 0.838 0.205 0.72 1e-34
340722474 475 PREDICTED: DEAD-box helicase Dbp80-like 0.838 0.208 0.71 2e-34
307199044 473 DEAD-box helicase Dbp80 [Harpegnathos sa 0.838 0.209 0.73 2e-34
350418469 475 PREDICTED: DEAD-box helicase Dbp80-like 0.838 0.208 0.71 3e-34
307173630 482 DEAD-box helicase Dbp80 [Camponotus flor 0.838 0.205 0.72 5e-34
291222274 530 PREDICTED: DDX19-like protein-like [Sacc 0.822 0.183 0.704 5e-34
16415782 472 Dbp5 protein [Chironomus tentans] 0.822 0.205 0.714 2e-33
195553569 481 GD11942 [Drosophila simulans] gi|1942020 0.822 0.201 0.704 3e-33
>gi|66547453|ref|XP_624946.1| PREDICTED: DEAD-box helicase Dbp80 [Apis mellifera] gi|380014255|ref|XP_003691155.1| PREDICTED: DEAD-box helicase Dbp80-like [Apis florea] Back     alignment and taxonomy information
 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 74/100 (74%), Positives = 84/100 (84%), Gaps = 1/100 (1%)

Query: 11  SSLNSFTSCKEKVLITTNVLARGIDVEQVTIVINFDMPIDMNGQADCETYLHRIGRTGRF 70
           S L+ F +  EKVLITTNVLARGIDVEQVTIV+NFD+P+D N QADCETYLHRIGR GRF
Sbjct: 370 SVLDRFRAGLEKVLITTNVLARGIDVEQVTIVVNFDLPMDQNRQADCETYLHRIGRAGRF 429

Query: 71  GKCGIAINLVD-EHSVGVLKDIEKHFGKKIELLDTEDIDD 109
           GK GIAINLVD  H++ + KDIEKHF KKI+ LDTED D+
Sbjct: 430 GKSGIAINLVDSSHAMQICKDIEKHFAKKIKYLDTEDADE 469

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383849834|ref|XP_003700540.1| PREDICTED: DEAD-box helicase Dbp80-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|332019714|gb|EGI60184.1| DEAD-box helicase Dbp80 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|340722474|ref|XP_003399630.1| PREDICTED: DEAD-box helicase Dbp80-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307199044|gb|EFN79768.1| DEAD-box helicase Dbp80 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|350418469|ref|XP_003491867.1| PREDICTED: DEAD-box helicase Dbp80-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307173630|gb|EFN64481.1| DEAD-box helicase Dbp80 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|291222274|ref|XP_002731145.1| PREDICTED: DDX19-like protein-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|16415782|emb|CAC87273.1| Dbp5 protein [Chironomus tentans] Back     alignment and taxonomy information
>gi|195553569|ref|XP_002076688.1| GD11942 [Drosophila simulans] gi|194202067|gb|EDX15643.1| GD11942 [Drosophila simulans] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query118
FB|FBgn0024804460 Dbp80 "Dead box protein 80" [D 0.661 0.169 0.721 4e-28
UNIPROTKB|J9PAF3267 J9PAF3 "Uncharacterized protei 0.669 0.295 0.687 2.5e-26
UNIPROTKB|B4DRZ7388 DDX19A "ATP-dependent RNA heli 0.669 0.203 0.687 2.5e-26
UNIPROTKB|I3L352396 DDX19A "ATP-dependent RNA heli 0.669 0.199 0.687 2.5e-26
UNIPROTKB|I3L0H8447 DDX19A "ATP-dependent RNA heli 0.669 0.176 0.687 3.3e-26
UNIPROTKB|Q5ZMC1479 DDX19B "Uncharacterized protei 0.669 0.164 0.7 4.4e-26
UNIPROTKB|Q3ZBV2478 DDX19A "ATP-dependent RNA heli 0.669 0.165 0.687 5.6e-26
UNIPROTKB|E2RR50478 DDX19A "Uncharacterized protei 0.669 0.165 0.687 5.6e-26
UNIPROTKB|Q9NUU7478 DDX19A "ATP-dependent RNA heli 0.669 0.165 0.687 5.6e-26
UNIPROTKB|I3LC00478 DDX19A "Uncharacterized protei 0.669 0.165 0.687 5.6e-26
FB|FBgn0024804 Dbp80 "Dead box protein 80" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 314 (115.6 bits), Expect = 4.0e-28, P = 4.0e-28
 Identities = 57/79 (72%), Positives = 70/79 (88%)

Query:    21 EKVLITTNVLARGIDVEQVTIVINFDMPIDMNGQADCETYLHRIGRTGRFGKCGIAINLV 80
             EKVLITTN+L+RGID+EQ+ +V+NFD+P+D++G ADCETYLHRIGRTGRFGK GIAINL+
Sbjct:   365 EKVLITTNILSRGIDIEQLQVVVNFDLPVDLDGMADCETYLHRIGRTGRFGKSGIAINLI 424

Query:    81 -DEHSVGVLKDIEKHFGKK 98
              DE ++ V  DIEKHF KK
Sbjct:   425 TDEKTMKVCSDIEKHFNKK 443
GO:0004004 "ATP-dependent RNA helicase activity" evidence=NAS
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0044614 "nuclear pore cytoplasmic filaments" evidence=ISS
UNIPROTKB|J9PAF3 J9PAF3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|B4DRZ7 DDX19A "ATP-dependent RNA helicase DDX19A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3L352 DDX19A "ATP-dependent RNA helicase DDX19A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3L0H8 DDX19A "ATP-dependent RNA helicase DDX19A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZMC1 DDX19B "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZBV2 DDX19A "ATP-dependent RNA helicase DDX19A" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RR50 DDX19A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NUU7 DDX19A "ATP-dependent RNA helicase DDX19A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LC00 DDX19A "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q61655DD19A_MOUSE3, ., 6, ., 4, ., 1, 30.62370.84740.2092yesN/A
P20449DBP5_YEAST3, ., 6, ., 4, ., 1, 30.51510.82200.2012yesN/A
Q3ZBV2DD19A_BOVIN3, ., 6, ., 4, ., 1, 30.62370.84740.2092yesN/A
Q6CJU1DBP5_KLULA3, ., 6, ., 4, ., 1, 30.52520.82200.2068yesN/A
Q6FKN8DBP5_CANGA3, ., 6, ., 4, ., 1, 30.510.81350.1904yesN/A
O02494IF4A_CRYPV3, ., 6, ., 4, ., 1, 30.51130.69490.2024yesN/A
Q4HY71DBP5_GIBZE3, ., 6, ., 4, ., 1, 30.530.82200.1987yesN/A
Q6C3X7DBP5_YARLI3, ., 6, ., 4, ., 1, 30.51020.82200.1987yesN/A
O61305DDX19_DROME3, ., 6, ., 4, ., 1, 30.67340.82200.2108yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query118
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 4e-27
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 4e-26
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 1e-25
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 5e-19
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 9e-19
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 2e-18
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 1e-17
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 2e-17
smart0049082 smart00490, HELICc, helicase superfamily c-termina 3e-17
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 1e-16
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 1e-16
PRK04537 572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 6e-16
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 4e-15
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 3e-11
TIGR01389 591 TIGR01389, recQ, ATP-dependent DNA helicase RecQ 3e-05
COG0514 590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 4e-04
PRK11057 607 PRK11057, PRK11057, ATP-dependent DNA helicase Rec 0.003
TIGR00614470 TIGR00614, recQ_fam, ATP-dependent DNA helicase, R 0.003
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information 
 Score =  102 bits (256), Expect = 4e-27
 Identities = 45/88 (51%), Positives = 63/88 (71%), Gaps = 6/88 (6%)

Query: 13  LNSFTSCKEKVLITTNVLARGIDVEQVTIVINFDMPIDMNGQADCETYLHRIGRTGRFGK 72
           +  F S   +VLITT++LARGIDV+QV++VIN+D+P      A  E Y+HRIGR+GRFG+
Sbjct: 310 MREFRSGSTRVLITTDLLARGIDVQQVSLVINYDLP------ASPENYIHRIGRSGRFGR 363

Query: 73  CGIAINLVDEHSVGVLKDIEKHFGKKIE 100
            G+AIN V    +  LK+IE+H+  +IE
Sbjct: 364 KGVAINFVTPDDIEQLKEIERHYNTQIE 391

Length = 401
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ Back     alignment and domain information
>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 118
KOG0328|consensus400 99.97
KOG0330|consensus476 99.96
KOG0332|consensus477 99.95
KOG0331|consensus519 99.95
KOG0340|consensus442 99.95
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.95
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.94
KOG0333|consensus673 99.93
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 99.93
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 99.93
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 99.93
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.93
PTZ00424401 helicase 45; Provisional 99.93
PTZ00110545 helicase; Provisional 99.92
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 99.92
KOG0326|consensus459 99.92
KOG0336|consensus629 99.92
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.92
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 99.92
KOG0342|consensus543 99.91
KOG0338|consensus 691 99.9
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.9
KOG0345|consensus 567 99.9
KOG0335|consensus482 99.9
KOG0341|consensus610 99.89
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.89
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.89
KOG0348|consensus 708 99.89
KOG0327|consensus397 99.89
KOG0344|consensus593 99.88
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.88
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.86
KOG0347|consensus 731 99.86
KOG0350|consensus620 99.86
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 99.86
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.85
KOG0343|consensus 758 99.83
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.81
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.81
KOG0339|consensus 731 99.81
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 99.8
PRK13767 876 ATP-dependent helicase; Provisional 99.79
KOG0334|consensus 997 99.79
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.78
PRK04914 956 ATP-dependent helicase HepA; Validated 99.78
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.77
PRK10689 1147 transcription-repair coupling factor; Provisional 99.77
PRK05298652 excinuclease ABC subunit B; Provisional 99.76
PRK02362 737 ski2-like helicase; Provisional 99.74
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.74
KOG0346|consensus 569 99.74
smart0049082 HELICc helicase superfamily c-terminal domain. 99.74
KOG4284|consensus 980 99.73
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.73
KOG0349|consensus725 99.72
PHA02653 675 RNA helicase NPH-II; Provisional 99.72
KOG0351|consensus 941 99.71
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.71
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.71
PRK00254 720 ski2-like helicase; Provisional 99.68
KOG0354|consensus 746 99.68
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.68
PRK13766 773 Hef nuclease; Provisional 99.67
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.67
KOG0337|consensus 529 99.66
KOG0352|consensus 641 99.66
PRK01172 674 ski2-like helicase; Provisional 99.65
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.64
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.64
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.6
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.6
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.6
PHA02558501 uvsW UvsW helicase; Provisional 99.59
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.57
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.55
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.54
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.54
KOG0329|consensus387 99.53
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.52
PRK05580679 primosome assembly protein PriA; Validated 99.52
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.5
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.41
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 99.38
KOG0353|consensus 695 99.37
KOG0953|consensus 700 99.37
COG1204 766 Superfamily II helicase [General function predicti 99.36
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.28
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.22
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.19
PRK14701 1638 reverse gyrase; Provisional 99.18
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.13
COG1202 830 Superfamily II helicase, archaea-specific [General 99.12
KOG0950|consensus 1008 99.12
KOG4150|consensus 1034 99.12
PRK09401 1176 reverse gyrase; Reviewed 99.09
COG1205 851 Distinct helicase family with a unique C-terminal 99.08
PRK09694 878 helicase Cas3; Provisional 99.06
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.06
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.02
COG4098441 comFA Superfamily II DNA/RNA helicase required for 98.99
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 98.92
KOG0947|consensus 1248 98.92
KOG0923|consensus 902 98.91
KOG0952|consensus 1230 98.9
KOG0922|consensus 674 98.88
KOG0951|consensus 1674 98.86
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 98.85
KOG0948|consensus 1041 98.79
PRK12904 830 preprotein translocase subunit SecA; Reviewed 98.79
KOG0949|consensus 1330 98.72
PRK13107 908 preprotein translocase subunit SecA; Reviewed 98.72
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 98.69
KOG0924|consensus 1042 98.63
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 98.62
KOG0390|consensus776 98.61
KOG0920|consensus 924 98.6
KOG0926|consensus 1172 98.59
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 98.43
KOG0385|consensus 971 98.05
KOG0392|consensus1549 97.93
KOG0387|consensus 923 97.91
KOG1123|consensus776 97.82
KOG0384|consensus 1373 97.73
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 97.73
PF13871 278 Helicase_C_4: Helicase_C-like 97.65
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 97.63
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 97.58
PRK14873665 primosome assembly protein PriA; Provisional 97.57
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 97.47
COG4889 1518 Predicted helicase [General function prediction on 97.46
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 97.38
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 97.34
KOG0925|consensus 699 97.34
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 97.32
PRK12326 764 preprotein translocase subunit SecA; Reviewed 97.29
smart00492141 HELICc3 helicase superfamily c-terminal domain. 97.21
KOG0391|consensus 1958 97.13
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 97.01
smart00491142 HELICc2 helicase superfamily c-terminal domain. 97.01
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 96.95
KOG0388|consensus1185 96.85
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 96.84
KOG0389|consensus941 96.74
KOG1000|consensus689 96.61
KOG1015|consensus 1567 96.6
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 96.59
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 96.42
KOG1002|consensus791 96.3
COG4096 875 HsdR Type I site-specific restriction-modification 96.13
KOG4439|consensus901 96.09
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 96.01
KOG1513|consensus 1300 95.77
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 95.71
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 95.62
KOG0701|consensus 1606 95.52
CHL00122 870 secA preprotein translocase subunit SecA; Validate 95.5
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 95.44
KOG0951|consensus 1674 94.85
KOG0386|consensus 1157 94.75
PF10593239 Z1: Z1 domain; InterPro: IPR018310 This entry repr 94.69
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 94.47
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 94.18
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 93.84
KOG0921|consensus 1282 93.83
KOG1016|consensus 1387 93.55
PRK14873 665 primosome assembly protein PriA; Provisional 92.66
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 91.97
COG1198 730 PriA Primosomal protein N' (replication factor Y) 91.54
PRK05580 679 primosome assembly protein PriA; Validated 91.09
TIGR00595 505 priA primosomal protein N'. All proteins in this f 90.66
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 89.35
PRK09401 1176 reverse gyrase; Reviewed 87.96
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 87.39
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 85.67
PRK10689 1147 transcription-repair coupling factor; Provisional 81.61
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 81.01
>KOG0328|consensus Back     alignment and domain information 
Probab=99.97  E-value=9e-31  Score=188.13  Aligned_cols=101  Identities=45%  Similarity=0.770  Sum_probs=98.6

Q ss_pred             CCCCCHHHHHHHHHHHhcCCCcEEEEcCccccccCcCCccEEEEecCCCCCCCCCCcchhhhhhcccccCCCceEEEEEe
Q psy6850           1 MGKGPNTSSSSSLNSFTSCKEKVLITTNVLARGIDVEQVTIVINFDMPIDMNGQADCETYLHRIGRTGRFGKCGIAINLV   80 (118)
Q Consensus         1 Hg~l~~~~r~~~~~~F~~g~~~iLv~T~~~~~Gidi~~v~~VI~~~~p~~~~~~~~~~~y~qr~GR~gR~~~~g~~~~~~   80 (118)
                      ||+|++++|.+++++||+|+.+||++||+.+||+|+|.|.+|||||+|.      +.+.|+||+||+||+|+.|+++.|+
T Consensus       297 HGDm~qkERd~im~dFRsg~SrvLitTDVwaRGiDv~qVslviNYDLP~------nre~YIHRIGRSGRFGRkGvainFV  370 (400)
T KOG0328|consen  297 HGDMEQKERDKIMNDFRSGKSRVLITTDVWARGIDVQQVSLVINYDLPN------NRELYIHRIGRSGRFGRKGVAINFV  370 (400)
T ss_pred             cCCcchhHHHHHHHHhhcCCceEEEEechhhccCCcceeEEEEecCCCc------cHHHHhhhhccccccCCcceEEEEe
Confidence            9999999999999999999999999999999999999999999999999      9999999999999999999999999


Q ss_pred             cCCcHHHHHHHHHHhCCCceecCCCCh
Q psy6850          81 DEHSVGVLKDIEKHFGKKIELLDTEDI  107 (118)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~  107 (118)
                      ..++...++.++++++..+.++|++..
T Consensus       371 k~~d~~~lrdieq~yst~i~emp~nva  397 (400)
T KOG0328|consen  371 KSDDLRILRDIEQYYSTQIDEMPMNVA  397 (400)
T ss_pred             cHHHHHHHHHHHHHHhhhcccccchhh
Confidence            999999999999999999999998743

>KOG0330|consensus Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>KOG1513|consensus Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>KOG0701|consensus Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>PF10593 Z1: Z1 domain; InterPro: IPR018310 This entry represents the Z1 domain of unknown function that is found in a group of putative endonucleases Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>KOG1016|consensus Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query118
3g0h_A424 Human Dead-box Rna Helicase Ddx19, In Complex With 5e-29
3fht_A412 Crystal Structure Of Human Dbp5 In Complex With Amp 5e-29
3ews_A445 Human Dead-Box Rna-Helicase Ddx19 In Complex With A 5e-29
3fmp_B479 Crystal Structure Of The Nucleoporin Nup214 In Comp 5e-29
3pey_A395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 8e-23
3pew_A395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 8e-23
2rb4_A175 Crystal Structure Of The Helicase Domain Of Human D 9e-23
2kbf_A187 Solution Structure Of Carboxyl-Terminal Domain Of D 1e-22
3gfp_A189 Structure Of The C-Terminal Domain Of The Dead-Box 3e-22
3peu_A188 S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To 3e-22
3fho_B508 Structure Of S. Pombe Dbp5 Length = 508 2e-21
2j0u_B374 The Crystal Structure Of Eif4aiii-Barentsz Complex 1e-16
2hyi_C413 Structure Of The Human Exon Junction Complex With A 1e-16
2j0q_A410 The Crystal Structure Of The Exon Junction Complex 1e-16
2xb2_A411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 1e-16
2hxy_A391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 1e-16
2j0u_A374 The Crystal Structure Of Eif4aiii-Barentsz Complex 1e-16
1xtj_A386 Structure Of Human Uap56 In Complex With Adp Length 1e-14
1xtk_A390 Structure Of Decd To Dead Mutation Of Human Uap56 L 1e-14
1xti_A391 Structure Of Wildtype Human Uap56 Length = 391 1e-14
1t5i_A172 Crystal Structure Of The C-Terminal Domain Of Uap56 2e-14
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 4e-14
2wax_A193 Structure Of The Human Ddx6 C-Terminal Domain In Co 1e-13
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 2e-13
2jgn_A185 Ddx3 Helicase Domain Length = 185 5e-13
2hjv_A163 Structure Of The Second Domain (Residues 207-368) O 9e-13
2yjt_D170 Crystal Structure Of E. Coli Dead-Box Protein Srmb 6e-12
1fuk_A165 Crystal Structure Of The Carboxy Terminal Domain Of 4e-11
2vso_A395 Crystal Structure Of A Translation Initiation Compl 1e-10
3eiq_A414 Crystal Structure Of Pdcd4-eif4a Length = 414 2e-10
2zu6_A388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 2e-10
1fuu_A394 Yeast Initiation Factor 4a Length = 394 2e-10
2z0m_A337 Crystal Structure Of Hypothetical Atp-Dependent Rna 3e-10
1hv8_A367 Crystal Structure Of A Dead Box Protein From The Hy 4e-10
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 1e-09
2p6n_A191 Human Dead-box Rna Helicase Ddx41, Helicase Domain 5e-08
3sqx_A512 Structure Of Mss116p (Nte And C-Tail Double Deletio 7e-05
3i5x_A563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 8e-05
3sqw_A 579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 8e-05
4db2_A257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 1e-04
4db4_A256 Mss116p Dead-Box Helicase Domain 2 Bound To A Chima 1e-04
4db2_C257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 1e-04
>pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 Back     alignment and structure 
Iteration: 1

 Score =  122 bits (306), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 55/80 (68%), Positives = 69/80 (86%), Gaps = 1/80 (1%)
Query: 20  KEKVLITTNVLARGIDVEQVTIVINFDMPIDMNGQADCETYLHRIGRTGRFGKCGIAINL 79
           KEKVL+TTNV ARGIDVEQV++VINFD+P+D +G  D ETYLHRIGRTGRFGK G+A+N+
Sbjct: 332 KEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNM 391
Query: 80  VD-EHSVGVLKDIEKHFGKK 98
           VD +HS+ +L  I++HF KK
Sbjct: 392 VDSKHSMNILNRIQEHFNKK 411
>pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 Back     alignment and structure
>pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 Back     alignment and structure
>pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|2RB4|A Chain A, Crystal Structure Of The Helicase Domain Of Human Ddx25 Rna Helicase Length = 175 Back     alignment and structure
>pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 Back     alignment and structure
>pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 Back     alignment and structure
>pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|1T5I|A Chain A, Crystal Structure Of The C-Terminal Domain Of Uap56 Length = 172 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 Back     alignment and structure
>pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 Back     alignment and structure
>pdb|2YJT|D Chain D, Crystal Structure Of E. Coli Dead-Box Protein Srmb Bound To Regulator Of Ribonuclease Activity A (Rraa) Length = 170 Back     alignment and structure
>pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure
>pdb|4DB2|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|4DB4|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To A Chimaeric Rna-Dna Duplex Length = 256 Back     alignment and structure
>pdb|4DB2|C Chain C, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query118
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 1e-53
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 4e-50
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 8e-49
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 1e-48
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 8e-46
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 1e-42
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 3e-41
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 8e-37
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 1e-36
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 3e-36
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 2e-35
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 9e-35
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 1e-34
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 2e-32
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 2e-28
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 5e-28
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 1e-27
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 2e-27
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 2e-26
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 6e-26
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 6e-25
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 5e-24
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 1e-23
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 9e-23
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 9e-14
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 9e-10
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 4e-05
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 1e-04
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 1e-04
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 2e-04
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 3e-04
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 7e-04
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query118
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.96
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.96
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.95
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.95
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 99.95
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.94
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.93
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.93
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.93
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.92
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.87
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.92
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.92
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.91
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.91
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.91
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.91
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.91
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.9
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.9
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.9
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.88
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.88
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.87
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 99.87
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.87
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 99.86
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.85
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 99.84
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.82
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.8
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.8
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.8
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.79
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.79
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.78
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.78
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.78
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.78
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.78
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.77
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.77
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.77
1yks_A 440 Genome polyprotein [contains: flavivirin protease 99.76
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.76
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.75
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 99.74
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.74
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.73
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.73
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.73
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.72
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 99.72
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.71
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.71
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 99.7
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.69
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.69
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.68
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.67
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.67
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.66
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.65
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 99.64
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.64
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.62
3h1t_A590 Type I site-specific restriction-modification syst 99.59
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.58
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.51
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.26
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 97.94
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 96.58
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 96.45
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 89.48
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 88.1
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 82.11
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
Probab=99.96  E-value=6.2e-29  Score=167.89  Aligned_cols=110  Identities=51%  Similarity=0.806  Sum_probs=96.3

Q ss_pred             CCCCCHHHHHHHHHHHhcCCCcEEEEcCccccccCcCCccEEEEecCCCCCCCCCCcchhhhhhcccccCCCceEEEEEe
Q psy6850           1 MGKGPNTSSSSSLNSFTSCKEKVLITTNVLARGIDVEQVTIVINFDMPIDMNGQADCETYLHRIGRTGRFGKCGIAINLV   80 (118)
Q Consensus         1 Hg~l~~~~r~~~~~~F~~g~~~iLv~T~~~~~Gidi~~v~~VI~~~~p~~~~~~~~~~~y~qr~GR~gR~~~~g~~~~~~   80 (118)
                      ||+|++.+|.+++++|++|+++|||||+++++|+|+|++++||+||+|++...+.+...|+||+||+||.|+.|.+++|+
T Consensus        65 ~g~~~~~~R~~~~~~f~~g~~~vLvaT~~~~~Gid~~~~~~Vi~~d~p~~~~~~~~~~~~~qr~GR~gR~g~~g~~~~~~  144 (175)
T 2rb4_A           65 SGELTVEQRASIIQRFRDGKEKVLITTNVCARGIDVKQVTIVVNFDLPVKQGEEPDYETYLHRIGRTGRFGKKGLAFNMI  144 (175)
T ss_dssp             CSSCCHHHHHHHHHHHHTTSCSEEEECCSCCTTTCCTTEEEEEESSCCC--CCSCCHHHHHHHHCBC----CCEEEEEEE
T ss_pred             eCCCCHHHHHHHHHHHHcCCCeEEEEecchhcCCCcccCCEEEEeCCCCCccccCCHHHHHHHhcccccCCCCceEEEEE
Confidence            89999999999999999999999999999999999999999999999954444449999999999999999999999999


Q ss_pred             cCCcHHHHHHHHHHhCCCceecCCCChhhh
Q psy6850          81 DEHSVGVLKDIEKHFGKKIELLDTEDIDDE  110 (118)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  110 (118)
                      .+.+...+..+++.++..+++++.+..+.+
T Consensus       145 ~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~  174 (175)
T 2rb4_A          145 EVDELPSLMKIQDHFNSSIKQLNAEDMDEI  174 (175)
T ss_dssp             CGGGHHHHHHHHHHHTCCCEEECSSCCC--
T ss_pred             ccchHHHHHHHHHHhcCcccccCCchhccc
Confidence            999999999999999999999998776654
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 118
d2rb4a1168 c.37.1.19 (A:307-474) ATP-dependent RNA helicase D 4e-17
d1a1va2 299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 1e-16
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 2e-16
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 1e-15
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 1e-15
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 6e-14
d1gkub2248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 5e-11
d1s2ma2171 c.37.1.19 (A:252-422) Putative ATP-dependent RNA h 8e-10
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 2e-08
d1t5la2181 c.37.1.19 (A:415-595) Nucleotide excision repair e 3e-08
d1t5ia_168 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 3e-08
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 6e-07
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 7e-07
d2p6ra4201 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob 4e-06
d1c4oa2174 c.37.1.19 (A:410-583) Nucleotide excision repair e 8e-04
d1oywa3200 c.37.1.19 (A:207-406) RecQ helicase domain {Escher 0.001
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Length = 181 Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query118
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.97
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.97
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.97
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.97
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.96
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.95
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.95
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.92
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.91
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.89
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.86
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.83
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.82
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.81
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.79
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.79
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV) 99.6
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.33
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.3
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.28
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.15
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 98.51
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 97.43
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 95.92
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 95.14
d1m56d_42 Bacterial aa3 type cytochrome c oxidase subunit IV 81.62
d1qled_43 Bacterial aa3 type cytochrome c oxidase subunit IV 80.05
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Initiation factor 4a
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.97  E-value=1.7e-31  Score=178.05  Aligned_cols=101  Identities=43%  Similarity=0.804  Sum_probs=92.6

Q ss_pred             CCCCCHHHHHHHHHHHhcCCCcEEEEcCccccccCcCCccEEEEecCCCCCCCCCCcchhhhhhcccccCCCceEEEEEe
Q psy6850           1 MGKGPNTSSSSSLNSFTSCKEKVLITTNVLARGIDVEQVTIVINFDMPIDMNGQADCETYLHRIGRTGRFGKCGIAINLV   80 (118)
Q Consensus         1 Hg~l~~~~r~~~~~~F~~g~~~iLv~T~~~~~Gidi~~v~~VI~~~~p~~~~~~~~~~~y~qr~GR~gR~~~~g~~~~~~   80 (118)
                      ||+|++.+|.+++++|+.|+.+||||||++++|+|+|+|++|||||+|+      ++..|+||+||+||.|+.|.|++|+
T Consensus        58 ~~~~~~~~r~~~l~~f~~~~~~iLv~Tdv~~rGiDi~~v~~VI~~d~P~------~~~~yihR~GR~gR~g~~g~~i~~~  131 (162)
T d1fuka_          58 YSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPA------NKENYIHRIGRGGRFGRKGVAINFV  131 (162)
T ss_dssp             CTTSCHHHHHHHHHHHHTTSCSEEEEEGGGTTTCCCCSCSEEEESSCCS------SGGGGGGSSCSCC-----CEEEEEE
T ss_pred             ccCCchhhHHHHHHHHhhcccceeeccccccccccCCCceEEEEeccch------hHHHHHhhccccccCCCccEEEEEc
Confidence            8999999999999999999999999999999999999999999999999      9999999999999999999999999


Q ss_pred             cCCcHHHHHHHHHHhCCCceecCCCCh
Q psy6850          81 DEHSVGVLKDIEKHFGKKIELLDTEDI  107 (118)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~  107 (118)
                      ++.+...++.+++.++..++++|.+..
T Consensus       132 ~~~d~~~~~~i~~~~~~~~~~ip~~~~  158 (162)
T d1fuka_         132 TNEDVGAMRELEKFYSTQIEELPSDIA  158 (162)
T ss_dssp             ETTTHHHHHHHHHHSSCCCEECCSCCT
T ss_pred             CHHHHHHHHHHHHHHcCcCCCCChHHH
Confidence            999999999999999999999987543
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m56d_ f.23.8.1 (D:) Bacterial aa3 type cytochrome c oxidase subunit IV {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1qled_ f.23.8.1 (D:) Bacterial aa3 type cytochrome c oxidase subunit IV {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure