Psyllid ID: psy7015

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280----
MLLYHLTAMYLTVDLTDGPFQPYLWSGLPDSDWLALIIPIFAVPSSYTCYCIDGYTGVHCQTNWDECWSNPCHNGGSCIDGIAAYNCSCPPGYTGPSCESNVDECGSNPCQNNGTCHDLLNGFVCSCHPGFTGNCIDGIAAYNCSCPPGYTGPSCESNVDECGSNPCQNNGTCHDLLNGFVCSCHPGFTGWTGSLCQSATNECESSPCQNGGVCVDLHAAYTCACLFGFTGRNCDIELKICENSPCLNEALCLEEEEEQVCYCVPDYHGNRCQYQYDECQITPR
cccccccccccccccccccccccccccccccccccccccEEcccccEEEEccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccEEEcccccEEEEccccccEEEEcccccEEEEccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccccccccccccccccEEccccccEEEEccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccccccccc
cEEEEEccccccccccccccccccccccccccccccccEcEcccccEEEEccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccEEEEccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccccccccc
MLLYHLTAMYLtvdltdgpfqpylwsglpdsdwlALIIPifavpssytcycidgytgvhcqtnwdecwsnpchnggscidgiaayncscppgytgpscesnvdecgsnpcqnngtchdllngfvcschpgftgncidgiaayncscppgytgpscesnvdecgsnpcqnngtchdllngfvcschpgftgwtgslcqsatnecesspcqnggvcvdlHAAYTCAClfgftgrncdielkicenspclnealcleeeeeqvcycvpdyhgnrcqyqydecqitpr
MLLYHLTAMYLTVDLTDGPFQPYLWSGLPDSDWLALIIPIFAVPSSYTCYCIDGYTGVHCQTNWDECWSNPCHNGGSCIDGIAAYNCSCPPGYTGPSCESNVDECGSNPCQNNGTCHDLLNGFVCSCHPGFTGNCIDGIAAYNCSCPPGYTGPSCESNVDECGSNPCQNNGTCHDLLNGFVCSCHPGFTGWTGSLCQSATNECESSPCQNGGVCVDLHAAYTCACLFGFTGRNCDIELKICENSPCLNEALCLEEEEEQVCYCVPDYHGNRCQYQYDECQITPR
MLLYHLTAMYLTVDLTDGPFQPYLWSGLPDSDWLALIIPIFAVPSSYTCYCIDGYTGVHCQTNWDECWSNPCHNGGSCIDGIAAYNCSCPPGYTGPSCESNVDECGSNPCQNNGTCHDLLNGFVCSCHPGFTGNCIDGIAAYNCSCPPGYTGPSCESNVDECGSNPCQNNGTCHDLLNGFVCSCHPGFTGWTGSLCQSATNECESSPCQNGGVCVDLHAAYTCACLFGFTGRNCDIELKICENSPCLNEALCLeeeeeQVCYCVPDYHGNRCQYQYDECQITPR
*LLYHLTAMYLTVDLTDGPFQPYLWSGLPDSDWLALIIPIFAVPSSYTCYCIDGYTGVHCQTNWDECWSNPCHNGGSCIDGIAAYNCSCPPGYTGPSCESNVDECGSNPCQNNGTCHDLLNGFVCSCHPGFTGNCIDGIAAYNCSCPPGYTGPSCESNVDECGSNPCQNNGTCHDLLNGFVCSCHPGFTGWTGSLCQSATNECESSPCQNGGVCVDLHAAYTCACLFGFTGRNCDIELKICENSPCLNEALCLEEEEEQVCYCVPDYHGNRCQYQYDECQ****
MLLYHLTAMYLTVDLTDGPFQPYLWSGLPDSDWLALIIPIFAVPSSYTCYCIDGYTGVHCQTNWDECWSNPCHNGGSCIDGIAAYNCSCPPGYTGPSCESNVDECGSNPCQNNGTCHDLLNGFVCSCHPGFTGNCIDGIAAYNCSCPPGYTGPSCESNVDECGSNPCQNNGTCHDLLNGFVCSCHPGFTGWTGSLCQSATNECESSPCQNGGVCVDLHAAYTCACLFGFTGRNCDIELKICENSPCLNEALCLEEEEEQVCYCVPDYHGNRCQYQYDECQI***
MLLYHLTAMYLTVDLTDGPFQPYLWSGLPDSDWLALIIPIFAVPSSYTCYCIDGYTGVHCQTNWDECWSNPCHNGGSCIDGIAAYNCSCPPGYTGPSCESNVDECGSNPCQNNGTCHDLLNGFVCSCHPGFTGNCIDGIAAYNCSCPPGYTGPSCESNVDECGSNPCQNNGTCHDLLNGFVCSCHPGFTGWTGSLCQ***********QNGGVCVDLHAAYTCACLFGFTGRNCDIELKICENSPCLNEALCLEEEEEQVCYCVPDYHGNRCQYQYDECQITPR
MLLYHLTAMYLTVDLTDGPFQPYLWSGLPDSDWLALIIPIFAVPSSYTCYCIDGYTGVHCQTNWDECWSNPCHNGGSCIDGIAAYNCSCPPGYTGPSCESNVDECGSNPCQNNGTCHDLLNGFVCSCHPGFTGNCIDGIAAYNCSCPPGYTGPSCESNVDECGSNPCQNNGTCHDLLNGFVCSCHPGFTGWTGSLCQSATNECESSPCQNGGVCVDLHAAYTCACLFGFTGRNCDIELKICENSPCLNEALCLEEEEEQVCYCVPDYHGNRCQYQYDEC*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLYHLTAMYLTVDLTDGPFQPYLWSGLPDSDWLALIIPIFAVPSSYTCYCIDGYTGVHCQTNWDECWSNPCHNGGSCIDGIAAYNCSCPPGYTGPSCESNVDECGSNPCQNNGTCHDLLNGFVCSCHPGFTGNCIDGIAAYNCSCPPGYTGPSCESNVDECGSNPCQNNGTCHDLLNGFVCSCHPGFTGWTGSLCQSATNECESSPCQNGGVCVDLHAAYTCACLFGFTGRNCDIELKICENSPCLNEALCLEEEEEQVCYCVPDYHGNRCQYQYDECQITPR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query284 2.2.26 [Sep-21-2011]
P10079 1064 Fibropellin-1 OS=Strongyl no N/A 0.830 0.221 0.465 5e-58
P07207 2703 Neurogenic locus Notch pr yes N/A 0.834 0.087 0.465 7e-58
A0A1F4 2176 Protein eyes shut OS=Dros no N/A 0.697 0.090 0.476 7e-58
P46531 2555 Neurogenic locus notch ho yes N/A 0.841 0.093 0.393 3e-52
P21783 2524 Neurogenic locus notch pr N/A N/A 0.841 0.094 0.397 1e-51
Q01705 2531 Neurogenic locus notch ho yes N/A 0.823 0.092 0.437 3e-51
Q07008 2531 Neurogenic locus notch ho yes N/A 0.823 0.092 0.437 7e-51
P49013 570 Fibropellin-3 OS=Strongyl no N/A 0.795 0.396 0.415 9e-50
P46530 2437 Neurogenic locus notch ho no N/A 0.827 0.096 0.426 1e-49
O35516 2470 Neurogenic locus notch ho no N/A 0.816 0.093 0.405 5e-48
>sp|P10079|FBP1_STRPU Fibropellin-1 OS=Strongylocentrotus purpuratus GN=EGF1 PE=1 SV=2 Back     alignment and function desciption
 Score =  224 bits (571), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 120/258 (46%), Positives = 154/258 (59%), Gaps = 22/258 (8%)

Query: 45  SSYTCYCIDGYTGVHCQTNWDECWSNPCHNGGSCIDGIAAYNCSCPPGYTGPSCESNVDE 104
           + YTC C  G++G +C+ N DEC S PC NGG+C+D + AY C C PG+TGP+C  N+DE
Sbjct: 310 NGYTCSCPLGFSGDNCENNDDECSSIPCLNGGTCVDLVNAYMCVCAPGWTGPTCADNIDE 369

Query: 105 CGSNPCQNNGTCHDLLNGFVCSCHPGFT-------------------GNCIDGIAAYNCS 145
           C S PCQN G C D +NG++C C PG+T                   G+C+DG+  Y C 
Sbjct: 370 CASAPCQNGGVCIDGVNGYMCDCQPGYTGTHCETDIDECARPPCQNGGDCVDGVNGYVCI 429

Query: 146 CPPGYTGPSCESNVDECGSNPCQNNGTCHDLLNGFVCSCHPGFTGWTGSLCQSATNECES 205
           C PG+ G +CE+N+DEC S PCQN   C D +NGFVC+C  G+TG    LC++  NEC S
Sbjct: 430 CAPGFDGLNCENNIDECASRPCQNGAVCVDGVNGFVCTCSAGYTGV---LCETDINECAS 486

Query: 206 SPCQNGGVCVDLHAAYTCACLFGFTGRNCDIELKICENSPCLNEALCLEEEEEQVCYCVP 265
            PC NGGVC DL   Y C C  GF G NC+ +   C + PC N A C ++    VC CVP
Sbjct: 487 MPCLNGGVCTDLVNGYICTCAAGFEGTNCETDTDECASFPCQNGATCTDQVNGYVCTCVP 546

Query: 266 DYHGNRCQYQYDECQITP 283
            Y G  C+   +EC   P
Sbjct: 547 GYTGVLCETDINECASFP 564
Forms the apical lamina, a component of the extracellular matrix.
Strongylocentrotus purpuratus (taxid: 7668)
>sp|P07207|NOTCH_DROME Neurogenic locus Notch protein OS=Drosophila melanogaster GN=N PE=1 SV=3 Back     alignment and function description
>sp|A0A1F4|EYS_DROME Protein eyes shut OS=Drosophila melanogaster GN=eys PE=1 SV=1 Back     alignment and function description
>sp|P46531|NOTC1_HUMAN Neurogenic locus notch homolog protein 1 OS=Homo sapiens GN=NOTCH1 PE=1 SV=4 Back     alignment and function description
>sp|P21783|NOTCH_XENLA Neurogenic locus notch protein homolog OS=Xenopus laevis GN=notch1 PE=1 SV=3 Back     alignment and function description
>sp|Q01705|NOTC1_MOUSE Neurogenic locus notch homolog protein 1 OS=Mus musculus GN=Notch1 PE=1 SV=3 Back     alignment and function description
>sp|Q07008|NOTC1_RAT Neurogenic locus notch homolog protein 1 OS=Rattus norvegicus GN=Notch1 PE=2 SV=2 Back     alignment and function description
>sp|P49013|FBP3_STRPU Fibropellin-3 OS=Strongylocentrotus purpuratus GN=EGF3 PE=1 SV=1 Back     alignment and function description
>sp|P46530|NOTC1_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio GN=notch1a PE=2 SV=1 Back     alignment and function description
>sp|O35516|NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus GN=Notch2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query284
328785540 1174 PREDICTED: protein eyes shut-like [Apis 0.757 0.183 0.493 9e-60
170031853 1705 crumbs [Culex quinquefasciatus] gi|16787 0.859 0.143 0.445 1e-59
380022847 1039 PREDICTED: protein eyes shut-like [Apis 0.757 0.206 0.489 8e-59
390333862 3404 PREDICTED: fibrillin-2-like [Strongyloce 0.830 0.069 0.461 8e-59
307211937 1110 Protein eyes shut [Harpegnathos saltator 0.742 0.190 0.497 2e-58
390335924 1017 PREDICTED: fibropellin-1-like [Strongylo 0.823 0.230 0.492 2e-58
161466 760 fibropellin Ib [Strongylocentrotus purpu 0.830 0.310 0.465 2e-58
340723218 1180 PREDICTED: protein eyes shut-like [Bombu 0.75 0.180 0.489 4e-58
552260 482 putative epidermal growth factor [Strong 0.830 0.489 0.465 4e-58
260803838328 hypothetical protein BRAFLDRAFT_211833 [ 0.823 0.713 0.464 1e-57
>gi|328785540|ref|XP_001122168.2| PREDICTED: protein eyes shut-like [Apis mellifera] Back     alignment and taxonomy information
 Score =  236 bits (602), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 118/239 (49%), Positives = 155/239 (64%), Gaps = 24/239 (10%)

Query: 43  VPSSYTCYCIDGYTGVHCQTNWDECWSNPCHNGGSCIDGIAAYNCSCPPGYTGPSCESNV 102
           + S+Y+CYCIDGYTG++C+ NW++CWSNPC NGG+C D +AAYNC+C  G+ G +CE   
Sbjct: 49  INSTYSCYCIDGYTGINCEINWNDCWSNPCLNGGTCNDAVAAYNCTCAEGFVGINCEQKY 108

Query: 103 DECGSNPCQNNGTCHDLLNGFVCSCHPGFTGNCIDGIAAYNCSCPPGYTGPSCESNVDEC 162
            EC + PC NNGTC D                  DGI    C CP GY+G  CE +   C
Sbjct: 109 SECSNQPCLNNGTCLDY-----------------DGIT---CQCPDGYSGDYCEIDASVC 148

Query: 163 GSNPCQNNGTCHDLLN-GFVCSCHPGFTGWTGSLCQSATNECESSPCQNGGVCVDLHAAY 221
            +  C+N G C +     F C C     GWTG LC    NEC +SPC+NGG+C+++ A+Y
Sbjct: 149 NNTICKNGGECMEGPGFSFFCRCSE---GWTGRLCDEDINECLTSPCKNGGLCINIPASY 205

Query: 222 TCACLFGFTGRNCDIELKICENSPCLNEALCLEEEEEQVCYCVPDYHGNRCQYQYDECQ 280
           TCACLFG+TG++CD  +  CE +PC N A+CL E+E QVCYCVPDYHG  C+ +YD+C+
Sbjct: 206 TCACLFGYTGKDCDKTIVPCEENPCKNNAICLFEDEHQVCYCVPDYHGALCELKYDDCE 264

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|170031853|ref|XP_001843798.1| crumbs [Culex quinquefasciatus] gi|167871197|gb|EDS34580.1| crumbs [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|380022847|ref|XP_003695247.1| PREDICTED: protein eyes shut-like [Apis florea] Back     alignment and taxonomy information
>gi|390333862|ref|XP_780540.3| PREDICTED: fibrillin-2-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|307211937|gb|EFN87851.1| Protein eyes shut [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|390335924|ref|XP_001198702.2| PREDICTED: fibropellin-1-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|161466|gb|AAA62163.1| fibropellin Ib [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|340723218|ref|XP_003399990.1| PREDICTED: protein eyes shut-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|552260|gb|AAA30050.1| putative epidermal growth factor [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|260803838|ref|XP_002596796.1| hypothetical protein BRAFLDRAFT_211833 [Branchiostoma floridae] gi|229282056|gb|EEN52808.1| hypothetical protein BRAFLDRAFT_211833 [Branchiostoma floridae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query284
UNIPROTKB|G3I6Z6 2412 I79_019276 "Neurogenic locus n 0.823 0.097 0.437 5.2e-61
MGI|MGI:97363 2531 Notch1 "notch 1" [Mus musculus 0.823 0.092 0.437 5.6e-61
RGD|3187 2531 Notch1 "notch 1" [Rattus norve 0.823 0.092 0.437 1.2e-60
UNIPROTKB|Q07008 2531 Notch1 "Neurogenic locus notch 0.823 0.092 0.437 1.2e-60
UNIPROTKB|P46531 2555 NOTCH1 "Neurogenic locus notch 0.823 0.091 0.434 1.5e-60
UNIPROTKB|F1MSM3 2534 NOTCH1 "Uncharacterized protei 0.823 0.092 0.434 4e-60
FB|FBgn0004647 2703 N "Notch" [Drosophila melanoga 0.827 0.086 0.434 1.9e-59
UNIPROTKB|F1NZ70 2548 Gga.54229 "Uncharacterized pro 0.827 0.092 0.437 3.3e-58
UNIPROTKB|I3LVI7504 NOTCH2 "Uncharacterized protei 0.827 0.466 0.413 1.1e-57
UNIPROTKB|P21783 2524 notch1 "Neurogenic locus notch 0.827 0.093 0.416 1.6e-56
UNIPROTKB|G3I6Z6 I79_019276 "Neurogenic locus notch-like protein 1" [Cricetulus griseus (taxid:10029)] Back     alignment and assigned GO terms
 Score = 640 (230.4 bits), Expect = 5.2e-61, P = 5.2e-61
 Identities = 113/258 (43%), Positives = 150/258 (58%)

Query:    45 SSYTCYCIDGYTGVHCQTNWDECWSNPCHNGGSCIDGIAAYNCSCPPGYTGPSCESNVDE 104
             +++TC C  GYTG HC+TN +EC S PC +GG+C D   +Y C C  G TGP+CE N+D+
Sbjct:   543 ATFTCLCQPGYTGHHCETNINECHSQPCRHGGTCQDRDNSYLCLCLKGTTGPNCEINLDD 602

Query:   105 CGSNPCQNNGTCHDLLNGFVCSCHPGFTGN-------------------CIDGIAAYNCS 145
             C SNPC ++GTC D ++G+ C+C PG+TG+                   C DGIA + C 
Sbjct:   603 CASNPC-DSGTCLDKIDGYECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAGFTCR 661

Query:   146 CPPGYTGPSCESNVDECGSNPCQNNGTCHDLLNGFVCSCHPGFTGWTGSLCQSATNECES 205
             CP GY  P+C S V+EC SNPC + G C D LNG+ C C PG   W+G+ C    NECES
Sbjct:   662 CPEGYHDPTCLSEVNECNSNPCIH-GACRDGLNGYKCDCAPG---WSGTNCDINNNECES 717

Query:   206 SPCQNGGVCVDLHAAYTCACLFGFTGRNCDIELKICENSPCLNEALCLXXXXXQVCYCVP 265
             +PC NGG C D+ + Y C C  GF+G NC   +  C ++PCLN+  C+       C C  
Sbjct:   718 NPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCPL 777

Query:   266 DYHGNRCQYQYDECQITP 283
              Y G  C+     C  +P
Sbjct:   778 PYTGATCEVVLAPCATSP 795
GO:0000139 "Golgi membrane" evidence=TAS
GO:0005796 "Golgi lumen" evidence=TAS
MGI|MGI:97363 Notch1 "notch 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|3187 Notch1 "notch 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q07008 Notch1 "Neurogenic locus notch homolog protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P46531 NOTCH1 "Neurogenic locus notch homolog protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MSM3 NOTCH1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0004647 N "Notch" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1NZ70 Gga.54229 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|I3LVI7 NOTCH2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P21783 notch1 "Neurogenic locus notch protein homolog" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query284
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 2e-06
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 2e-06
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 2e-06
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 6e-06
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 6e-06
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 2e-05
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 9e-05
cd0005336 cd00053, EGF, Epidermal growth factor domain, foun 4e-04
cd0005336 cd00053, EGF, Epidermal growth factor domain, foun 6e-04
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 0.001
cd0005336 cd00053, EGF, Epidermal growth factor domain, foun 0.001
pfam0000832 pfam00008, EGF, EGF-like domain 0.003
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information 
 Score = 43.8 bits (104), Expect = 2e-06
 Identities = 22/36 (61%), Positives = 28/36 (77%), Gaps = 1/36 (2%)

Query: 65 DEC-WSNPCHNGGSCIDGIAAYNCSCPPGYTGPSCE 99
          DEC   NPC NGG+C++ + +Y CSCPPGYTG +CE
Sbjct: 3  DECASGNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38

Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements. Length = 38
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|238010 cd00053, EGF, Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>gnl|CDD|238010 cd00053, EGF, Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|238010 cd00053, EGF, Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>gnl|CDD|215652 pfam00008, EGF, EGF-like domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 284
KOG4289|consensus 2531 99.73
KOG1217|consensus 487 99.69
KOG1217|consensus487 99.64
KOG1219|consensus 4289 99.56
KOG1219|consensus 4289 99.53
KOG1214|consensus 1289 99.45
KOG1214|consensus 1289 99.4
KOG4289|consensus 2531 99.39
KOG1225|consensus 525 99.31
KOG1225|consensus 525 99.3
KOG4260|consensus350 99.0
KOG0994|consensus 1758 98.97
KOG4260|consensus350 98.95
KOG0994|consensus 1758 98.94
KOG1226|consensus 783 98.48
KOG1226|consensus 783 98.45
KOG1836|consensus 1705 98.17
PF0000832 EGF: EGF-like domain This is a sub-family of the P 98.07
smart0017939 EGF_CA Calcium-binding EGF-like domain. 98.06
PF0000832 EGF: EGF-like domain This is a sub-family of the P 97.96
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.93
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 97.89
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 97.77
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 97.75
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 97.61
cd0005336 EGF Epidermal growth factor domain, found in epide 97.38
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 97.38
smart0018135 EGF Epidermal growth factor-like domain. 97.35
cd0005336 EGF Epidermal growth factor domain, found in epide 97.35
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 97.33
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 97.26
smart0018135 EGF Epidermal growth factor-like domain. 97.23
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 97.21
KOG1836|consensus 1705 97.04
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 96.99
PF1266224 cEGF: Complement Clr-like EGF-like 96.95
PF1266224 cEGF: Complement Clr-like EGF-like 96.93
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 96.91
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 96.79
smart0005163 DSL delta serrate ligand. 95.6
KOG3512|consensus 592 95.59
KOG1218|consensus316 95.55
smart0005163 DSL delta serrate ligand. 94.28
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 93.86
KOG3512|consensus 592 93.43
KOG1218|consensus316 92.95
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 92.82
PF1294637 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 92.5
PHA02887126 EGF-like protein; Provisional 92.3
PHA03099139 epidermal growth factor-like protein (EGF-like pro 91.92
PF1294637 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 91.7
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 89.34
PF0005349 Laminin_EGF: Laminin EGF-like (Domains III and V); 89.34
PHA02887126 EGF-like protein; Provisional 88.52
cd0005550 EGF_Lam Laminin-type epidermal growth factor-like 87.88
PF0486356 EGF_alliinase: Alliinase EGF-like domain; InterPro 87.77
PF0141463 DSL: Delta serrate ligand; InterPro: IPR001774 Lig 87.7
PHA03099139 epidermal growth factor-like protein (EGF-like pro 85.91
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 84.04
PF0005349 Laminin_EGF: Laminin EGF-like (Domains III and V); 82.33
smart0018046 EGF_Lam Laminin-type epidermal growth factor-like 80.24
>KOG4289|consensus Back     alignment and domain information 
Probab=99.73  E-value=8.5e-17  Score=152.88  Aligned_cols=90  Identities=41%  Similarity=0.973  Sum_probs=79.9

Q ss_pred             cCCCceEEeCCCCCccCCCCCCCCCCCCCCCCCCCeEecCCCCeeeeCCCCCcCCCcccCC--CCCCCCCCCCCCEEeeC
Q psy7015          42 AVPSSYTCYCIDGYTGVHCQTNWDECWSNPCHNGGSCIDGIAAYNCSCPPGYTGPSCESNV--DECGSNPCQNNGTCHDL  119 (284)
Q Consensus        42 ~~~g~~~C~C~~G~~g~~C~~~~~~C~~~~C~~~g~C~~~~g~~~C~C~~G~~G~~C~~~~--~~C~~~~C~~~~~C~~~  119 (284)
                      ...++++|.|++||+|+.|+..+|.|...||.++|+|....|.|+|.|.+||+|..||.+.  ..|.+..|.++++|++.
T Consensus      1217 ~pvnglrCrCPpGFTgd~CeTeiDlCYs~pC~nng~C~srEggYtCeCrpg~tGehCEvs~~agrCvpGvC~nggtC~~~ 1296 (2531)
T KOG4289|consen 1217 HPVNGLRCRCPPGFTGDYCETEIDLCYSGPCGNNGRCRSREGGYTCECRPGFTGEHCEVSARAGRCVPGVCKNGGTCVNL 1296 (2531)
T ss_pred             cccCceeEeCCCCCCcccccchhHhhhcCCCCCCCceEEecCceeEEecCCccccceeeecccCccccceecCCCEEeec
Confidence            3457889999999999999999999999999999999999999999999999999998643  45788889999999976


Q ss_pred             C-CCceEeCCCCC
Q psy7015         120 L-NGFVCSCHPGF  131 (284)
Q Consensus       120 ~-~~~~C~C~~g~  131 (284)
                      . +++.|+|+.|-
T Consensus      1297 ~nggf~c~Cp~ge 1309 (2531)
T KOG4289|consen 1297 LNGGFCCHCPYGE 1309 (2531)
T ss_pred             CCCceeccCCCcc
Confidence            4 56888999873

>KOG1217|consensus Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>KOG3512|consensus Back     alignment and domain information
>KOG1218|consensus Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>KOG3512|consensus Back     alignment and domain information
>KOG1218|consensus Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein Back     alignment and domain information
>PHA02887 EGF-like protein; Provisional Back     alignment and domain information
>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional Back     alignment and domain information
>PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation Back     alignment and domain information
>PHA02887 EGF-like protein; Provisional Back     alignment and domain information
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>PF04863 EGF_alliinase: Alliinase EGF-like domain; InterPro: IPR006947 Allicin is a thiosulphinate that gives rise to dithiines, allyl sulphides and ajoenes, the three groups of active compounds in Allium species Back     alignment and domain information
>PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates Back     alignment and domain information
>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation Back     alignment and domain information
>smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query284
2vj3_A135 Human Notch-1 Egfs 11-13 Length = 135 4e-23
2vj3_A135 Human Notch-1 Egfs 11-13 Length = 135 8e-21
2vj3_A135 Human Notch-1 Egfs 11-13 Length = 135 1e-15
1toz_A116 Nmr Structure Of The Human Notch-1 Ligand Binding R 7e-23
1toz_A116 Nmr Structure Of The Human Notch-1 Ligand Binding R 2e-19
1toz_A116 Nmr Structure Of The Human Notch-1 Ligand Binding R 2e-15
4d90_A143 Crystal Structure Of Del-1 Egf Domains Length = 143 1e-15
4d90_A143 Crystal Structure Of Del-1 Egf Domains Length = 143 1e-09
1ezq_B134 Crystal Structure Of Human Coagulation Factor Xa Co 1e-06
1ezq_B134 Crystal Structure Of Human Coagulation Factor Xa Co 7e-06
1p0s_L138 Crystal Structure Of Blood Coagulation Factor Xa In 1e-06
1p0s_L138 Crystal Structure Of Blood Coagulation Factor Xa In 6e-06
2ygq_A324 Wif Domain-Epidermal Growth Factor (Egf)-Like Domai 1e-06
1ioe_L96 Human Coagulation Factor Xa In Complex With M55532 1e-06
1ioe_L96 Human Coagulation Factor Xa In Complex With M55532 8e-06
3ens_A94 Crystal Structure Of Human Fxa In Complex With Meth 2e-06
3ens_A94 Crystal Structure Of Human Fxa In Complex With Meth 8e-06
1g2l_B94 Factor Xa Inhibitor Complex Length = 94 2e-06
1g2l_B94 Factor Xa Inhibitor Complex Length = 94 8e-06
1nfu_B195 Crystal Structure Of Human Coagulation Factor Xa Co 2e-06
1nfu_B195 Crystal Structure Of Human Coagulation Factor Xa Co 5e-06
2h9e_L149 Crystal Structure Of FxaSELECTIDENAPC2 TERNARY COMP 3e-06
2h9e_L149 Crystal Structure Of FxaSELECTIDENAPC2 TERNARY COMP 5e-06
3h5c_B 317 X-Ray Structure Of Protein Z-Protein Z Inhibitor Co 6e-06
3h5c_B 317 X-Ray Structure Of Protein Z-Protein Z Inhibitor Co 3e-05
1fax_L96 Coagulation Factor Xa Inhibitor Complex Length = 96 7e-06
1fax_L96 Coagulation Factor Xa Inhibitor Complex Length = 96 7e-06
1xka_L95 Factor Xa Complexed With A Synthetic Inhibitor Fx-2 9e-06
1xka_L95 Factor Xa Complexed With A Synthetic Inhibitor Fx-2 5e-05
1w0y_L142 Tf7a_3771 Complex Length = 142 2e-05
1w0y_L142 Tf7a_3771 Complex Length = 142 9e-05
1z6j_L142 Crystal Structure Of A Ternary Complex Of Factor Vi 2e-05
1z6j_L142 Crystal Structure Of A Ternary Complex Of Factor Vi 9e-05
1o5d_L152 Dissecting And Designing Inhibitor Selectivity Dete 2e-05
1o5d_L152 Dissecting And Designing Inhibitor Selectivity Dete 8e-05
1dan_L152 Complex Of Active Site Inhibited Human Blood Coagul 3e-05
1dan_L152 Complex Of Active Site Inhibited Human Blood Coagul 8e-05
1dva_L101 Crystal Structure Of The Complex Between The Peptid 3e-05
1dva_L101 Crystal Structure Of The Complex Between The Peptid 8e-05
1f7e_A46 The First Egf-Like Domain From Human Blood Coagulat 4e-05
1f7e_A46 The First Egf-Like Domain From Human Blood Coagulat 8e-05
1j9c_L95 Crystal Structure Of Tissue Factor-Factor Viia Comp 5e-05
1j9c_L95 Crystal Structure Of Tissue Factor-Factor Viia Comp 1e-04
1emn_A82 Nmr Study Of A Pair Of Fibrillin Ca2+ Binding Epide 6e-05
1emn_A82 Nmr Study Of A Pair Of Fibrillin Ca2+ Binding Epide 4e-04
1edm_B39 Epidermal Growth Factor-Like Domain From Human Fact 7e-05
1edm_B39 Epidermal Growth Factor-Like Domain From Human Fact 2e-04
1bf9_A41 N-Terminal Egf-Like Domain From Human Factor Vii, N 9e-05
1qfk_L104 Structure Of Human Factor Viia And Its Implications 1e-04
2puq_L94 Crystal Structure Of Active Site Inhibited Coagulat 1e-04
2rqz_A38 Structure Of Sugar Modified Epidermal Growth Factor 3e-04
2rqz_A38 Structure Of Sugar Modified Epidermal Growth Factor 8e-04
2rqz_A38 Structure Of Sugar Modified Epidermal Growth Factor 8e-04
2vj2_A169 Human Jagged-1, Domains Dsl And Egfs1-3 Length = 16 5e-04
>pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 Back     alignment and structure 
Iteration: 1

 Score =  105 bits (261), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 61/137 (44%), Positives = 76/137 (55%), Gaps = 24/137 (17%)
Query: 63  NWDEC--WSNPCHNGGSCIDGIAAYNCSCPPGYTGPSCESNVDECGSNPCQNNGTCHDLL 120
           + DEC   +NPC + G CI+ + ++ C C  GYTGP CE +V+EC SNPCQN+ TC D  
Sbjct: 4   DVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLD-- 61
Query: 121 NGFVCSCHPGFTGNCIDGIAAYNCSCPPGYTGPSCESNVDECGSNPCQNNGTCHDLLNGF 180
                             I  + C C PGY G  CE N DEC S+PC +NG C D +N F
Sbjct: 62  -----------------QIGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEF 104
Query: 181 VCSCHPGFTGWTGSLCQ 197
            C C    TG+TG LCQ
Sbjct: 105 QCECP---TGFTGHLCQ 118
>pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 Back     alignment and structure
>pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 Back     alignment and structure
>pdb|1TOZ|A Chain A, Nmr Structure Of The Human Notch-1 Ligand Binding Region Length = 116 Back     alignment and structure
>pdb|1TOZ|A Chain A, Nmr Structure Of The Human Notch-1 Ligand Binding Region Length = 116 Back     alignment and structure
>pdb|1TOZ|A Chain A, Nmr Structure Of The Human Notch-1 Ligand Binding Region Length = 116 Back     alignment and structure
>pdb|4D90|A Chain A, Crystal Structure Of Del-1 Egf Domains Length = 143 Back     alignment and structure
>pdb|4D90|A Chain A, Crystal Structure Of Del-1 Egf Domains Length = 143 Back     alignment and structure
>pdb|1EZQ|B Chain B, Crystal Structure Of Human Coagulation Factor Xa Complexed With Rpr128515 Length = 134 Back     alignment and structure
>pdb|1EZQ|B Chain B, Crystal Structure Of Human Coagulation Factor Xa Complexed With Rpr128515 Length = 134 Back     alignment and structure
>pdb|1P0S|L Chain L, Crystal Structure Of Blood Coagulation Factor Xa In Complex With Ecotin M84r Length = 138 Back     alignment and structure
>pdb|1P0S|L Chain L, Crystal Structure Of Blood Coagulation Factor Xa In Complex With Ecotin M84r Length = 138 Back     alignment and structure
>pdb|2YGQ|A Chain A, Wif Domain-Epidermal Growth Factor (Egf)-Like Domains 1-3 Of Human Wnt Inhibitory Factor 1 In Complex With 1,2-Dipalmitoylphosphatidylcholine Length = 324 Back     alignment and structure
>pdb|1IOE|L Chain L, Human Coagulation Factor Xa In Complex With M55532 Length = 96 Back     alignment and structure
>pdb|1IOE|L Chain L, Human Coagulation Factor Xa In Complex With M55532 Length = 96 Back     alignment and structure
>pdb|3ENS|A Chain A, Crystal Structure Of Human Fxa In Complex With Methyl (2z)-3-[(3- Chloro-1h-indol-7-yl)amino]-2-cyano-3-{[(3s)-2-oxo-1-(2- oxo-2- Pyrrolidin-1-ylethyl)azepan-3-yl]amino}acrylate Length = 94 Back     alignment and structure
>pdb|3ENS|A Chain A, Crystal Structure Of Human Fxa In Complex With Methyl (2z)-3-[(3- Chloro-1h-indol-7-yl)amino]-2-cyano-3-{[(3s)-2-oxo-1-(2- oxo-2- Pyrrolidin-1-ylethyl)azepan-3-yl]amino}acrylate Length = 94 Back     alignment and structure
>pdb|1G2L|B Chain B, Factor Xa Inhibitor Complex Length = 94 Back     alignment and structure
>pdb|1G2L|B Chain B, Factor Xa Inhibitor Complex Length = 94 Back     alignment and structure
>pdb|1NFU|B Chain B, Crystal Structure Of Human Coagulation Factor Xa Complexed With Rpr132747 Length = 195 Back     alignment and structure
>pdb|1NFU|B Chain B, Crystal Structure Of Human Coagulation Factor Xa Complexed With Rpr132747 Length = 195 Back     alignment and structure
>pdb|2H9E|L Chain L, Crystal Structure Of FxaSELECTIDENAPC2 TERNARY COMPLEX Length = 149 Back     alignment and structure
>pdb|2H9E|L Chain L, Crystal Structure Of FxaSELECTIDENAPC2 TERNARY COMPLEX Length = 149 Back     alignment and structure
>pdb|3H5C|B Chain B, X-Ray Structure Of Protein Z-Protein Z Inhibitor Complex Length = 317 Back     alignment and structure
>pdb|3H5C|B Chain B, X-Ray Structure Of Protein Z-Protein Z Inhibitor Complex Length = 317 Back     alignment and structure
>pdb|1FAX|L Chain L, Coagulation Factor Xa Inhibitor Complex Length = 96 Back     alignment and structure
>pdb|1FAX|L Chain L, Coagulation Factor Xa Inhibitor Complex Length = 96 Back     alignment and structure
>pdb|1XKA|L Chain L, Factor Xa Complexed With A Synthetic Inhibitor Fx-2212a,(2s)-(3'- Amidino-3-Biphenylyl)-5-(4-Pyridylamino)pentanoic Acid Length = 95 Back     alignment and structure
>pdb|1XKA|L Chain L, Factor Xa Complexed With A Synthetic Inhibitor Fx-2212a,(2s)-(3'- Amidino-3-Biphenylyl)-5-(4-Pyridylamino)pentanoic Acid Length = 95 Back     alignment and structure
>pdb|1W0Y|L Chain L, Tf7a_3771 Complex Length = 142 Back     alignment and structure
>pdb|1W0Y|L Chain L, Tf7a_3771 Complex Length = 142 Back     alignment and structure
>pdb|1Z6J|L Chain L, Crystal Structure Of A Ternary Complex Of Factor Viia/tissue Factor/pyrazinone Inhibitor Length = 142 Back     alignment and structure
>pdb|1Z6J|L Chain L, Crystal Structure Of A Ternary Complex Of Factor Viia/tissue Factor/pyrazinone Inhibitor Length = 142 Back     alignment and structure
>pdb|1O5D|L Chain L, Dissecting And Designing Inhibitor Selectivity Determinants At The S1 Site Using An Artificial Ala190 Protease (Ala190 Upa) Length = 152 Back     alignment and structure
>pdb|1O5D|L Chain L, Dissecting And Designing Inhibitor Selectivity Determinants At The S1 Site Using An Artificial Ala190 Protease (Ala190 Upa) Length = 152 Back     alignment and structure
>pdb|1DAN|L Chain L, Complex Of Active Site Inhibited Human Blood Coagulation Factor Viia With Human Recombinant Soluble Tissue Factor Length = 152 Back     alignment and structure
>pdb|1DAN|L Chain L, Complex Of Active Site Inhibited Human Blood Coagulation Factor Viia With Human Recombinant Soluble Tissue Factor Length = 152 Back     alignment and structure
>pdb|1DVA|L Chain L, Crystal Structure Of The Complex Between The Peptide Exosite Inhibitor E-76 And Coagulation Factor Viia Length = 101 Back     alignment and structure
>pdb|1DVA|L Chain L, Crystal Structure Of The Complex Between The Peptide Exosite Inhibitor E-76 And Coagulation Factor Viia Length = 101 Back     alignment and structure
>pdb|1F7E|A Chain A, The First Egf-Like Domain From Human Blood Coagulation Fvii, Nmr, 20 Structures Length = 46 Back     alignment and structure
>pdb|1F7E|A Chain A, The First Egf-Like Domain From Human Blood Coagulation Fvii, Nmr, 20 Structures Length = 46 Back     alignment and structure
>pdb|1J9C|L Chain L, Crystal Structure Of Tissue Factor-Factor Viia Complex Length = 95 Back     alignment and structure
>pdb|1J9C|L Chain L, Crystal Structure Of Tissue Factor-Factor Viia Complex Length = 95 Back     alignment and structure
>pdb|1EMN|A Chain A, Nmr Study Of A Pair Of Fibrillin Ca2+ Binding Epidermal Growth Factor-Like Domains, Minimized Average Structure Length = 82 Back     alignment and structure
>pdb|1EMN|A Chain A, Nmr Study Of A Pair Of Fibrillin Ca2+ Binding Epidermal Growth Factor-Like Domains, Minimized Average Structure Length = 82 Back     alignment and structure
>pdb|1EDM|B Chain B, Epidermal Growth Factor-Like Domain From Human Factor Ix Length = 39 Back     alignment and structure
>pdb|1EDM|B Chain B, Epidermal Growth Factor-Like Domain From Human Factor Ix Length = 39 Back     alignment and structure
>pdb|1BF9|A Chain A, N-Terminal Egf-Like Domain From Human Factor Vii, Nmr, 23 Structures Length = 41 Back     alignment and structure
>pdb|1QFK|L Chain L, Structure Of Human Factor Viia And Its Implications For The Triggering Of Blood Coagulation Length = 104 Back     alignment and structure
>pdb|2PUQ|L Chain L, Crystal Structure Of Active Site Inhibited Coagulation Factor Viia In Complex With Soluble Tissue Factor Length = 94 Back     alignment and structure
>pdb|2RQZ|A Chain A, Structure Of Sugar Modified Epidermal Growth Factor-Like Repeat 12 Of Mouse Notch-1 Receptor Length = 38 Back     alignment and structure
>pdb|2RQZ|A Chain A, Structure Of Sugar Modified Epidermal Growth Factor-Like Repeat 12 Of Mouse Notch-1 Receptor Length = 38 Back     alignment and structure
>pdb|2RQZ|A Chain A, Structure Of Sugar Modified Epidermal Growth Factor-Like Repeat 12 Of Mouse Notch-1 Receptor Length = 38 Back     alignment and structure
>pdb|2VJ2|A Chain A, Human Jagged-1, Domains Dsl And Egfs1-3 Length = 169 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query284
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 1e-47
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 1e-43
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 5e-42
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 6e-34
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 2e-43
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 5e-31
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 4e-30
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 2e-40
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 7e-31
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 4e-28
2vh0_B134 Activated factor XA light chain; serine protease, 1e-37
2vh0_B134 Activated factor XA light chain; serine protease, 3e-35
2vh0_B134 Activated factor XA light chain; serine protease, 4e-31
2vh0_B134 Activated factor XA light chain; serine protease, 2e-26
2vh0_B134 Activated factor XA light chain; serine protease, 6e-22
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 7e-35
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 2e-32
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 4e-30
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 4e-33
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 6e-32
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 7e-28
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 2e-19
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 2e-32
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 5e-18
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 3e-32
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 4e-28
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 7e-25
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 1e-18
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 8e-05
1aut_L114 Activated protein C; serine proteinase, plasma cal 4e-22
1aut_L114 Activated protein C; serine proteinase, plasma cal 9e-18
1aut_L114 Activated protein C; serine proteinase, plasma cal 4e-17
1aut_L114 Activated protein C; serine proteinase, plasma cal 5e-12
1aut_L114 Activated protein C; serine proteinase, plasma cal 6e-04
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 4e-20
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 2e-11
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 4e-05
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 1e-18
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 9e-16
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 2e-11
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 1e-08
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 1e-17
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 1e-13
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 3e-10
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 4e-04
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 2e-16
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 5e-09
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 3e-05
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 6e-16
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 3e-13
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 1e-12
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 1e-12
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 2e-07
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 2e-15
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 1e-13
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 5e-12
3k6s_B 687 Integrin beta-2; cell receptor, adhesion molecule, 1e-05
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 5e-15
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 3e-13
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 3e-13
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 9e-08
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 6e-04
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 6e-15
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 3e-14
2bou_A143 EGF-like module containing mucin-like hormone rece 9e-14
2bou_A143 EGF-like module containing mucin-like hormone rece 5e-10
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 7e-13
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 4e-11
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 2e-10
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 3e-10
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 7e-12
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 7e-11
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 7e-09
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 8e-08
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 1e-06
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 2e-06
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 3e-06
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 5e-06
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 7e-06
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 1e-05
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 3e-05
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 1e-11
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 1e-06
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 7e-04
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 2e-10
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 1e-09
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 5e-10
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 3e-09
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 2e-07
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 2e-04
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 2e-09
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 3e-08
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 3e-08
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 5e-07
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 6e-09
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 4e-08
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 4e-06
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 5e-04
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 1e-08
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 4e-08
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 4e-06
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 1e-08
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 3e-08
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 2e-06
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 3e-07
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 2e-05
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 1e-06
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 3e-06
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 1e-04
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 2e-06
2f83_A 625 Coagulation factor XI; protease, apple domain, hyd 3e-06
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 8e-06
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 2e-04
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 1e-05
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 1e-05
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 1e-04
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 1e-05
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 1e-05
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 2e-04
4dur_A 791 Plasminogen, serine protease; fibrinolysis, hydrol 4e-05
3nxp_A 424 Prethrombin-1; allostery, blood coagulation, hydro 7e-05
3nxp_A 424 Prethrombin-1; allostery, blood coagulation, hydro 9e-05
3v65_B 386 Low-density lipoprotein receptor-related protein; 1e-04
3v65_B 386 Low-density lipoprotein receptor-related protein; 3e-04
3v65_B 386 Low-density lipoprotein receptor-related protein; 8e-04
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 1e-04
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 4e-04
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 7e-04
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 8e-04
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
 Score =  154 bits (391), Expect = 1e-47
 Identities = 56/150 (37%), Positives = 74/150 (49%), Gaps = 22/150 (14%)

Query: 63  NWDECWSNPCHNGGSCIDGIAAYNCSCPPGYTGPSCESNVDECGSNPCQNNGTCHDLLNG 122
           +     +NPC + G CI+ + ++ C C  GYTGP CE +V+EC SNPCQN+ TC D +  
Sbjct: 6   DECSLGANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGE 65

Query: 123 FVCSCHPGFTGNCIDGIAAYNCSCPPGYTGPSCESNVDECGSNPCQNNGTCHDLLNGFVC 182
                              + C C PGY G  CE N DEC S+PC +NG C D +N F C
Sbjct: 66  -------------------FQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQC 106

Query: 183 SCHPGFTGWTGSLCQSATNECESSPCQNGG 212
            C     G+TG LCQ   +    +      
Sbjct: 107 ECPT---GFTGHLCQVDLHHILDAQKMVWN 133
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Length = 267 Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Length = 267 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Length = 217 Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Length = 625 Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Length = 162 Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Length = 162 Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Length = 285 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Length = 157 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Length = 791 Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Length = 424 Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Length = 424 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Length = 463 Back     alignment and structure
>3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} Length = 164 Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Length = 53 Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Length = 553 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query284
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.92
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.87
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.86
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.85
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.84
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.83
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.83
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.81
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.8
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.79
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.78
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.77
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.73
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.69
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.67
2bou_A143 EGF-like module containing mucin-like hormone rece 99.66
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.63
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.61
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.6
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 99.6
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 99.6
2bou_A143 EGF-like module containing mucin-like hormone rece 99.58
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.53
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 99.51
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.5
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 99.47
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 99.46
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 99.44
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 99.44
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 99.39
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 99.36
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 99.35
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 99.31
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.28
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.28
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 99.25
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.2
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.2
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 99.19
2vh0_B134 Activated factor XA light chain; serine protease, 99.19
1aut_L114 Activated protein C; serine proteinase, plasma cal 99.19
1aut_L114 Activated protein C; serine proteinase, plasma cal 99.17
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 99.16
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 99.14
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 99.07
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 99.06
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 99.05
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 99.04
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 99.02
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 98.99
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.99
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 98.96
2vh0_B134 Activated factor XA light chain; serine protease, 98.96
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 98.94
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 98.94
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 98.88
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 98.76
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 98.69
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.68
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.68
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.66
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 98.61
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.6
1a3p_A45 Epidermal growth factor; disulfide connectivities, 98.55
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 98.52
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.5
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 98.46
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 98.45
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 98.45
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 98.43
1a3p_A45 Epidermal growth factor; disulfide connectivities, 98.39
3v65_B 386 Low-density lipoprotein receptor-related protein; 98.37
2k2s_B61 Micronemal protein 6; microneme protein complex, c 98.3
3v65_B 386 Low-density lipoprotein receptor-related protein; 98.3
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 98.29
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 98.26
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 98.24
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 98.13
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 98.1
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 98.09
2k2s_B61 Micronemal protein 6; microneme protein complex, c 98.09
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 97.99
1nql_B53 Epidermal growth factor; cell surface receptor, ty 97.88
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 97.78
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 97.67
1nql_B53 Epidermal growth factor; cell surface receptor, ty 97.64
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 97.54
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 97.53
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 97.3
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 97.26
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 97.07
1ob1_C99 Major merozoite surface protein; immune system, im 97.02
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 96.95
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 96.92
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 96.8
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 96.79
1ob1_C99 Major merozoite surface protein; immune system, im 96.73
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 96.69
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 96.68
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 96.67
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 96.67
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 96.57
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 96.51
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 96.45
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 96.38
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 96.37
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 96.33
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 96.33
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 96.29
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 96.28
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 96.2
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 96.18
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 96.09
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 96.06
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 96.02
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 96.01
1gl4_A 285 Nidogen-1, entactin; immunoglobulin-like domain, e 95.94
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 95.83
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 95.8
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 95.78
2i9a_A145 Urokinase-type plasminogen activator; growth facto 95.76
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 95.61
2i9a_A145 Urokinase-type plasminogen activator; growth facto 95.36
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 95.2
1szb_A170 Mannose binding lectin-associated serine protease- 94.98
2y38_A403 Laminin subunit alpha-5; structural protein, cell 94.62
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 94.57
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 94.57
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 94.55
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 94.53
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 94.43
2y38_A403 Laminin subunit alpha-5; structural protein, cell 94.28
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 94.2
1szb_A170 Mannose binding lectin-associated serine protease- 94.05
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 93.95
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 93.76
2e26_A 725 Reelin, reeler protein; signaling protein; HET: NA 93.65
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 93.65
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 93.64
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 93.5
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 92.83
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 91.34
2e26_A725 Reelin, reeler protein; signaling protein; HET: NA 90.63
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 90.52
1nzi_A159 Complement C1S component; calcium, innate immunity 88.76
2wph_E59 Coagulation factor IXA light chain; serine proteas 86.96
2wph_E59 Coagulation factor IXA light chain; serine proteas 85.77
1b9w_A95 Protein (merozoite surface protein 1); MSP-1, cand 85.66
1nzi_A159 Complement C1S component; calcium, innate immunity 83.55
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
Probab=99.92  E-value=1.1e-24  Score=164.70  Aligned_cols=123  Identities=37%  Similarity=0.928  Sum_probs=110.4

Q ss_pred             CCCCCC--CCCCCCCCEeccCCCCeeEeCCCCCccCCCCCccCCCCCCCCCCCCCCCEEeeCCCCeeeecCCCCccCCCc
Q psy7015         158 NVDECG--SNPCQNNGTCHDLLNGFVCSCHPGFTGWTGSLCQSATNECESSPCQNGGVCVDLHAAYTCACLFGFTGRNCD  235 (284)
Q Consensus       158 ~~~~C~--~~~C~~~~~C~~~~g~~~C~C~~g~~g~~~~~c~~~~~~C~~~~C~~~g~C~~~~g~~~C~C~~G~~g~~C~  235 (284)
                      ++++|.  .++|..+++|++..++|+|.|++||+|   ..|..++++|...+|.++++|++..++|+|.|++||+|..|+
T Consensus         4 dideC~~~~~~C~~~g~C~~~~g~~~C~C~~Gy~G---~~C~~~~~~C~~~~C~~~~~C~~~~g~~~C~C~~G~~G~~C~   80 (135)
T 2vj3_A            4 DVDECSLGANPCEHAGKCINTLGSFECQCLQGYTG---PRCEIDVNECVSNPCQNDATCLDQIGEFQCICMPGYEGVHCE   80 (135)
T ss_dssp             CCCTTTSSSCSSSTTCEEEECSSSEEEECCTTEES---TTSCEECCTTTTCCCCSSCEEEECSSCEEEECCTTEESSSSC
T ss_pred             ccccccCCCCCCCCCCEeECCCCCEEEECCCCCcC---CcccccCccCCCCCCCCCCEEeCCCCCceeeCCCCCcCCcce
Confidence            788897  678999999999999999999999998   778778899999999999999999999999999999999999


Q ss_pred             ccCCcCCCCCCCCCCEEeecCCCeeeecCCCCcCCCccccccccccCC
Q psy7015         236 IELKICENSPCLNEALCLEEEEEQVCYCVPDYHGNRCQYQYDECQITP  283 (284)
Q Consensus       236 ~~~~~C~~~~C~~~~~C~~~~~~~~C~C~~G~~G~~C~~~~~~C~~~~  283 (284)
                      .++++|...+|.++++|++..++|+|.|++||+|..|+++|+||..++
T Consensus        81 ~~~~~C~~~~C~~~g~C~~~~g~~~C~C~~G~~G~~C~~~i~~C~~~~  128 (135)
T 2vj3_A           81 VNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQVDLHHILDAQ  128 (135)
T ss_dssp             EECCTTTTCCSTTTCEEEECSSCEEEECCTTEESSSSCEECC------
T ss_pred             ecCCcccCCCcCCCCEeECCCCCeEEECCCCCcCCccCccCccccCCC
Confidence            888999999999999999999999999999999999999999998754
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>1b9w_A Protein (merozoite surface protein 1); MSP-1, candidate malaria vaccine, surface antigen; 1.80A {Plasmodium cynomolgi} SCOP: g.3.11.4 g.3.11.4 PDB: 2npr_A Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 284
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 1e-10
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 5e-09
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 2e-08
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 2e-08
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 5e-10
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 7e-09
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 1e-08
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 1e-08
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 6e-10
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 3e-09
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 1e-08
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 1e-08
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 2e-09
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 4e-08
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 4e-08
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 4e-08
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 3e-09
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 8e-08
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 9e-08
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 9e-08
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 3e-09
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 1e-07
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 6e-07
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 6e-07
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 9e-09
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 1e-07
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 6e-07
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 6e-07
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 1e-08
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 2e-08
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 2e-06
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 1e-05
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 5e-08
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 1e-06
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 1e-06
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 1e-06
d1tpga141 g.3.11.1 (A:51-91) Plasminogen activator (tissue-t 1e-06
d1tpga141 g.3.11.1 (A:51-91) Plasminogen activator (tissue-t 4e-05
d1tpga141 g.3.11.1 (A:51-91) Plasminogen activator (tissue-t 8e-05
d1tpga141 g.3.11.1 (A:51-91) Plasminogen activator (tissue-t 5e-04
d1autl148 g.3.11.1 (L:49-96) Activated protein c (autoprothr 2e-06
d1autl148 g.3.11.1 (L:49-96) Activated protein c (autoprothr 1e-05
d1autl148 g.3.11.1 (L:49-96) Activated protein c (autoprothr 3e-04
d1autl148 g.3.11.1 (L:49-96) Activated protein c (autoprothr 5e-04
d3egfa_53 g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse 1e-05
d3egfa_53 g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse 2e-04
d3egfa_53 g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse 4e-04
d3egfa_53 g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse 5e-04
d1cvua241 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG 3e-05
d1cvua241 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG 6e-05
d1cvua241 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG 3e-04
d1cvua241 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG 8e-04
d1nqlb_48 g.3.11.1 (B:) Epidermal growth factor, EGF {Human 3e-05
d1nqlb_48 g.3.11.1 (B:) Epidermal growth factor, EGF {Human 4e-04
d1nqlb_48 g.3.11.1 (B:) Epidermal growth factor, EGF {Human 6e-04
d1nqlb_48 g.3.11.1 (B:) Epidermal growth factor, EGF {Human 9e-04
d1q4ga242 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG 4e-05
d1q4ga242 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG 5e-05
d1q4ga242 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG 1e-04
d1q4ga242 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG 9e-04
d1ioxa_50 g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) 0.001
d1moxc_49 g.3.11.1 (C:) Transforming growth factor alpha {Hu 0.002
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 0.003
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 0.004
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Factor X, N-terminal module
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 53.5 bits (129), Expect = 1e-10
 Identities = 16/38 (42%), Positives = 23/38 (60%)

Query: 65  DECWSNPCHNGGSCIDGIAAYNCSCPPGYTGPSCESNV 102
           D+C ++PC N G C DG+  Y C+C  G+ G +CE   
Sbjct: 1   DQCETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCELFT 38
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 49 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query284
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.95
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.93
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.91
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.91
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.9
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.9
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.89
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.83
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 98.8
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 98.79
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 98.79
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 98.76
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.75
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 98.74
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.64
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.62
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 98.59
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.54
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 98.54
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 98.51
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 98.46
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 98.37
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 98.33
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 98.31
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.23
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 98.23
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 98.09
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.09
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.04
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.03
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 98.01
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.94
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.93
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 97.93
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 97.89
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.82
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.8
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.76
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 97.72
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 97.71
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 97.66
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.66
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 97.61
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 97.52
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 97.51
d1i0ua241 Low density lipoprotein (LDL) receptor, different 97.37
d1nt0a345 Mannose-binding protein associated serine protease 97.37
d1szba245 Mannose-binding protein associated serine protease 97.36
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 97.34
d1nt0a345 Mannose-binding protein associated serine protease 97.27
d1szba245 Mannose-binding protein associated serine protease 97.26
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 97.16
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 97.03
d3bpse140 Low density lipoprotein (LDL) receptor, different 96.98
d1i0ua241 Low density lipoprotein (LDL) receptor, different 96.93
d3bpse140 Low density lipoprotein (LDL) receptor, different 96.85
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 96.81
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 96.73
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 96.66
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 96.51
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 96.33
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 96.24
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 96.05
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 95.61
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 95.5
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 95.33
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 95.23
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 95.0
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 94.99
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 94.9
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 94.51
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 94.48
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 92.78
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 92.59
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 92.57
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 92.01
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 91.61
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 91.45
d1ijqa250 Low density lipoprotein (LDL) receptor, different 91.23
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 90.91
d1ijqa250 Low density lipoprotein (LDL) receptor, different 90.17
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 89.88
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 89.23
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Neurogenic locus notch homolog protein 1, Notch1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.95  E-value=3.3e-10  Score=63.34  Aligned_cols=37  Identities=49%  Similarity=1.188  Sum_probs=34.9

Q ss_pred             CCCCCCCCCCCCCeEecCCCCeeeeCCCCCcCCCccc
Q psy7015          64 WDECWSNPCHNGGSCIDGIAAYNCSCPPGYTGPSCES  100 (284)
Q Consensus        64 ~~~C~~~~C~~~g~C~~~~g~~~C~C~~G~~G~~C~~  100 (284)
                      ||+|.++||.++|+|++..++|+|.|++||+|+.|+.
T Consensus         1 Id~C~~~PC~n~g~C~~~~~~y~C~C~~G~~G~~Ce~   37 (39)
T d2vj3a2           1 VNECVSNPCQNDATCLDQIGEFQCICMPGYEGVHCEV   37 (39)
T ss_dssp             CCTTTTCCCCSSCEEEECSSCEEEECCTTEESSSSCE
T ss_pred             CcCCcCCCCCCCCEEECCCCCEEEeCCCCCccCcCee
Confidence            5889999999999999999999999999999999974
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure