Psyllid ID: psy7145

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-
MRYLLLCLYFVWLTSAHKYSTRVARTKYGPLRGILIQNPPVEAYLGVPYATPPLGSLRYMPPVTPSTWRAPRFADTYSAVCPQRLPDIGNRTEALLQLPRGRLVFLEKLLPLLSNQSEDCLYLNLYVPRPVALEGEKKEKKKNKNKNKKKKKKKKKKKKKKKKKKKKKKKTKKFLPPSDPSGKAGVKSREQ
ccHHHHHHHHHHHHHcccccccEEEcccEEEEEEEEccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccccccccccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccc
cHHHHHHHHHHHHHccccccccEEEEcccEEEEEEEccccEEEEEEcccccccccccccccccccccccccccccccccccccccHHcccccccHHcccccccccccEEEcccccccccccEEEEEEccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccc
MRYLLLCLYFVWLTSAHKYSTRVartkygplrgiliqnppveaylgvpyatpplgslrymppvtpstwraprfadtysavcpqrlpdignRTEALLQLPRGRLVFLEKLLPllsnqsedclylnlyvprpvalegekkeKKKNKNKNKKKKKKKKKKKKKKKKKKKkkkktkkflppsdpsgkagvksreq
MRYLLLCLYFVWLTSAHKYSTRVARTKYGPLRGILIQNPPVEAYLGVPYATPPLGSLRYMPPVTPSTWRAPRFADTYSAVCPQRLPDIGNRTEALLQLPRGRLVFLEKLLPLLSNQSEDCLYLNLYVPrpvalegekkekkknknknkkkkkkkkkkkkkkkkkkkkkkktkkflppsdpsgkagvksreq
MRYLLLCLYFVWLTSAHKYSTRVARTKYGPLRGILIQNPPVEAYLGVPYATPPLGSLRYMPPVTPSTWRAPRFADTYSAVCPQRLPDIGNRTEALLQLPRGRLVFLEKLLPLLSNQSEDCLYLNLYVPRPVALEGEkkekkknknknkkkkkkkkkkkkkkkkkkkkkkktkkFLPPSDPSGKAGVKSREQ
**YLLLCLYFVWLTSAHKYSTRVARTKYGPLRGILIQNPPVEAYLGVPYATPPLGSLRYMPPVTPSTWRAPRFADTYSAVCPQRLPDIGNRTEALLQLPRGRLVFLEKLLPLLSNQSEDCLYLNLYVPRPV************************************************************
MRYLLLCLYFVWLTSAHKYSTRVARTKYGPLRGILIQNPPVEAYLGVPYATPPLGSLRYMPPVTPSTWRAPRFADTYSAVCPQRLPDIGNRTEALLQLPRGRLVFLEKLLPLLSNQSEDCLYLNLYV****************************************************************
MRYLLLCLYFVWLTSAHKYSTRVARTKYGPLRGILIQNPPVEAYLGVPYATPPLGSLRYMPPVTPSTWRAPRFADTYSAVCPQRLPDIGNRTEALLQLPRGRLVFLEKLLPLLSNQSEDCLYLNLYVPRPVALEGE*******************************************************
MRYLLLCLYFVWLTSAHKYSTRVARTKYGPLRGILIQNPPVEAYLGVPYATPPLGSLRYMPPVTPSTWRAPRFADTYSAVCPQRLPDIGNRTEALLQLPRGRLVFLEKLLPLLSNQSEDCLYLNLYVPRPV************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRYLLLCLYFVWLTSAHKYSTRVARTKYGPLRGILIQNPPVEAYLGVPYATPPLGSLRYMPPVTPSTWRAPRFADTYSAVCPQRLPDIGNRTEALLQLPRGRLVFLEKLLPLLSNQSEDCLYLNLYVPRPVAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFLPPSDPSGKAGVKSREQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query191 2.2.26 [Sep-21-2011]
Q8NFZ3 816 Neuroligin-4, Y-linked OS no N/A 0.617 0.144 0.421 2e-19
Q8N0W4 816 Neuroligin-4, X-linked OS no N/A 0.617 0.144 0.414 5e-19
B0F2B4 945 Neuroligin 4-like OS=Mus yes N/A 0.528 0.106 0.451 9e-19
Q9NZ94 848 Neuroligin-3 OS=Homo sapi no N/A 0.780 0.175 0.349 3e-16
Q8NFZ4 835 Neuroligin-2 OS=Homo sapi no N/A 0.534 0.122 0.450 3e-16
Q69ZK9 836 Neuroligin-2 OS=Mus muscu yes N/A 0.534 0.122 0.450 3e-16
Q62888 836 Neuroligin-2 OS=Rattus no yes N/A 0.534 0.122 0.450 3e-16
Q62889 848 Neuroligin-3 OS=Rattus no no N/A 0.780 0.175 0.343 6e-16
Q8N2Q7 840 Neuroligin-1 OS=Homo sapi no N/A 0.638 0.145 0.389 2e-15
Q8BYM5 825 Neuroligin-3 OS=Mus muscu no N/A 0.623 0.144 0.363 4e-15
>sp|Q8NFZ3|NLGNY_HUMAN Neuroligin-4, Y-linked OS=Homo sapiens GN=NLGN4Y PE=2 SV=1 Back     alignment and function desciption
 Score = 95.5 bits (236), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 54/128 (42%), Positives = 72/128 (56%), Gaps = 10/128 (7%)

Query: 6   LCLYFVWLTSAHKYSTRVARTKYGPLRGILIQNP-----PVEAYLGVPYATPPLGSLRYM 60
           L + F  + S  +Y   V  T YG ++G+    P     PVE YLGVPYA+PP G  R+ 
Sbjct: 32  LAIKFTLIDSQAQYP--VVNTNYGKIQGLRTPLPSEILGPVEQYLGVPYASPPTGERRFQ 89

Query: 61  PPVTPSTWRAPRFADTYSAVCPQRLPDIGNRTEALLQLPRGRLVFLEKLLPLLSNQSEDC 120
           PP +PS+W   R A  +SAVCPQ L +   R      LP      L+ L+  + +Q+EDC
Sbjct: 90  PPESPSSWTGIRNATQFSAVCPQHLDE---RFLLHDMLPIWFTTSLDTLMTYVQDQNEDC 146

Query: 121 LYLNLYVP 128
           LYLN+YVP
Sbjct: 147 LYLNIYVP 154
Putative neuronal cell surface protein involved in cell-cell-interactions.
Homo sapiens (taxid: 9606)
>sp|Q8N0W4|NLGNX_HUMAN Neuroligin-4, X-linked OS=Homo sapiens GN=NLGN4X PE=1 SV=1 Back     alignment and function description
>sp|B0F2B4|NLGN4_MOUSE Neuroligin 4-like OS=Mus musculus GN=Nlgn4l PE=1 SV=1 Back     alignment and function description
>sp|Q9NZ94|NLGN3_HUMAN Neuroligin-3 OS=Homo sapiens GN=NLGN3 PE=1 SV=2 Back     alignment and function description
>sp|Q8NFZ4|NLGN2_HUMAN Neuroligin-2 OS=Homo sapiens GN=NLGN2 PE=1 SV=1 Back     alignment and function description
>sp|Q69ZK9|NLGN2_MOUSE Neuroligin-2 OS=Mus musculus GN=Nlgn2 PE=1 SV=2 Back     alignment and function description
>sp|Q62888|NLGN2_RAT Neuroligin-2 OS=Rattus norvegicus GN=Nlgn2 PE=1 SV=1 Back     alignment and function description
>sp|Q62889|NLGN3_RAT Neuroligin-3 OS=Rattus norvegicus GN=Nlgn3 PE=1 SV=1 Back     alignment and function description
>sp|Q8N2Q7|NLGN1_HUMAN Neuroligin-1 OS=Homo sapiens GN=NLGN1 PE=1 SV=2 Back     alignment and function description
>sp|Q8BYM5|NLGN3_MOUSE Neuroligin-3 OS=Mus musculus GN=Nlgn3 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
189237858 907 PREDICTED: similar to GA12514-PA [Tribol 0.643 0.135 0.75 6e-43
242005657197 neuroligin, putative [Pediculus humanus 0.675 0.654 0.691 3e-42
270006725196 hypothetical protein TcasGA2_TC013093 [T 0.596 0.581 0.791 5e-42
357626268 927 hypothetical protein KGM_09844 [Danaus p 0.638 0.131 0.672 2e-39
157104438 812 neuroligin, putative [Aedes aegypti] gi| 0.586 0.137 0.675 2e-37
195471645 1244 GE14187 [Drosophila yakuba] gi|194174214 0.670 0.102 0.533 2e-35
194862710 1249 GG10441 [Drosophila erecta] gi|190661951 0.670 0.102 0.533 2e-35
195052261 1253 GH13719 [Drosophila grimshawi] gi|193900 0.581 0.088 0.625 3e-35
195117188 1172 GI24029 [Drosophila mojavensis] gi|19391 0.581 0.094 0.625 4e-35
195338773 1249 GM16237 [Drosophila sechellia] gi|194129 0.670 0.102 0.533 4e-35
>gi|189237858|ref|XP_974989.2| PREDICTED: similar to GA12514-PA [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  179 bits (453), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 105/124 (84%), Gaps = 1/124 (0%)

Query: 16  AHKYSTRVARTKYGPLRGILIQ-NPPVEAYLGVPYATPPLGSLRYMPPVTPSTWRAPRFA 74
            HKYSTRV RTKYGPLRG++I  NPPVEA+LGVPYATPP+GSLRYMPPVTPS W+  R A
Sbjct: 42  VHKYSTRVVRTKYGPLRGVMIHINPPVEAFLGVPYATPPVGSLRYMPPVTPSIWKNTRLA 101

Query: 75  DTYSAVCPQRLPDIGNRTEALLQLPRGRLVFLEKLLPLLSNQSEDCLYLNLYVPRPVALE 134
           D + AVCPQR PDIGNR+EALL+ PRGRL++LEKLLPLL+N+SEDCLYLNLYVPR    E
Sbjct: 102 DRFGAVCPQRPPDIGNRSEALLEFPRGRLLYLEKLLPLLANESEDCLYLNLYVPRTATGE 161

Query: 135 GEKK 138
            E  
Sbjct: 162 EETN 165

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|242005657|ref|XP_002423680.1| neuroligin, putative [Pediculus humanus corporis] gi|212506849|gb|EEB10942.1| neuroligin, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|270006725|gb|EFA03173.1| hypothetical protein TcasGA2_TC013093 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|357626268|gb|EHJ76417.1| hypothetical protein KGM_09844 [Danaus plexippus] Back     alignment and taxonomy information
>gi|157104438|ref|XP_001648408.1| neuroligin, putative [Aedes aegypti] gi|108869198|gb|EAT33423.1| AAEL014303-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|195471645|ref|XP_002088113.1| GE14187 [Drosophila yakuba] gi|194174214|gb|EDW87825.1| GE14187 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|194862710|ref|XP_001970084.1| GG10441 [Drosophila erecta] gi|190661951|gb|EDV59143.1| GG10441 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195052261|ref|XP_001993267.1| GH13719 [Drosophila grimshawi] gi|193900326|gb|EDV99192.1| GH13719 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195117188|ref|XP_002003131.1| GI24029 [Drosophila mojavensis] gi|193913706|gb|EDW12573.1| GI24029 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195338773|ref|XP_002035998.1| GM16237 [Drosophila sechellia] gi|194129878|gb|EDW51921.1| GM16237 [Drosophila sechellia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
FB|FBgn0031866 1248 neuroligin "neuroligin" [Droso 0.649 0.099 0.573 1.7e-32
FB|FBgn0083963 1159 CG34127 [Drosophila melanogast 0.570 0.094 0.552 3.3e-30
FB|FBgn0083975 1281 CG34139 [Drosophila melanogast 0.560 0.083 0.504 6.5e-25
UNIPROTKB|F1Q335 816 NLGN4X "Uncharacterized protei 0.617 0.144 0.421 8.4e-19
UNIPROTKB|F1SG28 816 LOC100624109 "Uncharacterized 0.617 0.144 0.421 1.1e-18
UNIPROTKB|Q8NFZ3 816 NLGN4Y "Neuroligin-4, Y-linked 0.617 0.144 0.421 1.4e-18
UNIPROTKB|B4DHI3 836 NLGN4Y "Neuroligin-4, Y-linked 0.617 0.141 0.421 1.4e-18
UNIPROTKB|A6NMU8 873 NLGN4Y "Neuroligin 4, Y-linked 0.617 0.135 0.421 1.5e-18
UNIPROTKB|Q8N0W4 816 NLGN4X "Neuroligin-4, X-linked 0.617 0.144 0.414 2.9e-18
UNIPROTKB|F1NGC1 609 NLGN4X "Uncharacterized protei 0.539 0.169 0.441 1.2e-17
FB|FBgn0031866 neuroligin "neuroligin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 368 (134.6 bits), Expect = 1.7e-32, P = 1.7e-32
 Identities = 74/129 (57%), Positives = 94/129 (72%)

Query:     4 LLLCLYFVW---LTSAHKYSTRVARTKYGPLRGILIQNPP-VEAYLGVPYATPPLGSLRY 59
             +LL L  +W       H  S  V +TKYG LRGI++++ P VEA+LG+PYA+PP+GSLR+
Sbjct:   163 VLLLLTSLWPDCCECLHGGSNTV-KTKYGLLRGIVVRSSPLVEAFLGIPYASPPVGSLRF 221

Query:    60 MPPVTPSTWRAPRFADTYSAVCPQRLPDIGNRTEALLQLPRGRLVFLEKLLPLLSNQSED 119
             MPP+TPSTW+  R AD +S VCPQ +P   N  EALL++PR RL  L +LLPLL NQSED
Sbjct:   222 MPPITPSTWKTVRSADRFSPVCPQNIPIPPNGPEALLEVPRARLAQLRRLLPLLKNQSED 281

Query:   120 CLYLNLYVP 128
             CL LN+YVP
Sbjct:   282 CLCLNIYVP 290
GO:0004091 "carboxylesterase activity" evidence=IKR;NAS
GO:0042043 "neurexin family protein binding" evidence=ISS;IBA
GO:0060074 "synapse maturation" evidence=IMP
GO:0050808 "synapse organization" evidence=IMP
GO:0045202 "synapse" evidence=IBA
GO:0009986 "cell surface" evidence=IBA
GO:0004872 "receptor activity" evidence=IBA
GO:0007416 "synapse assembly" evidence=IBA
GO:0005887 "integral to plasma membrane" evidence=IBA
FB|FBgn0083963 CG34127 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0083975 CG34139 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q335 NLGN4X "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SG28 LOC100624109 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NFZ3 NLGN4Y "Neuroligin-4, Y-linked" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B4DHI3 NLGN4Y "Neuroligin-4, Y-linked" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A6NMU8 NLGN4Y "Neuroligin 4, Y-linked, isoform CRA_c" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N0W4 NLGN4X "Neuroligin-4, X-linked" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NGC1 NLGN4X "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
pfam00135 510 pfam00135, COesterase, Carboxylesterase family 1e-24
cd00312 493 cd00312, Esterase_lipase, Esterases and lipases (i 8e-21
COG2272 491 COG2272, PnbA, Carboxylesterase type B [Lipid meta 3e-20
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 4e-09
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 5e-07
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 6e-06
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 7e-06
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 7e-06
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 2e-05
PTZ00372 413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 2e-05
pfam05764 238 pfam05764, YL1, YL1 nuclear protein 2e-05
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 3e-05
pfam09468287 pfam09468, RNase_H2-Ydr279, Ydr279p protein family 6e-05
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 7e-05
pfam08597 242 pfam08597, eIF3_subunit, Translation initiation fa 7e-05
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 8e-05
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 8e-05
PRK07561859 PRK07561, PRK07561, DNA topoisomerase I subunit om 9e-05
PTZ00372 413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 1e-04
PRK07561859 PRK07561, PRK07561, DNA topoisomerase I subunit om 1e-04
pfam06658142 pfam06658, DUF1168, Protein of unknown function (D 1e-04
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 2e-04
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 2e-04
PTZ00074135 PTZ00074, PTZ00074, 60S ribosomal protein L34; Pro 2e-04
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 3e-04
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 4e-04
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 5e-04
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 5e-04
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 5e-04
PRK06319860 PRK06319, PRK06319, DNA topoisomerase I/SWI domain 6e-04
PRK04195482 PRK04195, PRK04195, replication factor C large sub 6e-04
pfam08597 242 pfam08597, eIF3_subunit, Translation initiation fa 7e-04
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 7e-04
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 7e-04
PRK04195482 PRK04195, PRK04195, replication factor C large sub 7e-04
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 8e-04
PRK04195482 PRK04195, PRK04195, replication factor C large sub 8e-04
pfam06658142 pfam06658, DUF1168, Protein of unknown function (D 0.001
pfam06658142 pfam06658, DUF1168, Protein of unknown function (D 0.001
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.001
PRK04950213 PRK04950, PRK04950, ProP expression regulator; Pro 0.001
PRK04950213 PRK04950, PRK04950, ProP expression regulator; Pro 0.001
PRK11778 330 PRK11778, PRK11778, putative inner membrane peptid 0.001
PTZ00399651 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro 0.001
pfam09468287 pfam09468, RNase_H2-Ydr279, Ydr279p protein family 0.002
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 0.002
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.002
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.002
PRK04950213 PRK04950, PRK04950, ProP expression regulator; Pro 0.002
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 0.002
cd09270211 cd09270, RNase_H2-B, Ribonuclease H2-B is a subuni 0.002
CHL00189 742 CHL00189, infB, translation initiation factor 2; P 0.002
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 0.003
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 0.003
pfam11208132 pfam11208, DUF2992, Protein of unknown function (D 0.003
PRK04950213 PRK04950, PRK04950, ProP expression regulator; Pro 0.004
PRK11778 330 PRK11778, PRK11778, putative inner membrane peptid 0.004
pfam10278178 pfam10278, Med19, Mediator of RNA pol II transcrip 0.004
PTZ00053 470 PTZ00053, PTZ00053, methionine aminopeptidase 2; P 0.004
>gnl|CDD|215741 pfam00135, COesterase, Carboxylesterase family Back     alignment and domain information 
 Score = 99.3 bits (248), Expect = 1e-24
 Identities = 37/110 (33%), Positives = 46/110 (41%), Gaps = 20/110 (18%)

Query: 23  VARTKYGPLRGILIQ--NPPVEAYLGVPYATPPLGSLRYMPPVTPSTWRAPRFADTYSAV 80
           V  T YG +RG+ +     PV A+LG+PYA PP+G LR+  P  P  W     A  Y   
Sbjct: 2   VVETSYGKVRGLRVTVDGGPVYAFLGIPYAKPPVGELRFKKPQPPEPWTGVLDATKYGPA 61

Query: 81  CPQRLPDIGNRTEALLQLPRGRLVFLEKLLPLLSNQSEDCLYLNLYVPRP 130
           CPQ                                 SEDCLYLN+Y P+ 
Sbjct: 62  CPQNNDLGSEMWNKNT------------------GMSEDCLYLNVYTPKL 93

Length = 510
>gnl|CDD|238191 cd00312, Esterase_lipase, Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>gnl|CDD|225181 COG2272, PnbA, Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated Back     alignment and domain information
>gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|185429 PTZ00074, PTZ00074, 60S ribosomal protein L34; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|235778 PRK06319, PRK06319, DNA topoisomerase I/SWI domain fusion protein; Validated Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) Back     alignment and domain information
>gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional Back     alignment and domain information
>gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional Back     alignment and domain information
>gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional Back     alignment and domain information
>gnl|CDD|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional Back     alignment and domain information
>gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|187751 cd09270, RNase_H2-B, Ribonuclease H2-B is a subunit of the eukaryotic RNase H complex which cleaves RNA-DNA hybrids Back     alignment and domain information
>gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|221028 pfam11208, DUF2992, Protein of unknown function (DUF2992) Back     alignment and domain information
>gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional Back     alignment and domain information
>gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional Back     alignment and domain information
>gnl|CDD|150884 pfam10278, Med19, Mediator of RNA pol II transcription subunit 19 Back     alignment and domain information
>gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 191
PF00135 535 COesterase: Carboxylesterase family The prints ent 99.95
KOG4389|consensus 601 99.92
COG2272 491 PnbA Carboxylesterase type B [Lipid metabolism] 99.91
cd00312 493 Esterase_lipase Esterases and lipases (includes fu 99.9
KOG1516|consensus 545 99.86
PF10278178 Med19: Mediator of RNA pol II transcription subuni 88.25
PF10278178 Med19: Mediator of RNA pol II transcription subuni 86.03
>PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases Back     alignment and domain information 
Probab=99.95  E-value=1e-28  Score=224.12  Aligned_cols=118  Identities=40%  Similarity=0.734  Sum_probs=68.7

Q ss_pred             ChHHHHHHHHHHHhhh--ccCCCcEEEcCceeEEEEEec--C-CCeeEEecccccCCCCCCCCCCCCCCCCCCCCccccc
Q psy7145           1 MRYLLLCLYFVWLTSA--HKYSTRVARTKYGPLRGILIQ--N-PPVEAYLGVPYATPPLGSLRYMPPVTPSTWRAPRFAD   75 (191)
Q Consensus         1 M~~lll~l~l~~~~~~--~~~~~p~V~t~~G~v~G~~~~--~-~~V~~FlGIPYA~pP~G~lRF~~P~p~~~w~g~~dAt   75 (191)
                      |++++|+++++++...  ...+.++|+|.+|.|+|....  + .+|++|+|||||+||+|++||++|+++.+|+++++||
T Consensus         1 ~~~~~~~~l~~~~~~~~~~~~~~~~v~~~~g~i~G~~~~~~~~~~v~~f~gIpYA~pP~g~~Rf~~p~~~~~~~~~~~a~   80 (535)
T PF00135_consen    1 MKLLLLLLLLLALFASSQAQASSPVVTTSYGKIRGIRVNTDDGKGVYSFLGIPYAQPPVGELRFRPPQPPPPWSGVRDAT   80 (535)
T ss_dssp             -----------------ECCSTCCEEEETTEEEEEEEEEESTCCEEEEEEEEESSE---GGGTTS--EB--S-SSEEETB
T ss_pred             CchHHHHHHHHHHHHHhcccCCCCEEEECCeEEEeEEEecCCCcceEEEeCcccCCCCCCCcccccccccccchhhhhhh
Confidence            7777766666555443  344678999999999997654  3 4799999999999999999999999999999999999


Q ss_pred             cCCCCCCCCCCCCCchhhhhhcCCcchhhhhhhhcCCCCCCCccchhcccccCCCCCCcc
Q psy7145          76 TYSAVCPQRLPDIGNRTEALLQLPRGRLVFLEKLLPLLSNQSEDCLYLNLYVPRPVALEG  135 (191)
Q Consensus        76 ~~gp~CpQ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~sEDCL~LNI~tP~~a~~~~  135 (191)
                      .+|+.|||.......  .               .......+||||||||||+|..+..++
T Consensus        81 ~~~~~C~Q~~~~~~~--~---------------~~~~~~~~sEDCL~LnI~~P~~~~~~~  123 (535)
T PF00135_consen   81 KYGPACPQPPPPGPS--P---------------GFNPPVGQSEDCLYLNIYTPSNASSNS  123 (535)
T ss_dssp             S---BESCECTTSSH--H---------------HCSHSSHBES---EEEEEEETSSSSTT
T ss_pred             hcccccccccccccc--c---------------ccccccCCCchHHHHhhhhcccccccc
Confidence            999999998753310  0               000112369999999999999887653

Among the different types are those which act on carboxylic esters (3.1.1 from EC). Carboxyl-esterases have been classified into three categories (A, B and C) on the basis of differential patterns of inhibition by organophosphates. The sequence of a number of type-B carboxylesterases indicates [, , ] that the majority are evolutionary related. As is the case for lipases and serine proteases, the catalytic apparatus of esterases involves three residues (catalytic triad): a serine, a glutamate or aspartate and a histidine.; PDB: 3B3Q_A 1CLE_B 1GQS_A 2VJD_A 1HBJ_A 2C5G_A 1U65_A 2WG1_A 1FSS_A 3M3D_A ....
>KOG4389|consensus Back     alignment and domain information
>COG2272 PnbA Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>KOG1516|consensus Back     alignment and domain information
>PF10278 Med19: Mediator of RNA pol II transcription subunit 19 ; InterPro: IPR019403 The Mediator complex is a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes Back     alignment and domain information
>PF10278 Med19: Mediator of RNA pol II transcription subunit 19 ; InterPro: IPR019403 The Mediator complex is a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
3be8_A 588 Crystal Structure Of The Synaptic Protein Neuroligi 2e-19
3bl8_A 580 Crystal Structure Of The Extracellular Domain Of Ne 5e-16
3biw_A 574 Crystal Structure Of The Neuroligin-1NEUREXIN-1beta 1e-14
3vkf_A 585 Crystal Structure Of Neurexin 1betaNEUROLIGIN 1 COM 1e-14
3b3q_A 577 Crystal Structure Of A Synaptic Adhesion Complex Le 1e-14
2jgj_B 535 Crystal Structure Of Mouse Acetylcholinesterase Inh 9e-11
3dl7_A 538 Aged Form Of Mouse Acetylcholinesterase Inhibited B 9e-11
2jge_B 533 Crystal Structure Of Mouse Acetylcholinesterase Inh 9e-11
2jge_A 536 Crystal Structure Of Mouse Acetylcholinesterase Inh 9e-11
3dl7_B 534 Aged Form Of Mouse Acetylcholinesterase Inhibited B 9e-11
1mah_A 543 Fasciculin2-Mouse Acetylcholinesterase Complex Leng 1e-10
2ha4_A 543 Crystal Structure Of Mutant S203a Of Mouse Acetylch 1e-10
1maa_A 547 Mouse Acetylcholinesterase Catalytic Domain, Glycos 1e-10
2xud_A 543 Crystal Structure Of The Y337a Mutant Of Mouse Acet 1e-10
4a16_A 545 Structure Of Mouse Acetylcholinesterase Complex Wit 1e-10
1c2b_A 540 Electrophorus Electricus Acetylcholinesterase Lengt 1e-10
1n5m_A 541 Crystal Structure Of The Mouse Acetylcholinesterase 1e-10
1q83_A 580 Crystal Structure Of The Mouse Acetylcholinesterase 1e-10
1ku6_A 549 Fasciculin 2-Mouse Acetylcholinesterase Complex Len 1e-10
2xuf_A 544 Crystal Structure Of Mache-Y337a-Tz2pa6 Anti Comple 1e-10
2whp_B 548 Crystal Structure Of Acetylcholinesterase, Phosphon 1e-10
2jgf_A 548 Crystal Structure Of Mouse Acetylcholinesterase Inh 1e-10
2c0p_A 548 Aged Form Of Mouse Acetylcholinesterase Inhibited B 1e-10
1c2o_A 539 Electrophorus Electricus Acetylcholinesterase Lengt 1e-10
1c7i_A 489 Thermophylic Pnb Esterase Length = 489 1e-09
1f8u_A 583 Crystal Structure Of Mutant E202q Of Human Acetylch 2e-09
1k4y_A 534 Crystal Structure Of Rabbit Liver Carboxylesterase 2e-09
2x8b_A 583 Crystal Structure Of Human Acetylcholinesterase Inh 2e-09
1dx4_A 585 Ache From Drosophila Melanogaster Complex With Tacr 2e-09
3lii_A 540 Recombinant Human Acetylcholinesterase Length = 540 2e-09
1b41_A 539 Human Acetylcholinesterase Complexed With Fasciculi 2e-09
4ey4_A 542 Crystal Structure Of Recombinant Human Acetylcholin 2e-09
2wsl_A 529 Aged Form Of Human Butyrylcholinesterase Inhibited 5e-09
1c7j_A 489 Pnb Esterase 56c8 Length = 489 5e-09
2j4c_A 529 Structure Of Human Butyrylcholinesterase In Complex 5e-09
1qe3_A 489 Pnb Esterase Length = 489 6e-09
2wil_A 529 Aged Form Of Human Butyrylcholinesterase Inhibited 7e-09
2wif_A 529 Aged Form Of Human Butyrylcholinesterase Inhibited 7e-09
4aqd_A 531 Crystal Structure Of Fully Glycosylated Human Butyr 7e-09
2y1k_A 529 Structure Of Human Butyrylcholinesterase Inhibited 7e-09
2xqf_A 527 X-Ray Structure Of Human Butyrylcholinesterase Inhi 7e-09
2dqy_A 542 Crystal Structure Of Human Carboxylesterase In Comp 7e-09
4axb_A 527 Crystal Structure Of Soman-aged Human Butyrylcholin 7e-09
1p0i_A 529 Crystal Structure Of Human Butyryl Cholinesterase L 7e-09
2xmb_A 529 G117h Mutant Of Human Butyrylcholinesterase In Comp 7e-09
4b0o_A 529 Crystal Structure Of Soman-Aged Human Butyrylcholin 7e-09
3djy_A 529 Nonaged Form Of Human Butyrylcholinesterase Inhibit 7e-09
1mx1_A 548 Crystal Structure Of Human Liver Carboxylesterase I 8e-09
2wid_A 529 Nonaged Form Of Human Butyrylcholinesterase Inhibit 8e-09
3k9b_A 529 Crystal Structure Of Human Liver Carboxylesterase 1 1e-08
1ya4_A 532 Crystal Structure Of Human Liver Carboxylesterase 1 1e-08
3o9m_A 574 Co-Crystallization Studies Of Full Length Recombina 2e-08
2pm8_A 574 Crystal Structure Of Recombinant Full Length Human 2e-08
2w6c_X 586 Ache In Complex With A Bis-(-)-Nor-Meptazinol Deriv 3e-08
1som_A 543 Torpedo Californica Acetylcholinesterase Inhibited 1e-07
1fss_A 537 Acetylcholinesterase (E.C. 3.1.1.7) Complexed With 1e-07
2dfp_A 534 X-Ray Structure Of Aged Di-Isopropyl-Phosphoro-Fluo 1e-07
2c58_A 537 Torpedo Californica Acetylcholinesterase In Complex 1e-07
3i6m_A 534 3d Structure Of Torpedo Californica Acetylcholinest 1e-07
2cek_A 535 Conformational Flexibility In The Peripheral Site O 1e-07
1eea_A 534 Acetylcholinesterase Length = 534 1e-07
1ut6_A 537 Structure Of Acetylcholinesterase (E.C. 3.1.1.7) Co 1e-07
1gqr_A 532 Acetylcholinesterase (E.C. 3.1.1.7) Complexed With 2e-07
3gel_A 532 O-Methylphosphorylated Torpedo Acetylcholinesterase 2e-07
2ogs_A 498 Crystal Structure Of The Geobacillus Stearothermoph 4e-07
2ogt_A 498 Crystal Structure Of The Geobacillus Stearothermoph 4e-07
1crl_A 534 Insights Into Interfacial Activation From An 'open' 6e-07
1lpm_A 549 A Structural Basis For The Chiral Preferences Of Li 7e-07
1llf_A 534 Cholesterol Esterase (Candida Cylindracea) Crystal 1e-06
1cle_A 534 Structure Of Uncomplexed And Linoleate-Bound Candid 1e-06
1gz7_A 534 Crystal Structure Of The Closed State Of Lipase 2 F 1e-05
>pdb|3BE8|A Chain A, Crystal Structure Of The Synaptic Protein Neuroligin 4 Length = 588 Back     alignment and structure 
Iteration: 1

 Score = 92.4 bits (228), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 49/111 (44%), Positives = 64/111 (57%), Gaps = 8/111 (7%)
Query: 23  VARTKYGPLRGILIQNP-----PVEAYLGVPYATPPLGSLRYMPPVTPSTWRAPRFADTY 77
           V  T YG +RG+    P     PVE YLGVPYA+PP G  R+ PP  PS+W   R    +
Sbjct: 16  VVNTNYGKIRGLRTPLPNEILGPVEQYLGVPYASPPTGERRFQPPEPPSSWTGIRNTTQF 75
Query: 78  SAVCPQRLPDIGNRTEALLQLPRGRLVFLEKLLPLLSNQSEDCLYLNLYVP 128
           +AVCPQ L +   R+     LP      L+ L+  + +Q+EDCLYLN+YVP
Sbjct: 76  AAVCPQHLDE---RSLLHDMLPIWFTANLDTLMTYVQDQNEDCLYLNIYVP 123
>pdb|3BL8|A Chain A, Crystal Structure Of The Extracellular Domain Of Neuroligin 2a From Mouse Length = 580 Back     alignment and structure
>pdb|3BIW|A Chain A, Crystal Structure Of The Neuroligin-1NEUREXIN-1beta Synaptic Adhesion Complex Length = 574 Back     alignment and structure
>pdb|3VKF|A Chain A, Crystal Structure Of Neurexin 1betaNEUROLIGIN 1 COMPLEX Length = 585 Back     alignment and structure
>pdb|3B3Q|A Chain A, Crystal Structure Of A Synaptic Adhesion Complex Length = 577 Back     alignment and structure
>pdb|3DL7|A Chain A, Aged Form Of Mouse Acetylcholinesterase Inhibited By Tabun- Update Length = 538 Back     alignment and structure
>pdb|2JGE|A Chain A, Crystal Structure Of Mouse Acetylcholinesterase Inhibited By Non-Aged Methamidophos Length = 536 Back     alignment and structure
>pdb|1MAH|A Chain A, Fasciculin2-Mouse Acetylcholinesterase Complex Length = 543 Back     alignment and structure
>pdb|2HA4|A Chain A, Crystal Structure Of Mutant S203a Of Mouse Acetylcholinesterase Complexed With Acetylcholine Length = 543 Back     alignment and structure
>pdb|1MAA|A Chain A, Mouse Acetylcholinesterase Catalytic Domain, Glycosylated Protein Length = 547 Back     alignment and structure
>pdb|2XUD|A Chain A, Crystal Structure Of The Y337a Mutant Of Mouse Acetylcholinesterase Length = 543 Back     alignment and structure
>pdb|4A16|A Chain A, Structure Of Mouse Acetylcholinesterase Complex With Huprine Derivative Length = 545 Back     alignment and structure
>pdb|1C2B|A Chain A, Electrophorus Electricus Acetylcholinesterase Length = 540 Back     alignment and structure
>pdb|1N5M|A Chain A, Crystal Structure Of The Mouse Acetylcholinesterase-Gallamine Complex Length = 541 Back     alignment and structure
>pdb|1Q83|A Chain A, Crystal Structure Of The Mouse Acetylcholinesterase-Tz2pa6 Syn Complex Length = 580 Back     alignment and structure
>pdb|1KU6|A Chain A, Fasciculin 2-Mouse Acetylcholinesterase Complex Length = 549 Back     alignment and structure
>pdb|2XUF|A Chain A, Crystal Structure Of Mache-Y337a-Tz2pa6 Anti Complex (1 Mth) Length = 544 Back     alignment and structure
>pdb|2WHP|B Chain B, Crystal Structure Of Acetylcholinesterase, Phosphonylated By Sarin And In Complex With Hi-6 Length = 548 Back     alignment and structure
>pdb|2JGF|A Chain A, Crystal Structure Of Mouse Acetylcholinesterase Inhibited By Non-Aged Fenamiphos Length = 548 Back     alignment and structure
>pdb|2C0P|A Chain A, Aged Form Of Mouse Acetylcholinesterase Inhibited By Tabun Length = 548 Back     alignment and structure
>pdb|1C2O|A Chain A, Electrophorus Electricus Acetylcholinesterase Length = 539 Back     alignment and structure
>pdb|1C7I|A Chain A, Thermophylic Pnb Esterase Length = 489 Back     alignment and structure
>pdb|1F8U|A Chain A, Crystal Structure Of Mutant E202q Of Human Acetylcholinesterase Complexed With Green Mamba Venom Peptide Fasciculin-ii Length = 583 Back     alignment and structure
>pdb|1K4Y|A Chain A, Crystal Structure Of Rabbit Liver Carboxylesterase In Complex With 4- Piperidino-Piperidine Length = 534 Back     alignment and structure
>pdb|2X8B|A Chain A, Crystal Structure Of Human Acetylcholinesterase Inhibited By Aged Tabun And Complexed With Fasciculin-Ii Length = 583 Back     alignment and structure
>pdb|1DX4|A Chain A, Ache From Drosophila Melanogaster Complex With Tacrine Derivative 9-(3-Phenylmethylamino)-1,2,3,4-Tetrahydroacridine Length = 585 Back     alignment and structure
>pdb|3LII|A Chain A, Recombinant Human Acetylcholinesterase Length = 540 Back     alignment and structure
>pdb|1B41|A Chain A, Human Acetylcholinesterase Complexed With Fasciculin-Ii, Glycosylated Protein Length = 539 Back     alignment and structure
>pdb|4EY4|A Chain A, Crystal Structure Of Recombinant Human Acetylcholinesterase In The Apo State Length = 542 Back     alignment and structure
>pdb|2WSL|A Chain A, Aged Form Of Human Butyrylcholinesterase Inhibited By Tabun Analogue Ta4 Length = 529 Back     alignment and structure
>pdb|1C7J|A Chain A, Pnb Esterase 56c8 Length = 489 Back     alignment and structure
>pdb|2J4C|A Chain A, Structure Of Human Butyrylcholinesterase In Complex With 10mm Hgcl2 Length = 529 Back     alignment and structure
>pdb|1QE3|A Chain A, Pnb Esterase Length = 489 Back     alignment and structure
>pdb|2WIL|A Chain A, Aged Form Of Human Butyrylcholinesterase Inhibited By Tabun Analogue Ta5 Length = 529 Back     alignment and structure
>pdb|2WIF|A Chain A, Aged Form Of Human Butyrylcholinesterase Inhibited By Tabun Analogue Ta1 Length = 529 Back     alignment and structure
>pdb|4AQD|A Chain A, Crystal Structure Of Fully Glycosylated Human Butyrylcholinesterase Length = 531 Back     alignment and structure
>pdb|2Y1K|A Chain A, Structure Of Human Butyrylcholinesterase Inhibited By Cbdp ( 12h Soak): Phosphoserine Adduct Length = 529 Back     alignment and structure
>pdb|2XQF|A Chain A, X-Ray Structure Of Human Butyrylcholinesterase Inhibited By Racemic Vx Length = 527 Back     alignment and structure
>pdb|2DQY|A Chain A, Crystal Structure Of Human Carboxylesterase In Complex With Cholate And Palmitate Length = 542 Back     alignment and structure
>pdb|4AXB|A Chain A, Crystal Structure Of Soman-aged Human Butyrylcholinesterase In Complex With 2-pam Length = 527 Back     alignment and structure
>pdb|1P0I|A Chain A, Crystal Structure Of Human Butyryl Cholinesterase Length = 529 Back     alignment and structure
>pdb|2XMB|A Chain A, G117h Mutant Of Human Butyrylcholinesterase In Complex With Sulfate Length = 529 Back     alignment and structure
>pdb|4B0O|A Chain A, Crystal Structure Of Soman-Aged Human Butyrylcholinesterase In Complex With Benzyl Pyridinium-4-Methyltrichloroacetimidate Length = 529 Back     alignment and structure
>pdb|3DJY|A Chain A, Nonaged Form Of Human Butyrylcholinesterase Inhibited By Tabun Length = 529 Back     alignment and structure
>pdb|1MX1|A Chain A, Crystal Structure Of Human Liver Carboxylesterase In Complex With Tacrine Length = 548 Back     alignment and structure
>pdb|2WID|A Chain A, Nonaged Form Of Human Butyrylcholinesterase Inhibited By Tabun Analogue Ta1 Length = 529 Back     alignment and structure
>pdb|3K9B|A Chain A, Crystal Structure Of Human Liver Carboxylesterase 1 (Hce1) In Covalent Complex With The Nerve Agent Cyclosarin (Gf) Length = 529 Back     alignment and structure
>pdb|1YA4|A Chain A, Crystal Structure Of Human Liver Carboxylesterase 1 In Complex With Tamoxifen Length = 532 Back     alignment and structure
>pdb|3O9M|A Chain A, Co-Crystallization Studies Of Full Length Recombinant Bche With Cocaine Offers Insights Into Cocaine Detoxification Length = 574 Back     alignment and structure
>pdb|2PM8|A Chain A, Crystal Structure Of Recombinant Full Length Human Butyrylcholinesterase Length = 574 Back     alignment and structure
>pdb|2W6C|X Chain X, Ache In Complex With A Bis-(-)-Nor-Meptazinol Derivative Length = 586 Back     alignment and structure
>pdb|1SOM|A Chain A, Torpedo Californica Acetylcholinesterase Inhibited By Nerve Agent Gd (Soman). Length = 543 Back     alignment and structure
>pdb|1FSS|A Chain A, Acetylcholinesterase (E.C. 3.1.1.7) Complexed With Fasciculin-Ii Length = 537 Back     alignment and structure
>pdb|2DFP|A Chain A, X-Ray Structure Of Aged Di-Isopropyl-Phosphoro-Fluoridate (Dfp) Bound To Acetylcholinesterase Length = 534 Back     alignment and structure
>pdb|2C58|A Chain A, Torpedo Californica Acetylcholinesterase In Complex With 20mm Acetylthiocholine Length = 537 Back     alignment and structure
>pdb|3I6M|A Chain A, 3d Structure Of Torpedo Californica Acetylcholinesterase Complexed With N-Piperidinopropyl-Galanthamine Length = 534 Back     alignment and structure
>pdb|2CEK|A Chain A, Conformational Flexibility In The Peripheral Site Of Torpedo Californica Acetylcholinesterase Revealed By The Complex Structure With A Bifunctional Inhibitor Length = 535 Back     alignment and structure
>pdb|1EEA|A Chain A, Acetylcholinesterase Length = 534 Back     alignment and structure
>pdb|1UT6|A Chain A, Structure Of Acetylcholinesterase (E.C. 3.1.1.7) Complexed With N-9-(1',2',3',4'-Tetrahydroacridinyl)-1,8- Diaminooctane At 2.4 Angstroms Resolution. Length = 537 Back     alignment and structure
>pdb|1GQR|A Chain A, Acetylcholinesterase (E.C. 3.1.1.7) Complexed With Rivastigmine Length = 532 Back     alignment and structure
>pdb|3GEL|A Chain A, O-Methylphosphorylated Torpedo Acetylcholinesterase Obtained By Reaction With Methyl Paraoxon (Aged) Length = 532 Back     alignment and structure
>pdb|2OGS|A Chain A, Crystal Structure Of The Geobacillus Stearothermophilus Carboxylesterase Est55 At Ph 6.2 Length = 498 Back     alignment and structure
>pdb|2OGT|A Chain A, Crystal Structure Of The Geobacillus Stearothermophilus Carboxylesterase Est55 At Ph 6.8 Length = 498 Back     alignment and structure
>pdb|1CRL|A Chain A, Insights Into Interfacial Activation From An 'open' Structure Of Candida Rugosa Lipase Length = 534 Back     alignment and structure
>pdb|1LPM|A Chain A, A Structural Basis For The Chiral Preferences Of Lipases Length = 549 Back     alignment and structure
>pdb|1LLF|A Chain A, Cholesterol Esterase (Candida Cylindracea) Crystal Structure At 1.4a Resolution Length = 534 Back     alignment and structure
>pdb|1CLE|A Chain A, Structure Of Uncomplexed And Linoleate-Bound Candida Cylindracea Cholesterol Esterase Length = 534 Back     alignment and structure
>pdb|1GZ7|A Chain A, Crystal Structure Of The Closed State Of Lipase 2 From Candida Rugosa Length = 534 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 6e-34
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 5e-31
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 8e-30
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 2e-29
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 5e-29
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 1e-28
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 6e-28
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 6e-28
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 7e-28
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 1e-27
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 3e-27
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 2e-25
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 7e-22
1b6a_A 478 Methionine aminopeptidase; angiogenesis inhibitor; 1e-05
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Length = 574 Back     alignment and structure
 Score =  125 bits (315), Expect = 6e-34
 Identities = 44/121 (36%), Positives = 59/121 (48%), Gaps = 8/121 (6%)

Query: 23  VARTKYGPLRGILIQNP-----PVEAYLGVPYATPPLGSLRYMPPVTPSTWRAPRFADTY 77
           +  T +G +RGI  +       PV  +LGVPYA PP G  R+ PP  PS W   R A  +
Sbjct: 12  LVTTNFGKIRGIKKELNNEILGPVIQFLGVPYAAPPTGEHRFQPPEPPSPWSDIRNATQF 71

Query: 78  SAVCPQRLPDIGNRTEALLQLPRGRLVFLEKLLPLLSNQSEDCLYLNLYVPRPVALEGEK 137
           + VCPQ + D          LP      L+ +   + +QSEDCLYLN+YVP    +    
Sbjct: 72  APVCPQNIIDGRLPEV---MLPVWFTNNLDVVSSYVQDQSEDCLYLNIYVPTEDDIRDSG 128

Query: 138 K 138
            
Sbjct: 129 G 129
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Length = 543 Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Length = 537 Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Length = 585 Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Length = 529 Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Length = 542 Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Length = 498 Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Length = 489 Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Length = 544 Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Length = 534 Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Length = 522 Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Length = 551 Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Length = 579 Back     alignment and structure
>1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 99.92
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 99.89
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 99.89
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 99.89
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 99.89
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 99.88
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 99.88
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 99.88
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 99.88
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 99.88
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 99.87
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 99.86
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 99.82
1jkm_A 361 Brefeldin A esterase; serine hydrolase, degradatio 97.46
2zsh_A 351 Probable gibberellin receptor GID1L1; plant hormon 96.19
3doh_A 380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 82.4
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure
Probab=99.92  E-value=1.5e-25  Score=208.34  Aligned_cols=100  Identities=34%  Similarity=0.580  Sum_probs=77.3

Q ss_pred             CCcEEEcCceeEEEEEec--CCCeeEEecccccCCCCCCCCCCCCCCCCCCCCccccccCCCCCCCCCCCCCchhhhhhc
Q psy7145          20 STRVARTKYGPLRGILIQ--NPPVEAYLGVPYATPPLGSLRYMPPVTPSTWRAPRFADTYSAVCPQRLPDIGNRTEALLQ   97 (191)
Q Consensus        20 ~~p~V~t~~G~v~G~~~~--~~~V~~FlGIPYA~pP~G~lRF~~P~p~~~w~g~~dAt~~gp~CpQ~~~~~~~~~~~~~~   97 (191)
                      +.++|+|.+|.|+|....  +.+|++|+|||||+||+|++||++|+|+.+|++++|||.+|+.|||........   +  
T Consensus         3 ~~~~V~t~~G~v~G~~~~~~~~~v~~F~GIPYA~pPvG~lRF~~P~p~~~w~gv~dAt~~g~~C~Q~~~~~~~~---~--   77 (585)
T 1dx4_A            3 DRLVVQTSSGPVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATGLSATCVQERYEYFPG---F--   77 (585)
T ss_dssp             CCSEEEETTEEEECEEEEETTEEEEEEEEEECSCCCCGGGTTSCCCCCCCCSSCEECSSCCCBCSCCCCCSSTT---C--
T ss_pred             CCcEEEeCCEEEEeEEEecCCceEEEEccCccCCCCCCccCCCCCcCCCCCcCceeeeecCCCCCCCCcccccc---c--
Confidence            467999999999998642  457999999999999999999999999999999999999999999975321000   0  


Q ss_pred             CCcchhhhhhhhcCCCCCCCccchhcccccCCCC
Q psy7145          98 LPRGRLVFLEKLLPLLSNQSEDCLYLNLYVPRPV  131 (191)
Q Consensus        98 ~~~~~~~~~~~~~~~~~~~sEDCL~LNI~tP~~a  131 (191)
                             ....+......+||||||||||+|..+
T Consensus        78 -------~~~~~~~~~~~~sEDCL~LNV~~P~~~  104 (585)
T 1dx4_A           78 -------SGEEIWNPNTNVSEDCLYINVWAPAKA  104 (585)
T ss_dssp             -------HHHHTTSCSSCBCSCCCEEEEEEEC--
T ss_pred             -------cccccccCCCCCCCcCCeEEEEecCcc
Confidence                   000011122457999999999999753
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 191
d1dx4a_ 571 c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Dro 2e-30
d2ha2a1 542 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mu 5e-28
d1qe3a_ 483 c.69.1.1 (A:) Thermophilic para-nitrobenzyl estera 2e-27
d2h7ca1 532 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase 3e-27
d1ea5a_ 532 c.69.1.1 (A:) Acetylcholinesterase {Pacific electr 4e-27
d1p0ia_ 526 c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo 9e-27
d1thga_ 544 c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fun 2e-26
d1llfa_ 534 c.69.1.17 (A:) Type-B carboxylesterase/lipase {Can 2e-26
d1ukca_ 517 c.69.1.17 (A:) Esterase EstA {Aspergillus niger [T 1e-25
d2bcea_ 579 c.69.1.1 (A:) Bile-salt activated lipase (choleste 1e-20
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 571 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Acetylcholinesterase-like
domain: Acetylcholinesterase
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

 Score =  114 bits (284), Expect = 2e-30
 Identities = 37/147 (25%), Positives = 53/147 (36%), Gaps = 14/147 (9%)

Query: 23  VARTKYGPLRGIL--IQNPPVEAYLGVPYATPPLGSLRYMPPVTPSTWRAPRFADTYSAV 80
           V +T  GP+RG    +Q   V  Y G+PYA PP+  LR+  PV    W     A   SA 
Sbjct: 4   VVQTSSGPVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATGLSAT 63

Query: 81  CPQRLPDIGNRTEALLQLPRGRLVFLEKLLPLLSNQSEDCLYLNLYVPRPVALEGEKKEK 140
           C Q   +                   E++    +N SEDCLY+N++ P    L   +   
Sbjct: 64  CVQERYEYFPGFSG------------EEIWNPNTNVSEDCLYINVWAPAKARLRHGRGAN 111

Query: 141 KKNKNKNKKKKKKKKKKKKKKKKKKKK 167
                  K+            +     
Sbjct: 112 GGEHPNGKQADTDHLIHNGNPQNTTNG 138
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Length = 542 Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Length = 483 Back     information, alignment and structure
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Length = 532 Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Length = 532 Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Length = 526 Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Length = 544 Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Length = 534 Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Length = 517 Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Length = 579 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
d2h7ca1 532 Mammalian carboxylesterase (liver carboxylesterase 99.94
d1ukca_ 517 Esterase EstA {Aspergillus niger [TaxId: 5061]} 99.94
d1qe3a_ 483 Thermophilic para-nitrobenzyl esterase (PNB estera 99.94
d1ea5a_ 532 Acetylcholinesterase {Pacific electric ray (Torped 99.94
d1dx4a_ 571 Acetylcholinesterase {Fruit fly (Drosophila melano 99.94
d1p0ia_ 526 Butyryl cholinesterase {Human (Homo sapiens) [TaxI 99.94
d2ha2a1 542 Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 99.93
d1llfa_ 534 Type-B carboxylesterase/lipase {Candida cylindrace 99.91
d1thga_ 544 Type-B carboxylesterase/lipase {Fungus (Geotrichum 99.9
d2bcea_ 579 Bile-salt activated lipase (cholesterol esterase) 99.9
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Acetylcholinesterase-like
domain: Mammalian carboxylesterase (liver carboxylesterase I)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.94  E-value=8.5e-29  Score=221.41  Aligned_cols=104  Identities=34%  Similarity=0.637  Sum_probs=81.2

Q ss_pred             CCcEEEcCceeEEEEEec----CCCeeEEecccccCCCCCCCCCCCCCCCCCCCCccccccCCCCCCCCCCCCCchhhhh
Q psy7145          20 STRVARTKYGPLRGILIQ----NPPVEAYLGVPYATPPLGSLRYMPPVTPSTWRAPRFADTYSAVCPQRLPDIGNRTEAL   95 (191)
Q Consensus        20 ~~p~V~t~~G~v~G~~~~----~~~V~~FlGIPYA~pP~G~lRF~~P~p~~~w~g~~dAt~~gp~CpQ~~~~~~~~~~~~   95 (191)
                      +.|+|+|.+|.|+|....    ...|++|+|||||+||+|++||++|+|+.+|++++|||.+|+.|||...........+
T Consensus         2 ~~pvv~t~~G~v~G~~~~~~~~~~~v~~f~gIpYA~pP~g~~Rf~~p~~~~~~~~~~~at~~~~~C~Q~~~~~~~~~~~~   81 (532)
T d2h7ca1           2 SPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNATSYPPMCTQDPKAGQLLSELF   81 (532)
T ss_dssp             CCCEEEETTEEEECEEECCTTCSSCEEEEEEEECSCCCCGGGTTSCCCCCCCCSSEEECBSCCCEESCCHHHHHHHHHHH
T ss_pred             CCCEEEECceEEEeEEEeeCCCCcceEEEeccccCCCCCCCCCCCCCCCCCCCCCceeCccCCCCCCCCCcccccccccc
Confidence            579999999999999764    4579999999999999999999999999999999999999999999852211000000


Q ss_pred             hcCCcchhhhhhhhcCCCCCCCccchhcccccCCCCCC
Q psy7145          96 LQLPRGRLVFLEKLLPLLSNQSEDCLYLNLYVPRPVAL  133 (191)
Q Consensus        96 ~~~~~~~~~~~~~~~~~~~~~sEDCL~LNI~tP~~a~~  133 (191)
                                ..........+||||||||||+|.+...
T Consensus        82 ----------~~~~~~~~~~~sEDCL~LnI~~P~~~~~  109 (532)
T d2h7ca1          82 ----------TNRKENIPLKLSEDCLYLNIYTPADLTK  109 (532)
T ss_dssp             ----------CCSSSCCCCCEESCCCEEEEEECSCTTS
T ss_pred             ----------cccccCCCCCCCCcCCEEEEEECCCCCC
Confidence                      0011122346899999999999976543
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Back     information, alignment and structure
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure