Psyllid ID: psy7309


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450----
MGRAWRLLREIIEGLSHIHSQGIIHRDLKPVNIFIDYEDHVKIGDFGLATNILQKHAGPLARELTGYILPPIDSTAFYSHDTSHTGQVGTALYAAPELDSHGVKAMYNQFTPQNYFSKQQKAFYVEILRVLWGYLKAEVYKDRPKTLEELKHNIRRENGPSTGSNVQKSLQKFQKSPPSVYREWRSSFEWSTVRNNIKSNFQHFLILIHQQKWCLNHDPSKRPSSEQNLCQPISLEGSSSGLSVLGSEQLLTCDHIPPPLVGETVLQDMVRQTLSNPQSKGYKYLVAACFNQKVSPADDITYDISLSRSANFSLLESTGDKLRRIFQLHGGAHFQTPLLTPLNSLTATSETTASVMTRGGSIVTLPHDLRIPFARYLAQNGSIVSMKRYCIDRVFRERRVLGFHPRELYECAFDIVTNTPGVLTMGSLRRCLMGSFRRFNYGNISFAPHPRVLN
cHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccHHHHHHHHccccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHcccccccccccccccHHHHcccccccccccccccccccccHHcccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccEEcccccccccccccccccccEEEEcccccEEEccccccHHHHHHHHHccccccEEEEEEEEEEEccccccccccEEEEEEEEEEcccccccHHHHHHHHHHHHHHccccccEEEEccccccc
ccHHHHHHHHHHHHHHHHHHcccccccccHHHEEEcccccEEEccccccccccHHHccccHHcccccccccccccccccccccccHEEEEEEEccHHHHHccccHHHHHHccccccccEEEEEHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccHHcHcccHHHHHHHHccccccccccccccccccccHHHHcccccHHHHHHHHHHHcccccccccHHHHHcccHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccHHHcccccccccccHHHHHHHHHHHHHHHHHHcccEEccccccccccccccccccEEEEEccccEEEEcccccccHHHHHHEEccccEEEEEEEEccEEcccccccccccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHcccccEEEEcccHHcc
MGRAWRLLREIIEGLSHihsqgiihrdlkpvnifidyedhvkigdfGLATNILQKHAGplareltgyilppidstafyshdtshtgqvgtalyaapeldshgvkamynqftpqnyfsKQQKAFYVEILRVLWGYLKAevykdrpkTLEELKHNirrengpstgsNVQKSLQKfqksppsvyrEWRSSFEWSTVRNNIKSNFQHFLILIHQQKwclnhdpskrpsseqnlcqpislegsssglsvlgseqlltcdhippplvgetVLQDMVRQtlsnpqskgyKYLVAACFnqkvspadditydislsrsanfslLESTGDKLRRIFQlhggahfqtplltplnsltatsetTASVMTrggsivtlphdlripFARYlaqngsivsmkRYCIDRVFRerrvlgfhprelYECAFDivtntpgvltmgSLRRClmgsfrrfnygnisfaphprvln
MGRAWRLLREIIEGLShihsqgiihrdLKPVNIFIDYEDHVKIGDFGLATNILQKHAGPLARELTGYILPPIDSTAFYSHDTSHTGQVGTALYAAPELDSHGVKAMYNQFTPQNYFSKQQKAFYVEILRVLWGYLKAEVYKDRPKTLEELkhnirrengpstgsnvqKSLQkfqksppsvyREWRSSFEWSTVRNNIKSNFQHFLILIHQQKWCLNHDPSKRPSSEQNLCQPISLEGSSSGLSVLGSEQLLTCDHIPPPLVGETVLQDMVRQTLSNPQSKGYKYLVAACFNQKVSPADDITYDISLSRSANFSLLESTGDKLRRIFQLHGGAHFQTPLLTPLNSLTATSETTASVMTRGGSIVTLPHDLRIPFARylaqngsivsmKRYCIDRVFRERRVLGFHPRELYECAFDIVTNTPGVLTMGSLRRCLMGSFRRfnygnisfaphprvln
MGRAWRLLREIIEGLSHIHSQGIIHRDLKPVNIFIDYEDHVKIGDFGLATNILQKHAGPLARELTGYILPPIDSTAFYSHDTSHTGQVGTALYAAPELDSHGVKAMYNQFTPQNYFSKQQKAFYVEILRVLWGYLKAEVYKDRPKTLEELKHNIRRENGPSTGSNVQKSLQKFQKSPPSVYREWRSSFEWSTVRNNIKSNFQHFLILIHQQKWCLNHDPSKRPSSEQNLCQPIslegsssglsvlgseqllTCDHIPPPLVGETVLQDMVRQTLSNPQSKGYKYLVAACFNQKVSPADDITYDISLSRSANFSLLESTGDKLRRIFQLHGGAHFQTPLLTPLNSLTATSETTASVMTRGGSIVTLPHDLRIPFARYLAQNGSIVSMKRYCIDRVFRERRVLGFHPRELYECAFDIVTNTPGVLTMGSLRRCLMGSFRRFNYGNISFAPHPRVLN
***AWRLLREIIEGLSHIHSQGIIHRDLKPVNIFIDYEDHVKIGDFGLATNILQKHAGPLARELTGYILPPIDSTAFYSHDTSHTGQVGTALYAAPELDSHGVKAMYNQFTPQNYFSKQQKAFYVEILRVLWGYLKAEVYKD*************************************VYREWRSSFEWSTVRNNIKSNFQHFLILIHQQKWCLN***************************VLGSEQLLTCDHIPPPLVGETVLQDMVRQTLSNPQSKGYKYLVAACFNQKVSPADDITYDISLSRSANFSLLESTGDKLRRIFQLHGGAHFQTPLLTPLNSLTATSETTASVMTRGGSIVTLPHDLRIPFARYLAQNGSIVSMKRYCIDRVFRERRVLGFHPRELYECAFDIVTNTPGVLTMGSLRRCLMGSFRRFNYGNISFA*******
MGRAWRLLREIIEGLSHIHSQGIIHRDLKPVNIFIDYEDHVKIGDFGLATNILQKH***************************HTGQVGTALYAAPELDSHGVKAMYNQFTPQNYFSKQQKAFYVEILRVLWGYLKAEVYKDRPKTLEELKHNIRRENGPSTGSNVQKSLQKFQ****************************HFLILIHQQKW************************************LLTCDHIPPPLVGETVLQDMVRQTLSNPQSKGYKYLVAACFNQKVSPADDITYDISLSRSANFSLLESTGDKLRRIFQLHGGAHFQTPLLTPLNSLTATSETTASVMTRGGSIVTLPHDLRIPFARYLAQNGSIVSMKRYCIDRVFRERR***FHPRELYECAFDIVTNTPGVLTMGSLRRCLMGSFRRFNYGNISFAPHPRVL*
MGRAWRLLREIIEGLSHIHSQGIIHRDLKPVNIFIDYEDHVKIGDFGLATNILQKHAGPLARELTGYILPPIDSTAFYSHDTSHTGQVGTALYAAPELDSHGVKAMYNQFTPQNYFSKQQKAFYVEILRVLWGYLKAEVYKDRPKTLEELKHNIRRENG***********************EWRSSFEWSTVRNNIKSNFQHFLILIHQQKWCLNHD**********LCQPISLEGSSSGLSVLGSEQLLTCDHIPPPLVGETVLQDMVRQTLSNPQSKGYKYLVAACFNQKVSPADDITYDISLSRSANFSLLESTGDKLRRIFQLHGGAHFQTPLLTPLNSLTATSETTASVMTRGGSIVTLPHDLRIPFARYLAQNGSIVSMKRYCIDRVFRERRVLGFHPRELYECAFDIVTNTPGVLTMGSLRRCLMGSFRRFNYGNISFAPHPRVLN
MGRAWRLLREIIEGLSHIHSQGIIHRDLKPVNIFIDYEDHVKIGDFGLATNILQKHA***********************DTSHTGQVGTALYAAPELDSHGVKAMYNQFTPQNYFSKQQKAFYVEILRVLWGYLKAEVYKDRPKTLEELKHNIRRENGPSTGSNVQKSLQKFQKSPPSVYREWRSSFEWSTVRNNIKSNFQHFLILIHQQKWCLNHDPSKRPSSEQNLCQPISLEGSSSGLSVLGSEQLLTCDHIPPPLVGETVLQDMVRQTLSNPQSKGYKYLVAACFNQKVSPADDITYDISLSRSANFSLLESTGDKLRRIFQLHGGAHFQTPLLTPLNSLTATSETTASVMTRGGSIVTLPHDLRIPFARYLAQNGSIVSMKRYCIDRVFRERRVLGFHPRELYECAFDIVTNTPGVLTMGSLRRCLMGSFRRFNYGNISFAPHP**L*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRAWRLLREIIEGLSHIHSQGIIHRDLKPVNIFIDYEDHVKIGDFGLATNILQKHAGPLARELTGYILPPIDSTAFYSHDTSHTGQVGTALYAAPELDSHGVKAMYNQFTPQNYFSKQQKAFYVEILRVLWGYLKAEVYKDRPKTLEELKHNIRRENGPSTGSNVQKSLQKFQKSPPSVYREWRSSFEWSTVRNNIKSNFQHFLILIHQQKWCLNHDPSKRPSSEQNLCQPISLEGSSSGLSVLGSEQLLTCDHIPPPLVGETVLQDMVRQTLSNPQSKGYKYLVAACFNQKVSPADDITYDISLSRSANFSLLESTGDKLRRIFQLHGGAHFQTPLLTPLNSLTATSETTASVMTRGGSIVTLPHDLRIPFARYLAQNGSIVSMKRYCIDRVFRERRVLGFHPRELYECAFDIVTNTPGVLTMGSLRRCLMGSFRRFNYGNISFAPHPRVLN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in the Non-Redundant Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST


Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query454
UNIPROTKB|H0YME5 1427 EIF2AK4 "Eukaryotic translatio 0.356 0.113 0.449 2.2e-60
UNIPROTKB|Q9P2K8 1649 EIF2AK4 "Eukaryotic translatio 0.356 0.098 0.449 4.2e-60
UNIPROTKB|E2RS10 1651 EIF2AK4 "Uncharacterized prote 0.359 0.098 0.443 7.5e-59
UNIPROTKB|E1BAL6 1649 EIF2AK4 "Uncharacterized prote 0.356 0.098 0.431 5.4e-58
MGI|MGI:1353427 1648 Eif2ak4 "eukaryotic translatio 0.356 0.098 0.426 3.7e-57
RGD|1311439 1572 Eif2ak4 "eukaryotic translatio 0.356 0.103 0.426 4e-57
UNIPROTKB|D4A7V9 1649 Eif2ak4 "Protein Eif2ak4" [Rat 0.356 0.098 0.426 4.8e-57
FB|FBgn0019990 1589 Gcn2 "Gcn2" [Drosophila melano 0.411 0.117 0.361 2.9e-54
DICTYBASE|DDB_G0276829 1358 ifkB "PEK family protein kinas 0.341 0.114 0.325 6.6e-29
SGD|S000002691 1659 GCN2 "Protein kinase" [Sacchar 0.191 0.052 0.535 1.7e-28
UNIPROTKB|H0YME5 EIF2AK4 "Eukaryotic translation initiation factor 2-alpha kinase 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 367 (134.2 bits), Expect = 2.2e-60, Sum P(3) = 2.2e-60
 Identities = 76/169 (44%), Positives = 108/169 (63%)

Query:   256 IPPPLVGETVLQDMVRQTLSNPQSKGYKYLVAACFNQKVSPADDITYDISLSRSANFSLL 315
             +PPP + E+ L +++  TL+N   K Y+ ++A  F+Q++SPA D TYD  + +  NFS+ 
Sbjct:   779 LPPPQMEESELHEVLHHTLTNVDGKAYRTMMAQIFSQRISPAIDYTYDSDILKG-NFSIR 837

Query:   316 -----ESTGDKLRRIFQLHGGAHFQTPLLTPLNSLTATSETTASVMTRGGSIVTLPHDLR 370
                  +   + + RIF+ HG     TPLL P N         A  M   G +V LP DLR
Sbjct:   838 TAKMQQHVCETIIRIFKRHGAVQLCTPLLLPRNRQIYEHNEAALFMDHSGMLVMLPFDLR 897

Query:   371 IPFARYLAQNGSIVSMKRYCIDRVFRERRVLGFHPRELYECAFDIVTNT 419
             IPFARY+A+N +I+++KRYCI+RVFR R++  FHP+EL ECAFDIVT+T
Sbjct:   898 IPFARYVARN-NILNLKRYCIERVFRPRKLDRFHPKELLECAFDIVTST 945


GO:0004694 "eukaryotic translation initiation factor 2alpha kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
UNIPROTKB|Q9P2K8 EIF2AK4 "Eukaryotic translation initiation factor 2-alpha kinase 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RS10 EIF2AK4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BAL6 EIF2AK4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1353427 Eif2ak4 "eukaryotic translation initiation factor 2 alpha kinase 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1311439 Eif2ak4 "eukaryotic translation initiation factor 2 alpha kinase 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4A7V9 Eif2ak4 "Protein Eif2ak4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0019990 Gcn2 "Gcn2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0276829 ifkB "PEK family protein kinase IfkB" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
SGD|S000002691 GCN2 "Protein kinase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.7.11.10.737
3rd Layer2.7.11LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query454
pfam00069260 pfam00069, Pkinase, Protein kinase domain 1e-24
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 3e-21
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 9e-19
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 1e-16
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 1e-15
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 1e-15
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 6e-15
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 6e-15
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 5e-14
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 7e-14
cd07834330 cd07834, STKc_MAPK, Catalytic domain of the Serine 2e-13
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 2e-13
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 3e-13
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 3e-13
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 3e-13
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 3e-13
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 4e-13
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 8e-13
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 1e-12
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 1e-12
cd07830283 cd07830, STKc_MAK_like, Catalytic domain of Male g 2e-12
cd07852337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 5e-12
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 6e-12
PLN02972 763 PLN02972, PLN02972, Histidyl-tRNA synthetase 7e-12
cd07851343 cd07851, STKc_p38, Catalytic domain of the Serine/ 9e-12
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 1e-11
cd07841298 cd07841, STKc_CDK7, Catalytic domain of the Serine 1e-11
PTZ00024335 PTZ00024, PTZ00024, cyclin-dependent protein kinas 2e-11
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 2e-11
cd05584323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 2e-11
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 4e-11
cd00773 261 cd00773, HisRS-like_core, Class II Histidinyl-tRNA 4e-11
cd07854342 cd07854, STKc_MAPK4_6, Catalytic domain of the Ser 6e-11
cd07855334 cd07855, STKc_ERK5, Catalytic domain of the Serine 1e-10
cd05599364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 2e-10
cd07838287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 2e-10
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 2e-10
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 4e-10
cd05577277 cd05577, STKc_GRK, Catalytic domain of the Protein 5e-10
cd07866311 cd07866, STKc_BUR1, Catalytic domain of the Serine 5e-10
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 7e-10
TIGR03903 1266 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclas 7e-10
cd05606278 cd05606, STKc_beta_ARK, Catalytic domain of the Pr 8e-10
cd07856328 cd07856, STKc_Sty1_Hog1, Catalytic domain of the S 9e-10
cd07842316 cd07842, STKc_CDK8_like, Catalytic domain of Cycli 9e-10
cd05600333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 9e-10
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 9e-10
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 1e-09
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 1e-09
PHA03209357 PHA03209, PHA03209, serine/threonine kinase US3; P 1e-09
cd07831282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 2e-09
cd05605285 cd05605, STKc_GRK4_like, Catalytic domain of G pro 2e-09
cd05582318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 2e-09
cd07849336 cd07849, STKc_ERK1_2_like, Catalytic domain of Ext 2e-09
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 2e-09
cd05038284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 2e-09
cd05592316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 2e-09
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 2e-09
cd08224267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 3e-09
cd05632285 cd05632, STKc_GRK5, Catalytic domain of the Protei 3e-09
cd07879342 cd07879, STKc_p38delta_MAPK13, Catalytic domain of 3e-09
cd05627360 cd05627, STKc_NDR2, Catalytic domain of the Protei 3e-09
cd07880343 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of 4e-09
cd07835283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 4e-09
cd05612291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 4e-09
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 5e-09
cd05587324 cd05587, STKc_cPKC, Catalytic domain of the Protei 5e-09
cd07857332 cd07857, STKc_MPK1, Catalytic domain of the Serine 5e-09
cd05570318 cd05570, STKc_PKC, Catalytic domain of the Protein 5e-09
cd07877345 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of 6e-09
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 6e-09
cd07850353 cd07850, STKc_JNK, Catalytic domain of the Serine/ 6e-09
cd07847286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 7e-09
cd08221256 cd08221, STKc_Nek9, Catalytic domain of the Protei 7e-09
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 7e-09
cd05629377 cd05629, STKc_NDR_like_fungal, Catalytic domain of 7e-09
cd05608280 cd05608, STKc_GRK1, Catalytic domain of the Protei 7e-09
cd05633279 cd05633, STKc_GRK3, Catalytic domain of the Protei 9e-09
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 1e-08
cd05630285 cd05630, STKc_GRK6, Catalytic domain of the Protei 1e-08
PHA03207392 PHA03207, PHA03207, serine/threonine kinase US3; P 2e-08
cd07858337 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of 2e-08
cd05080283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 2e-08
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 2e-08
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 2e-08
cd07865310 cd07865, STKc_CDK9, Catalytic domain of the Serine 2e-08
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 3e-08
cd05598376 cd05598, STKc_LATS, Catalytic domain of the Protei 3e-08
cd05628363 cd05628, STKc_NDR1, Catalytic domain of the Protei 3e-08
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 3e-08
COG0124 429 COG0124, HisS, Histidyl-tRNA synthetase [Translati 4e-08
cd06645267 cd06645, STKc_MAP4K3, Catalytic domain of the Prot 4e-08
cd07846286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 4e-08
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 4e-08
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 4e-08
cd06621287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 4e-08
cd07860284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 4e-08
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 5e-08
cd05619316 cd05619, STKc_nPKC_theta, Catalytic domain of the 5e-08
cd07876359 cd07876, STKc_JNK2, Catalytic domain of the Serine 5e-08
cd05596370 cd05596, STKc_ROCK, Catalytic domain of the Protei 6e-08
cd07878343 cd07878, STKc_p38beta_MAPK11, Catalytic domain of 7e-08
cd07875364 cd07875, STKc_JNK1, Catalytic domain of the Serine 9e-08
cd06636282 cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr 9e-08
cd07843293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 1e-07
cd07864302 cd07864, STKc_CDK12, Catalytic domain of the Serin 1e-07
cd07874355 cd07874, STKc_JNK3, Catalytic domain of the Serine 1e-07
cd06617283 cd06617, PKc_MKK3_6, Catalytic domain of the dual- 1e-07
cd05574316 cd05574, STKc_phototropin_like, Catalytic domain o 1e-07
cd05589324 cd05589, STKc_PKN, Catalytic domain of the Protein 2e-07
cd05610 669 cd05610, STKc_MASTL, Catalytic domain of the Prote 2e-07
PTZ00263329 PTZ00263, PTZ00263, protein kinase A catalytic sub 2e-07
cd05583288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 2e-07
cd07845309 cd07845, STKc_CDK10, Catalytic domain of the Serin 2e-07
cd06651266 cd06651, STKc_MEKK3, Catalytic domain of the Prote 2e-07
cd07870291 cd07870, STKc_PFTAIRE2, Catalytic domain of the Se 2e-07
cd07837295 cd07837, STKc_CdkB_plant, Catalytic domain of the 2e-07
cd06653264 cd06653, STKc_MEKK3_like_1, Catalytic domain of MA 2e-07
PLN00034353 PLN00034, PLN00034, mitogen-activated protein kina 2e-07
cd05571323 cd05571, STKc_PKB, Catalytic domain of the Protein 2e-07
cd05621370 cd05621, STKc_ROCK2, Catalytic domain of the Prote 2e-07
cd05590320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 3e-07
cd07839284 cd07839, STKc_CDK5, Catalytic domain of the Serine 3e-07
cd05620316 cd05620, STKc_nPKC_delta, Catalytic domain of the 3e-07
cd05609305 cd05609, STKc_MAST, Catalytic domain of the Protei 3e-07
cd08228267 cd08228, STKc_Nek6, Catalytic domain of the Protei 3e-07
cd08528269 cd08528, STKc_Nek10, Catalytic domain of the Prote 3e-07
cd08229267 cd08229, STKc_Nek7, Catalytic domain of the Protei 3e-07
cd07853372 cd07853, STKc_NLK, Catalytic domain of the Serine/ 4e-07
cd05601330 cd05601, STKc_CRIK, Catalytic domain of the Protei 4e-07
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 4e-07
cd05626381 cd05626, STKc_LATS2, Catalytic domain of the Prote 5e-07
cd07844291 cd07844, STKc_PCTAIRE_like, Catalytic domain of PC 5e-07
cd05625382 cd05625, STKc_LATS1, Catalytic domain of the Prote 5e-07
cd05586330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 5e-07
cd05615323 cd05615, STKc_cPKC_alpha, Catalytic domain of the 5e-07
cd07861285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 5e-07
cd06652265 cd06652, STKc_MEKK2, Catalytic domain of the Prote 7e-07
cd07863288 cd07863, STKc_CDK4, Catalytic domain of the Serine 7e-07
cd05616323 cd05616, STKc_cPKC_beta, Catalytic domain of the P 8e-07
cd06642277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 8e-07
cd07836284 cd07836, STKc_Pho85, Catalytic domain of the Serin 9e-07
cd06640277 cd06640, STKc_MST4, Catalytic domain of the Protei 9e-07
cd06641277 cd06641, STKc_MST3, Catalytic domain of the Protei 1e-06
cd06618296 cd06618, PKc_MKK7, Catalytic domain of the dual-sp 1e-06
cd05614332 cd05614, STKc_MSK2_N, N-terminal catalytic domain 1e-06
PLN03224507 PLN03224, PLN03224, probable serine/threonine prot 1e-06
cd05631285 cd05631, STKc_GRK4, Catalytic domain of the Protei 1e-06
cd06637272 cd06637, STKc_TNIK, Catalytic domain of the Protei 1e-06
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 1e-06
cd05588329 cd05588, STKc_aPKC, Catalytic domain of the Protei 2e-06
cd06646267 cd06646, STKc_MAP4K5, Catalytic domain of the Prot 2e-06
cd05575323 cd05575, STKc_SGK, Catalytic domain of the Protein 2e-06
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 2e-06
cd05585312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 3e-06
cd07859338 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of 3e-06
cd05040257 cd05040, PTKc_Ack_like, Catalytic domain of the Pr 3e-06
PLN03225566 PLN03225, PLN03225, Serine/threonine-protein kinas 3e-06
cd05603321 cd05603, STKc_SGK2, Catalytic domain of the Protei 3e-06
cd05622371 cd05622, STKc_ROCK1, Catalytic domain of the Prote 3e-06
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 4e-06
cd07871288 cd07871, STKc_PCTAIRE3, Catalytic domain of the Se 4e-06
cd05595323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 4e-06
cd07862290 cd07862, STKc_CDK6, Catalytic domain of the Serine 4e-06
cd05081284 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) 4e-06
PLN00009294 PLN00009, PLN00009, cyclin-dependent kinase A; Pro 5e-06
cd07869303 cd07869, STKc_PFTAIRE1, Catalytic domain of the Se 5e-06
cd05607277 cd05607, STKc_GRK7, Catalytic domain of the Protei 5e-06
cd07872309 cd07872, STKc_PCTAIRE2, Catalytic domain of the Se 5e-06
cd06644292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 5e-06
PHA03211461 PHA03211, PHA03211, serine/threonine kinase US3; P 5e-06
PRK12420 423 PRK12420, PRK12420, histidyl-tRNA synthetase; Prov 6e-06
cd05613290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 7e-06
cd08218256 cd08218, STKc_Nek1, Catalytic domain of the Protei 8e-06
cd07873301 cd07873, STKc_PCTAIRE1, Catalytic domain of the Se 9e-06
cd07867317 cd07867, STKc_CDC2L6, Catalytic domain of Serine/T 9e-06
cd05591321 cd05591, STKc_nPKC_epsilon, Catalytic domain of th 1e-05
cd05032277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 1e-05
cd08219255 cd08219, STKc_Nek3, Catalytic domain of the Protei 1e-05
cd08225257 cd08225, STKc_Nek5, Catalytic domain of the Protei 1e-05
cd06647293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 1e-05
cd05067260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 1e-05
PHA03212391 PHA03212, PHA03212, serine/threonine kinase US3; P 1e-05
cd05604325 cd05604, STKc_SGK3, Catalytic domain of the Protei 1e-05
cd06659297 cd06659, STKc_PAK6, Catalytic domain of the Protei 2e-05
cd06619279 cd06619, PKc_MKK5, Catalytic domain of the dual-sp 2e-05
cd05602325 cd05602, STKc_SGK1, Catalytic domain of the Protei 2e-05
PTZ00036440 PTZ00036, PTZ00036, glycogen synthase kinase; Prov 2e-05
cd05618329 cd05618, STKc_aPKC_iota, Catalytic domain of the P 2e-05
cd05057279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 2e-05
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 2e-05
cd05593328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 2e-05
TIGR00442 397 TIGR00442, hisS, histidyl-tRNA synthetase 3e-05
cd05597331 cd05597, STKc_DMPK_like, Catalytic domain of Myoto 3e-05
PRK13184 932 PRK13184, pknD, serine/threonine-protein kinase; R 3e-05
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 3e-05
cd05623332 cd05623, STKc_MRCK_alpha, Catalytic domain of the 3e-05
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 3e-05
cd06633313 cd06633, STKc_TAO3, Catalytic domain of the Protei 4e-05
cd06648285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 5e-05
cd05079284 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma 5e-05
cd07848287 cd07848, STKc_CDKL5, Catalytic domain of the Serin 6e-05
cd06657292 cd06657, STKc_PAK4, Catalytic domain of the Protei 7e-05
cd06607307 cd06607, STKc_TAO, Catalytic domain of the Protein 7e-05
PTZ00283496 PTZ00283, PTZ00283, serine/threonine protein kinas 8e-05
cd06622286 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of 9e-05
PRK00037 412 PRK00037, hisS, histidyl-tRNA synthetase; Reviewed 1e-04
cd05624331 cd05624, STKc_MRCK_beta, Catalytic domain of the P 1e-04
cd06656297 cd06656, STKc_PAK3, Catalytic domain of the Protei 1e-04
cd08223257 cd08223, STKc_Nek4, Catalytic domain of the Protei 1e-04
cd06654296 cd06654, STKc_PAK1, Catalytic domain of the Protei 1e-04
cd06643282 cd06643, STKc_SLK, Catalytic domain of the Protein 1e-04
cd06634308 cd06634, STKc_TAO2, Catalytic domain of the Protei 1e-04
cd06658292 cd06658, STKc_PAK5, Catalytic domain of the Protei 2e-04
cd06616288 cd06616, PKc_MKK4, Catalytic domain of the dual-sp 2e-04
PHA03210501 PHA03210, PHA03210, serine/threonine kinase US3; P 2e-04
cd06655296 cd06655, STKc_PAK2, Catalytic domain of the Protei 2e-04
cd06638286 cd06638, STKc_myosinIIIA, Catalytic domain of the 2e-04
cd06620284 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of 2e-04
cd05617327 cd05617, STKc_aPKC_zeta, Catalytic domain of the P 2e-04
cd07868317 cd07868, STKc_CDK8, Catalytic domain of the Serine 2e-04
PTZ00267478 PTZ00267, PTZ00267, NIMA-related protein kinase; P 3e-04
cd05109279 cd05109, PTKc_HER2, Catalytic domain of the Protei 3e-04
cd05053293 cd05053, PTKc_FGFR, Catalytic domain of the Protei 3e-04
cd06639291 cd06639, STKc_myosinIIIB, Catalytic domain of the 3e-04
cd08222260 cd08222, STKc_Nek11, Catalytic domain of the Prote 3e-04
cd05594325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 3e-04
cd05042269 cd05042, PTKc_Aatyk, Catalytic domain of the Prote 4e-04
cd06635317 cd06635, STKc_TAO1, Catalytic domain of the Protei 4e-04
cd05083254 cd05083, PTKc_Chk, Catalytic domain of the Protein 5e-04
cd05108316 cd05108, PTKc_EGFR, Catalytic domain of the Protei 5e-04
cd05058262 cd05058, PTKc_Met_Ron, Catalytic domain of the Pro 5e-04
cd05072261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 6e-04
cd05043280 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Rece 6e-04
cd05068261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 7e-04
cd05110303 cd05110, PTKc_HER4, Catalytic domain of the Protei 8e-04
cd05061288 cd05061, PTKc_InsR, Catalytic domain of the Protei 8e-04
cd05073260 cd05073, PTKc_Hck, Catalytic domain of the Protein 8e-04
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 9e-04
cd05106374 cd05106, PTKc_CSF-1R, Catalytic domain of the Prot 0.001
cd05101304 cd05101, PTKc_FGFR2, Catalytic domain of the Prote 0.001
cd05055302 cd05055, PTKc_PDGFR, Catalytic domain of the Prote 0.001
PHA03390267 PHA03390, pk1, serine/threonine-protein kinase 1; 0.001
PRK09605535 PRK09605, PRK09605, bifunctional UGMP family prote 0.002
cd05062277 cd05062, PTKc_IGF-1R, Catalytic domain of the Prot 0.002
cd05102338 cd05102, PTKc_VEGFR3, Catalytic domain of the Prot 0.002
cd05100334 cd05100, PTKc_FGFR3, Catalytic domain of the Prote 0.002
cd05099314 cd05099, PTKc_FGFR4, Catalytic domain of the Prote 0.002
cd05060257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 0.002
cd05113256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 0.003
cd05098307 cd05098, PTKc_FGFR1, Catalytic domain of the Prote 0.003
cd06650333 cd06650, PKc_MEK1, Catalytic domain of the dual-sp 0.003
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 0.003
PHA02882294 PHA02882, PHA02882, putative serine/threonine kina 0.004
cd06615308 cd06615, PKc_MEK, Catalytic domain of the dual-spe 0.004
cd05144198 cd05144, RIO2_C, RIO kinase family; RIO2, C-termin 0.004
cd05048283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 0.004
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
 Score =  101 bits (255), Expect = 1e-24
 Identities = 61/230 (26%), Positives = 87/230 (37%), Gaps = 76/230 (33%)

Query: 6   RLLREIIEGLSHIHSQGIIHRDLKPVNIFIDYEDHVKIGDFGLATNILQKHAGPLARELT 65
           ++  +I+ GL ++HS GIIHRDLKP NI +D    VKI DFGLA                
Sbjct: 102 KIALQILRGLEYLHSNGIIHRDLKPENILLDENGVVKIADFGLA---------------- 145

Query: 66  GYILPPIDSTAFYSHDTSHTGQVGTALYAAPELDSHGVKAMYNQFTPQNYFSKQQKAFYV 125
                           +S T  VGT  Y APE+   G            Y  K      V
Sbjct: 146 ---------KKLLKSSSSLTTFVGTPWYMAPEVLLGG----------NGYGPK------V 180

Query: 126 EILRVLW--GYLKAEVYKDRPKTLEELKHNIRRENGPSTGSNVQKSLQKF-QKSPPSVYR 182
           ++    W  G +  E+   +P               P +G N+   LQ   +   P +  
Sbjct: 181 DV----WSLGVILYELLTGKP---------------PFSGENILDQLQLIRRILGPPLEF 221

Query: 183 EWRSSFEWSTVRNNIKSNFQHFLILIHQQKWCLNHDPSKRPSSEQNLCQP 232
           +           ++     +  +      K CLN DPSKRP++E+ L  P
Sbjct: 222 DEPKW-------SSGSEEAKDLI------KKCLNKDPSKRPTAEEILQHP 258


Length = 260

>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|215525 PLN02972, PLN02972, Histidyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|238396 cd00773, HisRS-like_core, Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain Back     alignment and domain information
>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein Back     alignment and domain information
>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>gnl|CDD|165473 PHA03207, PHA03207, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|223202 COG0124, HisS, Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>gnl|CDD|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>gnl|CDD|143375 cd07870, STKc_PFTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>gnl|CDD|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>gnl|CDD|178763 PLN03224, PLN03224, probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>gnl|CDD|215638 PLN03225, PLN03225, Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional Back     alignment and domain information
>gnl|CDD|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|223009 PHA03211, PHA03211, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|237097 PRK12420, PRK12420, histidyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|143372 cd07867, STKc_CDC2L6, Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|165478 PHA03212, PHA03212, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional Back     alignment and domain information
>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|213530 TIGR00442, hisS, histidyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|183880 PRK13184, pknD, serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|234586 PRK00037, hisS, histidyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>gnl|CDD|165476 PHA03210, PHA03210, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>gnl|CDD|143373 cd07868, STKc_CDK8, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|133240 cd05109, PTKc_HER2, Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|133174 cd05042, PTKc_Aatyk, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|133175 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|223069 PHA03390, pk1, serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>gnl|CDD|236586 PRK09605, PRK09605, bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|133233 cd05102, PTKc_VEGFR3, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|165211 PHA02882, PHA02882, putative serine/threonine kinase; Provisional Back     alignment and domain information
>gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>gnl|CDD|240167 cd05144, RIO2_C, RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 454
KOG1035|consensus 1351 100.0
COG0124 429 HisS Histidyl-tRNA synthetase [Translation, riboso 100.0
PLN02972 763 Histidyl-tRNA synthetase 100.0
KOG1936|consensus 518 100.0
KOG0615|consensus475 100.0
KOG0661|consensus538 100.0
PRK12292 391 hisZ ATP phosphoribosyltransferase regulatory subu 100.0
KOG0598|consensus357 100.0
KOG0660|consensus359 100.0
PLN02530 487 histidine-tRNA ligase 100.0
KOG0581|consensus364 100.0
PRK12420 423 histidyl-tRNA synthetase; Provisional 100.0
KOG0575|consensus592 100.0
CHL00201 430 syh histidine-tRNA synthetase; Provisional 100.0
PRK12421 392 ATP phosphoribosyltransferase regulatory subunit; 100.0
KOG0592|consensus604 99.98
KOG0594|consensus323 99.97
PF13393 311 tRNA-synt_His: Histidyl-tRNA synthetase; PDB: 3HRI 99.97
KOG0659|consensus318 99.97
TIGR00443 314 hisZ_biosyn_reg ATP phosphoribosyltransferase, reg 99.97
KOG0663|consensus419 99.97
KOG0593|consensus396 99.97
KOG0600|consensus560 99.97
KOG0658|consensus364 99.97
PRK12295 373 hisZ ATP phosphoribosyltransferase regulatory subu 99.97
KOG0033|consensus355 99.97
KOG0599|consensus411 99.97
PRK12293 281 hisZ ATP phosphoribosyltransferase regulatory subu 99.97
cd00773 261 HisRS-like_core Class II Histidinyl-tRNA synthetas 99.97
KOG0616|consensus355 99.97
KOG0667|consensus586 99.97
KOG0578|consensus550 99.97
KOG0198|consensus313 99.96
KOG0588|consensus 786 99.96
KOG0583|consensus370 99.96
TIGR00442 397 hisS histidyl-tRNA synthetase. This model finds a 99.96
KOG0694|consensus694 99.96
KOG0591|consensus375 99.96
COG3705 390 HisZ ATP phosphoribosyltransferase involved in his 99.96
KOG0671|consensus415 99.96
KOG0605|consensus550 99.96
KOG0582|consensus516 99.96
KOG0665|consensus369 99.96
PRK00037 412 hisS histidyl-tRNA synthetase; Reviewed 99.95
KOG0986|consensus591 99.95
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.95
KOG0597|consensus 808 99.95
KOG0579|consensus 1187 99.95
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.95
KOG0585|consensus576 99.95
KOG0666|consensus438 99.95
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.95
PHA03212391 serine/threonine kinase US3; Provisional 99.95
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.95
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.95
KOG0201|consensus467 99.95
KOG0669|consensus376 99.95
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.94
PTZ00036440 glycogen synthase kinase; Provisional 99.94
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.94
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.94
PTZ00284467 protein kinase; Provisional 99.94
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.94
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.94
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.94
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.94
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.94
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.94
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.94
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.94
KOG0604|consensus400 99.94
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.94
PTZ00263329 protein kinase A catalytic subunit; Provisional 99.94
PHA03209357 serine/threonine kinase US3; Provisional 99.94
KOG0595|consensus429 99.94
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.94
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.94
KOG0610|consensus459 99.94
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.94
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.94
KOG0596|consensus677 99.94
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.94
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.94
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 99.94
KOG0577|consensus 948 99.94
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.94
KOG0662|consensus292 99.94
PHA03211461 serine/threonine kinase US3; Provisional 99.94
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 99.94
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.94
PHA03207392 serine/threonine kinase US3; Provisional 99.94
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.94
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.93
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.93
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.93
KOG0032|consensus382 99.93
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.93
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.93
KOG0983|consensus391 99.93
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.93
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.93
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.93
PHA03210501 serine/threonine kinase US3; Provisional 99.93
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.93
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.93
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.93
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.93
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.93
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.93
KOG0603|consensus612 99.93
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.93
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.93
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 99.93
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 99.93
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.93
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.93
KOG0589|consensus426 99.93
PTZ00283496 serine/threonine protein kinase; Provisional 99.93
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.93
KOG0690|consensus516 99.93
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.93
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.93
KOG0192|consensus362 99.93
KOG4645|consensus1509 99.93
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.93
KOG0664|consensus449 99.93
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.93
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.93
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 99.92
KOG0580|consensus281 99.92
PTZ00267478 NIMA-related protein kinase; Provisional 99.92
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.92
KOG4279|consensus 1226 99.92
KOG0670|consensus752 99.92
KOG0574|consensus502 99.92
PRK12294 272 hisZ ATP phosphoribosyltransferase regulatory subu 99.92
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.92
KOG0611|consensus 668 99.92
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.92
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.92
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.92
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.92
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.92
KOG0614|consensus732 99.92
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.92
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.92
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 99.92
KOG0584|consensus 632 99.92
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.92
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 99.92
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.92
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.92
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.92
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.91
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.91
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.91
KOG4236|consensus888 99.91
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.91
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.91
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.91
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.91
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.91
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.91
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.91
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.91
KOG4717|consensus 864 99.91
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.91
KOG0607|consensus463 99.91
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.91
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.91
KOG0696|consensus683 99.91
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.91
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.91
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.91
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.91
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.91
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.91
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.91
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.91
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.9
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.9
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.9
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.9
KOG0197|consensus468 99.9
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.9
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.9
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.9
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.9
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.9
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.9
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.9
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.9
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.9
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 99.9
KOG0612|consensus 1317 99.9
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.9
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.9
PLN00181 793 protein SPA1-RELATED; Provisional 99.9
KOG4721|consensus 904 99.9
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.9
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.9
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.9
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.9
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.9
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.9
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.9
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.9
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.9
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.9
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.9
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.9
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.9
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.9
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.9
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.9
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.9
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.9
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.9
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.9
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 99.9
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.89
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.89
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.89
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.89
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.89
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.89
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.89
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.89
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.89
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.89
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.89
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.89
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.89
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.89
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.89
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.89
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.89
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.89
KOG1027|consensus903 99.89
KOG2345|consensus302 99.89
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.89
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.89
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.89
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.89
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.89
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.89
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.89
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.89
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.89
PHA02988283 hypothetical protein; Provisional 99.89
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.89
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.89
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.89
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.89
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.89
PHA02882294 putative serine/threonine kinase; Provisional 99.89
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.89
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.89
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.89
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.89
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 99.89
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.89
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.89
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.89
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.89
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.89
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.89
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.88
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.88
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.88
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.88
PRK00413 638 thrS threonyl-tRNA synthetase; Reviewed 99.88
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.88
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.88
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.88
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.88
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.88
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.88
PLN00009294 cyclin-dependent kinase A; Provisional 99.88
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.88
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.88
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.88
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.88
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.88
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.88
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.88
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.88
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.88
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.88
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.88
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.88
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.88
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.88
KOG1290|consensus590 99.88
KOG0695|consensus593 99.88
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.88
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.88
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.88
KOG0193|consensus678 99.88
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.88
KOG0668|consensus338 99.88
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.88
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.88
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.88
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.88
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.88
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.88
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.88
KOG1989|consensus 738 99.88
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.88
KOG0586|consensus596 99.88
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.88
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.88
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.88
KOG1006|consensus361 99.88
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.88
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.88
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.88
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.88
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.88
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.87
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.87
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.87
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.87
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.87
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.87
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.87
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.87
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.87
PLN03224507 probable serine/threonine protein kinase; Provisio 99.87
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.87
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.87
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.87
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.87
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.87
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.87
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.87
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.87
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.87
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.87
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.87
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.87
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.87
KOG1167|consensus418 99.87
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.87
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.87
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.87
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.87
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.87
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.87
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.87
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.87
KOG0608|consensus1034 99.87
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.86
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.86
KOG0587|consensus 953 99.86
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.86
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.86
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.86
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.86
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.86
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.86
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.86
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.86
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.86
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.86
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.86
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.86
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.86
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.86
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.86
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.86
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.85
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.85
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.85
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.85
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.85
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.85
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.85
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.85
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.85
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.85
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.85
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.85
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.85
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.85
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.85
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.85
PRK12305 575 thrS threonyl-tRNA synthetase; Reviewed 99.84
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.84
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.84
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.84
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.84
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.84
KOG0576|consensus 829 99.84
cd00670235 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_t 99.84
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.84
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.84
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.83
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.83
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.83
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.83
KOG0984|consensus282 99.83
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.83
cd00779255 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) cla 99.82
KOG1187|consensus361 99.81
KOG0194|consensus474 99.81
cd00771 298 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class 99.8
KOG1095|consensus1025 99.8
KOG1026|consensus774 99.8
KOG1151|consensus775 99.79
TIGR00418 563 thrS threonyl-tRNA synthetase. This model represen 99.79
PRK09194 565 prolyl-tRNA synthetase; Provisional 99.77
KOG0590|consensus601 99.76
KOG4257|consensus 974 99.76
KOG4250|consensus 732 99.76
KOG0200|consensus609 99.76
KOG0196|consensus996 99.75
KOG0199|consensus 1039 99.75
TIGR00409 568 proS_fam_II prolyl-tRNA synthetase, family II. Pro 99.74
PRK12444 639 threonyl-tRNA synthetase; Reviewed 99.74
KOG4278|consensus 1157 99.73
PRK14799 545 thrS threonyl-tRNA synthetase; Provisional 99.73
KOG1345|consensus378 99.73
KOG3653|consensus534 99.72
KOG2052|consensus513 99.71
TIGR02367453 PylS pyrrolysyl-tRNA synthetase. PylS is the archa 99.71
KOG1094|consensus807 99.68
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.67
cd00772264 ProRS_core Prolyl-tRNA synthetase (ProRS) class II 99.67
KOG0606|consensus 1205 99.67
cd00774254 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-lik 99.67
KOG1152|consensus772 99.67
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.66
PF00587173 tRNA-synt_2b: tRNA synthetase class II core domain 99.65
PLN02908 686 threonyl-tRNA synthetase 99.65
PRK04172489 pheS phenylalanyl-tRNA synthetase subunit alpha; P 99.65
KOG1025|consensus1177 99.62
KOG1033|consensus516 99.62
KOG1024|consensus563 99.61
KOG0603|consensus 612 99.58
PRK12325 439 prolyl-tRNA synthetase; Provisional 99.53
PRK09537417 pylS pyrolysyl-tRNA synthetase; Reviewed 99.51
PTZ00326494 phenylalanyl-tRNA synthetase alpha chain; Provisio 99.49
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.46
KOG4158|consensus598 99.45
COG0515384 SPS1 Serine/threonine protein kinase [General func 99.44
cd00768211 class_II_aaRS-like_core Class II tRNA amino-acyl s 99.43
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 99.38
KOG1240|consensus 1431 99.38
cd00778261 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) 99.38
PRK09188365 serine/threonine protein kinase; Provisional 99.35
KOG1164|consensus322 99.26
TIGR00408 472 proS_fam_I prolyl-tRNA synthetase, family I. Proly 99.25
PRK08661 477 prolyl-tRNA synthetase; Provisional 99.24
KOG0590|consensus601 99.17
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.15
KOG1163|consensus341 99.13
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.1
KOG1165|consensus449 99.08
PRK09350 306 poxB regulator PoxA; Provisional 99.06
cd00770297 SerRS_core Seryl-tRNA synthetase (SerRS) class II 99.04
PRK12274218 serine/threonine protein kinase; Provisional 99.02
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.01
cd00669 269 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase cl 98.96
KOG1023|consensus484 98.91
KOG1166|consensus974 98.91
smart00090237 RIO RIO-like kinase. 98.88
KOG0606|consensus1205 98.84
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 98.82
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 98.82
PRK10345210 hypothetical protein; Provisional 98.79
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 98.79
PRK14879211 serine/threonine protein kinase; Provisional 98.64
KOG2137|consensus 700 98.62
KOG0195|consensus448 98.61
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 98.58
PRK09605535 bifunctional UGMP family protein/serine/threonine 98.58
PLN02837 614 threonine-tRNA ligase 98.55
cd00777 280 AspRS_core Asp tRNA synthetase (aspRS) class II co 98.53
KOG0601|consensus524 98.53
TIGR00414418 serS seryl-tRNA synthetase. This model represents 98.52
PF01409247 tRNA-synt_2d: tRNA synthetases class II core domai 98.46
PRK04173 456 glycyl-tRNA synthetase; Provisional 98.45
cd00496218 PheRS_alpha_core Phenylalanyl-tRNA synthetase (Phe 98.41
PRK00488339 pheS phenylalanyl-tRNA synthetase subunit alpha; V 98.41
PRK03991 613 threonyl-tRNA synthetase; Validated 98.38
TIGR00468294 pheS phenylalanyl-tRNA synthetase, alpha subunit. 98.37
cd00776 322 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class 98.35
PRK05431425 seryl-tRNA synthetase; Provisional 98.3
KOG1266|consensus458 98.29
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 98.26
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 98.19
COG0442 500 ProS Prolyl-tRNA synthetase [Translation, ribosoma 98.19
PLN02678 448 seryl-tRNA synthetase 98.13
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 98.12
KOG0601|consensus524 98.09
COG0441 589 ThrS Threonyl-tRNA synthetase [Translation, riboso 98.08
PF00152 335 tRNA-synt_2: tRNA synthetases class II (D, K and N 98.05
COG4248 637 Uncharacterized protein with protein kinase and he 98.05
>KOG1035|consensus Back     alignment and domain information
Probab=100.00  E-value=3.3e-58  Score=491.48  Aligned_cols=365  Identities=37%  Similarity=0.566  Sum_probs=285.3

Q ss_pred             hhHHHHHHHHHHHHHHHHHcCCcccCCCCCcEEEccCCCeEEecccchhhhhhh-cCCCccccccCccCCCCCCCCcc-c
Q psy7309           2 GRAWRLLREIIEGLSHIHSQGIIHRDLKPVNIFIDYEDHVKIGDFGLATNILQK-HAGPLARELTGYILPPIDSTAFY-S   79 (454)
Q Consensus         2 ~~i~~i~~qil~gL~~LH~~giiHrDLKp~NILl~~~~~vKL~DFGla~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~-~   79 (454)
                      +++|++|+||++||.|+|++|||||||||.|||++.+++|||+|||+|+..... ......         ........ .
T Consensus       697 d~~wrLFreIlEGLaYIH~~giIHRDLKP~NIFLd~~~~VKIGDFGLAt~~~~~~~~~d~~---------~~~~~~~~g~  767 (1351)
T KOG1035|consen  697 DEAWRLFREILEGLAYIHDQGIIHRDLKPRNIFLDSRNSVKIGDFGLATDLKENLESIDQD---------LSFSTNRAGS  767 (1351)
T ss_pred             HHHHHHHHHHHHHHHHHHhCceeeccCCcceeEEcCCCCeeecccccchhhhhhhhhHhhc---------cCccccccCC
Confidence            478999999999999999999999999999999999999999999999963210 000000         00000011 2


Q ss_pred             CCCCCcCcccccceeccccccccccccccccCCccccchhhhHHHHHHHHHhcceeeeeecCCchhhHHHHHHHhhhcCC
Q psy7309          80 HDTSHTGQVGTALYAAPELDSHGVKAMYNQFTPQNYFSKQQKAFYVEILRVLWGYLKAEVYKDRPKTLEELKHNIRRENG  159 (454)
Q Consensus        80 ~~~~~~~~~gT~~Y~aPE~~~~~~~~~~~~~~~~DiwSl~~~~~~~~~~~~~~G~il~el~~~~~~~~~~l~~~i~~~~~  159 (454)
                      .....|+.+||..|+|||++.......|+.|+  |||||              |+++|||+---....+..         
T Consensus       768 ~~~~~Ts~VGTalYvAPEll~~~~~~~Yn~Ki--DmYSL--------------GIVlFEM~yPF~TsMERa---------  822 (1351)
T KOG1035|consen  768 NDGDLTSQVGTALYVAPELLSDTSSNKYNSKI--DMYSL--------------GIVLFEMLYPFGTSMERA---------  822 (1351)
T ss_pred             CCcccccccceeeeecHHHhcccccccccchh--hhHHH--------------HHHHHHHhccCCchHHHH---------
Confidence            34478889999999999999843334799999  99999              999999543111111111         


Q ss_pred             CCCCchhhhhhhhhccCCCCCCCccccccccccccccccccchhHHHHHHHHhhhcCCCCCCCCChhhhhcCcccccCCC
Q psy7309         160 PSTGSNVQKSLQKFQKSPPSVYREWRSSFEWSTVRNNIKSNFQHFLILIHQQKWCLNHDPSKRPSSEQNLCQPISLEGSS  239 (454)
Q Consensus       160 p~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~li~~~~~~~~L~~dP~~Rpta~e~l~hp~f~~~~~  239 (454)
                              ..+..+. .+..+.+..   |.      ....+...++|     +|||++||++||||.             
T Consensus       823 --------~iL~~LR-~g~iP~~~~---f~------~~~~~~e~slI-----~~Ll~hdP~kRPtA~-------------  866 (1351)
T KOG1035|consen  823 --------SILTNLR-KGSIPEPAD---FF------DPEHPEEASLI-----RWLLSHDPSKRPTAT-------------  866 (1351)
T ss_pred             --------HHHHhcc-cCCCCCCcc---cc------cccchHHHHHH-----HHHhcCCCccCCCHH-------------
Confidence                    0111111 222222211   21      12236677899     999999999999999             


Q ss_pred             CCCCccCccccccCCCCCCCCcchHHHHHHHHHHhcCCCChhHHHHHHHHhCCCCCCccccccccccCC-----chhhHH
Q psy7309         240 SGLSVLGSEQLLTCDHIPPPLVGETVLQDMVRQTLSNPQSKGYKYLVAACFNQKVSPADDITYDISLSR-----SANFSL  314 (454)
Q Consensus       240 ~~~~~~~~~~ll~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~f~q~~~~~~d~~yD~~~~~-----~~~~~~  314 (454)
                               +||+|+++||   ++.++.....+++.+++.+.+....+.+|.+....+.++.||.+...     +-...+
T Consensus       867 ---------eLL~s~llpp---e~~el~~~~~h~~~~~~~k~~~~~~~~~~~q~~~~~~n~~yd~~~~~~~~~~~~~~~l  934 (1351)
T KOG1035|consen  867 ---------ELLNSELLPP---EESELLVFLQHLYIEQLGKAYKNLLQLIFEQEVLEVLNHQYDLDRLSYIQYTEINNEL  934 (1351)
T ss_pred             ---------HHhhccCCCc---cchHHHHHHHHHHHHHHHHHHhchhhHHHHHhhhhhhccccccccccccccchhHHHH
Confidence                     6777777776   66778888898999999999999999999999999999999997731     233348


Q ss_pred             HHHHHHHHHHHHHhcCCccccCCCccccccccccccccEEEEcCCCCeEeeCCCCCHHHHHHHHHcCCCCceeeEeecCc
Q psy7309         315 LESTGDKLRRIFQLHGGAHFQTPLLTPLNSLTATSETTASVMTRGGSIVTLPHDLRIPFARYLAQNGSIVSMKRYCIDRV  394 (454)
Q Consensus       315 ~~~i~~~l~~~f~~~G~~~i~tp~le~~~~~~~~~~~~~~~~d~~G~~~~Lr~d~T~p~aR~~a~~~~~~~~k~~y~g~v  394 (454)
                      ++++++.+.++|++|||+++.||.+-+...-.....+.+.++|.+|.+|.|++|||.||||++++|. ...+|+|++++|
T Consensus       935 ~~~v~e~~~~ifr~Hga~~l~tpp~~~~~~~~~~~~~~v~~ld~sG~~v~Lp~DLr~pfar~vs~N~-~~~~Kry~i~rV 1013 (1351)
T KOG1035|consen  935 REYVVEEVVKIFRKHGAIELETPPLSLRNACAYFSRKAVELLDHSGDVVELPYDLRLPFARYVSRNS-VLSFKRYCISRV 1013 (1351)
T ss_pred             HHHHHHHHHHHHHHhcceeccCCccccccccchhccceeeeecCCCCEEEeeccccchHHHHhhhch-HHHHHHhhhhee
Confidence            9999999999999999999999965544433223468999999999999999999999999999987 899999999999


Q ss_pred             cccCCCCCCccceEEEEEEEEEcCCCCcccHHHHHHHHHHHHHh-CCCCCcEEEcCccc
Q psy7309         395 FRERRVLGFHPRELYECAFDIVTNTPGVLTMGSLRRCLMGSFRR-FNYGNISFAPHPRV  452 (454)
Q Consensus       395 fR~~~~~~g~~rE~~Q~g~eiig~~~~~~~d~e~~~~~~~~l~~-~~~~~~~i~i~~~~  452 (454)
                      ||... .. +|+|++||+|||||++.+ ..|||++.++.|++.. |--+++.|.+||-.
T Consensus      1014 yr~~~-~~-hP~~~~ec~fDii~~t~s-l~~AE~L~vi~Ei~~~~l~~~n~~i~lnH~~ 1069 (1351)
T KOG1035|consen 1014 YRPAI-HN-HPKECLECDFDIIGPTTS-LTEAELLKVIVEITTEILHEGNCDIHLNHAD 1069 (1351)
T ss_pred             ecccc-cC-CCccccceeeeEecCCCC-ccHHHHHHHHHHHHHHHhccCceeEEeChHH
Confidence            99866 44 999999999999999944 9999999999998866 33378999999864



>COG0124 HisS Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02972 Histidyl-tRNA synthetase Back     alignment and domain information
>KOG1936|consensus Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>KOG0661|consensus Back     alignment and domain information
>PRK12292 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>KOG0660|consensus Back     alignment and domain information
>PLN02530 histidine-tRNA ligase Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>PRK12420 histidyl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG0575|consensus Back     alignment and domain information
>CHL00201 syh histidine-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12421 ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>KOG0594|consensus Back     alignment and domain information
>PF13393 tRNA-synt_His: Histidyl-tRNA synthetase; PDB: 3HRI_E 3HRK_A 3LC0_A 1Z7N_A 1Z7M_D 3NET_A 1H4V_B 3OD1_A 4E51_B 3RAC_A Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>TIGR00443 hisZ_biosyn_reg ATP phosphoribosyltransferase, regulatory subunit Back     alignment and domain information
>KOG0663|consensus Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>KOG0600|consensus Back     alignment and domain information
>KOG0658|consensus Back     alignment and domain information
>PRK12295 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>PRK12293 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>cd00773 HisRS-like_core Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>KOG0667|consensus Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>KOG0588|consensus Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>TIGR00442 hisS histidyl-tRNA synthetase Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>COG3705 HisZ ATP phosphoribosyltransferase involved in histidine biosynthesis [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0671|consensus Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>KOG0582|consensus Back     alignment and domain information
>KOG0665|consensus Back     alignment and domain information
>PRK00037 hisS histidyl-tRNA synthetase; Reviewed Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>KOG0579|consensus Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>KOG0666|consensus Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>KOG0669|consensus Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0595|consensus Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0596|consensus Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>KOG0577|consensus Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0662|consensus Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>KOG0983|consensus Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>KOG0589|consensus Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>KOG0192|consensus Back     alignment and domain information
>KOG4645|consensus Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>KOG0664|consensus Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>KOG0670|consensus Back     alignment and domain information
>KOG0574|consensus Back     alignment and domain information
>PRK12294 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>KOG0584|consensus Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>KOG4717|consensus Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>KOG0607|consensus Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG4721|consensus Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>KOG1027|consensus Back     alignment and domain information
>KOG2345|consensus Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>PRK00413 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>KOG1290|consensus Back     alignment and domain information
>KOG0695|consensus Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>KOG0193|consensus Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>KOG0668|consensus Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>KOG1989|consensus Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>KOG0586|consensus Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>KOG1006|consensus Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>KOG1167|consensus Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>KOG0608|consensus Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>KOG0587|consensus Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>PRK12305 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>KOG0576|consensus Back     alignment and domain information
>cd00670 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_tRNA synthetase class II core domain Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>KOG0984|consensus Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd00779 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>KOG1187|consensus Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>cd00771 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class II core catalytic domain Back     alignment and domain information
>KOG1095|consensus Back     alignment and domain information
>KOG1026|consensus Back     alignment and domain information
>KOG1151|consensus Back     alignment and domain information
>TIGR00418 thrS threonyl-tRNA synthetase Back     alignment and domain information
>PRK09194 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>KOG4257|consensus Back     alignment and domain information
>KOG4250|consensus Back     alignment and domain information
>KOG0200|consensus Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>TIGR00409 proS_fam_II prolyl-tRNA synthetase, family II Back     alignment and domain information
>PRK12444 threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>PRK14799 thrS threonyl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG1345|consensus Back     alignment and domain information
>KOG3653|consensus Back     alignment and domain information
>KOG2052|consensus Back     alignment and domain information
>TIGR02367 PylS pyrrolysyl-tRNA synthetase Back     alignment and domain information
>KOG1094|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd00772 ProRS_core Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>cd00774 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-like class II core catalytic domain Back     alignment and domain information
>KOG1152|consensus Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>PF00587 tRNA-synt_2b: tRNA synthetase class II core domain (G, H, P, S and T) This Prosite entry contains all class II enzymes Back     alignment and domain information
>PLN02908 threonyl-tRNA synthetase Back     alignment and domain information
>PRK04172 pheS phenylalanyl-tRNA synthetase subunit alpha; Provisional Back     alignment and domain information
>KOG1025|consensus Back     alignment and domain information
>KOG1033|consensus Back     alignment and domain information
>KOG1024|consensus Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>PRK12325 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK09537 pylS pyrolysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PTZ00326 phenylalanyl-tRNA synthetase alpha chain; Provisional Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG4158|consensus Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>cd00768 class_II_aaRS-like_core Class II tRNA amino-acyl synthetase-like catalytic core domain Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>cd00778 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1164|consensus Back     alignment and domain information
>TIGR00408 proS_fam_I prolyl-tRNA synthetase, family I Back     alignment and domain information
>PRK08661 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>KOG1163|consensus Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>KOG1165|consensus Back     alignment and domain information
>PRK09350 poxB regulator PoxA; Provisional Back     alignment and domain information
>cd00770 SerRS_core Seryl-tRNA synthetase (SerRS) class II core catalytic domain Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>cd00669 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase class II core domain Back     alignment and domain information
>KOG1023|consensus Back     alignment and domain information
>KOG1166|consensus Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG2137|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>PLN02837 threonine-tRNA ligase Back     alignment and domain information
>cd00777 AspRS_core Asp tRNA synthetase (aspRS) class II core domain Back     alignment and domain information
>KOG0601|consensus Back     alignment and domain information
>TIGR00414 serS seryl-tRNA synthetase Back     alignment and domain information
>PF01409 tRNA-synt_2d: tRNA synthetases class II core domain (F); InterPro: IPR002319 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK04173 glycyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00496 PheRS_alpha_core Phenylalanyl-tRNA synthetase (PheRS) alpha chain catalytic core domain Back     alignment and domain information
>PRK00488 pheS phenylalanyl-tRNA synthetase subunit alpha; Validated Back     alignment and domain information
>PRK03991 threonyl-tRNA synthetase; Validated Back     alignment and domain information
>TIGR00468 pheS phenylalanyl-tRNA synthetase, alpha subunit Back     alignment and domain information
>cd00776 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class II core domain Back     alignment and domain information
>PRK05431 seryl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG1266|consensus Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>COG0442 ProS Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02678 seryl-tRNA synthetase Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>KOG0601|consensus Back     alignment and domain information
>COG0441 ThrS Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00152 tRNA-synt_2: tRNA synthetases class II (D, K and N) ; InterPro: IPR004364 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query454
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 1e-32
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 4e-32
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 9e-27
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 6e-23
2a19_B284 Interferon-induced, double-stranded RNA-activated 1e-22
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 3e-19
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 4e-18
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 1e-17
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 5e-17
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 2e-16
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 2e-16
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 2e-16
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 3e-16
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 3e-16
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 4e-16
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 6e-16
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 6e-16
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 7e-16
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 7e-16
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 8e-16
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 9e-16
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 1e-15
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 1e-15
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 2e-15
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 2e-15
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 2e-15
3q4u_A301 Activin receptor type-1; structural genomics conso 2e-15
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 2e-15
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 3e-15
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 3e-15
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 3e-15
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 3e-15
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 5e-15
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 6e-15
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 7e-15
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 7e-15
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 8e-15
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 9e-15
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 1e-14
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 1e-14
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 1e-14
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 1e-14
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 1e-14
3bhy_A283 Death-associated protein kinase 3; death associate 1e-14
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 1e-14
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 1e-14
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 2e-14
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 2e-14
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 2e-14
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 2e-14
3ork_A311 Serine/threonine protein kinase; structural genomi 2e-14
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 2e-14
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 3e-14
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 3e-14
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 3e-14
2y0a_A326 Death-associated protein kinase 1; transferase, ca 3e-14
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 3e-14
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 3e-14
3rp9_A458 Mitogen-activated protein kinase; structural genom 3e-14
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 3e-14
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 3e-14
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 4e-14
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 4e-14
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 4e-14
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 4e-14
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 5e-14
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 5e-14
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 5e-14
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 6e-14
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 6e-14
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 6e-14
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 6e-14
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 6e-14
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 7e-14
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 7e-14
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 8e-14
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 9e-14
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 9e-14
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 9e-14
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 9e-14
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 9e-14
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 1e-13
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 1e-13
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 1e-13
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 1e-13
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 1e-13
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 1e-13
3lij_A494 Calcium/calmodulin dependent protein kinase with A 2e-13
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 2e-13
3dls_A335 PAS domain-containing serine/threonine-protein KI; 2e-13
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 2e-13
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 2e-13
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 2e-13
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 2e-13
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 2e-13
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 2e-13
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 2e-13
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 3e-13
3pvu_A695 Beta-adrenergic receptor kinase 1; transferase, se 3e-13
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 4e-13
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 4e-13
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 4e-13
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 4e-13
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 5e-13
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 5e-13
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 5e-13
3o0g_A292 Cell division protein kinase 5; kinase activator c 6e-13
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 6e-13
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 6e-13
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 7e-13
3niz_A311 Rhodanese family protein; structural genomics, str 8e-13
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 8e-13
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 8e-13
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 8e-13
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 8e-13
2eue_A275 Carbon catabolite derepressing protein kinase; kin 8e-13
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 8e-13
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 9e-13
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 9e-13
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 1e-12
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 1e-12
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 1e-12
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 1e-12
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 1e-12
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 2e-12
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 2e-12
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 2e-12
3soc_A322 Activin receptor type-2A; structural genomics cons 2e-12
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 2e-12
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 2e-12
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 2e-12
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 3e-12
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 3e-12
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 3e-12
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 4e-12
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 4e-12
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 4e-12
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 5e-12
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 5e-12
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 5e-12
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 5e-12
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 5e-12
3aln_A327 Dual specificity mitogen-activated protein kinase; 5e-12
2fst_X367 Mitogen-activated protein kinase 14; active mutant 5e-12
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 6e-12
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 6e-12
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 7e-12
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 8e-12
3eqc_A360 Dual specificity mitogen-activated protein kinase; 8e-12
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 1e-11
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 1e-11
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 1e-11
2dyl_A318 Dual specificity mitogen-activated protein kinase 1e-11
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 1e-11
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 2e-11
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 2e-11
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 2e-11
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 2e-11
3an0_A340 Dual specificity mitogen-activated protein kinase; 2e-11
3net_A 465 Histidyl-tRNA synthetase; aminoacyl-tRNA synthetas 3e-11
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 3e-11
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 3e-11
3fme_A290 Dual specificity mitogen-activated protein kinase; 6e-11
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 2e-10
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 7e-10
3uqc_A286 Probable conserved transmembrane protein; structur 9e-10
3lc0_A 456 Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-t 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 8e-09
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 4e-08
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 6e-08
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 9e-08
3rac_A 373 Histidine-tRNA ligase; structural genomics, PSI-bi 1e-07
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 1e-07
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 2e-07
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 2e-07
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 3e-07
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 3e-07
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 3e-07
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 3e-07
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 5e-07
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 5e-07
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 6e-07
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 7e-07
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 7e-07
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 8e-07
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 1e-06
3lzb_A327 Epidermal growth factor receptor; epidermal growth 1e-06
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 1e-06
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 1e-06
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 1e-06
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 2e-06
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 2e-06
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 2e-06
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 2e-06
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 2e-06
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 2e-06
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 2e-06
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 3e-06
2xir_A316 Vascular endothelial growth factor receptor 2; ang 3e-06
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 3e-06
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 3e-06
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 3e-06
3od1_A 400 ATP phosphoribosyltransferase regulatory subunit; 3e-06
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 4e-06
3pls_A298 Macrophage-stimulating protein receptor; protein k 4e-06
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 4e-06
3poz_A327 Epidermal growth factor receptor; kinase domain, a 4e-06
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 5e-06
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 5e-06
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 5e-06
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 5e-06
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 5e-06
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 6e-06
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 7e-06
3qtc_A290 Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthet 7e-06
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 7e-06
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 8e-06
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 8e-06
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 9e-06
3v5q_A297 NT-3 growth factor receptor; kinase domain, kinase 9e-06
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 9e-06
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 1e-05
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 1e-05
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 1e-05
3zzw_A289 Tyrosine-protein kinase transmembrane receptor RO; 1e-05
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 1e-05
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 2e-05
4aoj_A329 High affinity nerve growth factor receptor; transf 2e-05
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 3e-05
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 3e-05
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 3e-05
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 5e-05
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 5e-05
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 6e-05
1wu7_A 434 Histidyl-tRNA synthetase; ligase, structural genom 7e-05
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 2e-04
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 3e-04
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 3e-04
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
 Score =  124 bits (314), Expect = 1e-32
 Identities = 63/238 (26%), Positives = 89/238 (37%), Gaps = 77/238 (32%)

Query: 3   RAWRLLREIIEGLSHIHSQGIIHRDLKPVNIFIDYEDHVKIGDFGLATNILQKHAGPLAR 62
             WRL R+I+E LS+IHSQGIIHRDLKP+NIFID   +VKIGDFGLA N+ +        
Sbjct: 117 EYWRLFRQILEALSYIHSQGIIHRDLKPMNIFIDESRNVKIGDFGLAKNVHRSLD----- 171

Query: 63  ELTGYILPPIDSTAFYSHDTSHTGQVGTALYAAPELDSHGVKAMYNQFTPQNYFSKQQKA 122
                 +  +DS        + T  +GTA+Y A E+        YN           +K 
Sbjct: 172 ------ILKLDSQNLPGSSDNLTSAIGTAMYVATEVLDG--TGHYN-----------EKI 212

Query: 123 --------FYVEILRVLWGYLKAEVYKDRPKTLEELKHNIRRENGPSTGSNVQKSLQKFQ 174
                   F+                        E+ +        STG      L+K +
Sbjct: 213 DMYSLGIIFF------------------------EMIY------PFSTGMERVNILKKLR 242

Query: 175 KSPPSVYREWRSSFEWSTVRNNIKSNFQHFLILIHQQKWCLNHDPSKRPSSEQNLCQP 232
                                      +  +I     +  ++HDP+KRP +   L   
Sbjct: 243 SVSIEF-----PPDFDDNK-----MKVEKKII-----RLLIDHDPNKRPGARTLLNSG 285


>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Length = 299 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>3net_A Histidyl-tRNA synthetase; aminoacyl-tRNA synthetase, ligase, structural genomics, PSI- nostoc, protein structure initiative; 2.70A {Nostoc SP} Length = 465 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>3lc0_A Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-tRNA synthetase, ligase, structural G medical structural genomics of pathogenic protozoa; HET: HIS; 1.80A {Trypanosoma cruzi} PDB: 3hrk_A* 3hri_A Length = 456 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Length = 352 Back     alignment and structure
>3rac_A Histidine-tRNA ligase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, PSI-BIO; 2.30A {Alicyclobacillus acidocaldarius subsp} Length = 373 Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Length = 364 Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Length = 345 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>3od1_A ATP phosphoribosyltransferase regulatory subunit; structural genomics, PSI-2, protein structure initiative; 1.97A {Bacillus halodurans} Length = 400 Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Length = 336 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>3qtc_A Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP B O-methyl tyrosine binding, magnesium binding, aminoacylatio esterification; HET: 0A1 ANP; 1.75A {Methanosarcina mazei} PDB: 2q7e_A* 2q7g_A* 2q7h_A* 2zim_A* 2zin_A* 2e3c_A* 2zcd_A* 2zce_A* 2zio_A* Length = 290 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Length = 330 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Length = 296 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Length = 298 Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Length = 483 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure
>1wu7_A Histidyl-tRNA synthetase; ligase, structural genomics, dimer; 2.40A {Thermoplasma acidophilum} SCOP: c.51.1.1 d.104.1.1 Length = 434 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query454
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 100.0
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 100.0
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 100.0
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 100.0
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 100.0
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 100.0
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 100.0
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 100.0
4g85_A 517 Histidine-tRNA ligase, cytoplasmic; synthetase; 3. 99.98
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 99.98
3rac_A 373 Histidine-tRNA ligase; structural genomics, PSI-bi 99.97
3od1_A 400 ATP phosphoribosyltransferase regulatory subunit; 99.97
3net_A 465 Histidyl-tRNA synthetase; aminoacyl-tRNA synthetas 99.97
3lc0_A 456 Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-t 99.97
4g84_A 464 Histidine--tRNA ligase, cytoplasmic; synthetase; 2 99.97
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.97
1z7m_A 344 ATP phosphoribosyltransferase regulatory subunit; 99.97
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 99.97
4aoj_A329 High affinity nerve growth factor receptor; transf 99.97
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 99.97
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 99.97
4ase_A353 Vascular endothelial growth factor receptor 2; tra 99.97
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 99.96
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 99.96
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.96
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 99.96
3rp9_A458 Mitogen-activated protein kinase; structural genom 99.96
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.96
1wu7_A 434 Histidyl-tRNA synthetase; ligase, structural genom 99.96
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 99.96
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 99.96
3o0g_A292 Cell division protein kinase 5; kinase activator c 99.96
4e51_A 467 Histidine--tRNA ligase; seattle structural genomic 99.96
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 99.96
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 99.96
1h4v_B 421 Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA 99.96
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 99.96
1htt_A 423 Histidyl-tRNA synthetase; complex (tRNA synthetase 99.96
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 99.96
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 99.96
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.96
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.96
3niz_A311 Rhodanese family protein; structural genomics, str 99.96
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 99.96
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 99.96
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 99.96
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.95
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.95
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.95
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 99.95
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.95
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.95
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 99.95
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.95
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.95
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.95
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 99.95
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 99.95
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.95
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 99.95
2fst_X367 Mitogen-activated protein kinase 14; active mutant 99.95
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 99.95
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.95
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.95
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.95
2eue_A275 Carbon catabolite derepressing protein kinase; kin 99.95
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 99.95
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 99.95
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.95
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 99.95
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 99.95
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 99.95
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.95
2y0a_A326 Death-associated protein kinase 1; transferase, ca 99.95
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 99.95
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 99.95
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 99.95
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.95
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.95
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 99.95
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 99.95
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 99.95
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 99.95
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 99.95
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.95
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 99.94
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 99.94
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 99.94
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 99.94
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 99.94
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 99.94
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.94
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 99.94
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.94
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 99.94
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 99.94
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 99.94
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 99.94
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 99.94
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 99.94
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.94
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.94
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.94
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 99.94
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 99.94
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.94
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 99.94
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.94
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 99.94
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 99.94
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.94
3dls_A335 PAS domain-containing serine/threonine-protein KI; 99.94
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.94
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 99.94
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 99.94
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 99.94
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 99.94
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 99.94
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 99.94
3fme_A290 Dual specificity mitogen-activated protein kinase; 99.94
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.94
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 99.94
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 99.94
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.94
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 99.94
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 99.94
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 99.94
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.94
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 99.94
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.94
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 99.94
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 99.94
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.94
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.94
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 99.93
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 99.93
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 99.93
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 99.93
1usy_A 275 ATP phosphoribosyltransferase regulatory subunit; 99.93
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 99.93
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 99.93
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 99.93
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.93
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.93
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.93
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 99.93
3aln_A327 Dual specificity mitogen-activated protein kinase; 99.93
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.93
3an0_A340 Dual specificity mitogen-activated protein kinase; 99.93
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 99.93
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.93
3bhy_A283 Death-associated protein kinase 3; death associate 99.93
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 99.93
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 99.93
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 99.93
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.93
3ork_A311 Serine/threonine protein kinase; structural genomi 99.93
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.93
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 99.93
1qe0_A 420 Histidyl-tRNA synthetase; class II tRNA synthetase 99.93
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 99.93
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 99.93
2dyl_A318 Dual specificity mitogen-activated protein kinase 99.93
3poz_A327 Epidermal growth factor receptor; kinase domain, a 99.93
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.93
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.93
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 99.93
3eqc_A360 Dual specificity mitogen-activated protein kinase; 99.92
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 99.92
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 99.92
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 99.92
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.92
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 99.92
3lzb_A327 Epidermal growth factor receptor; epidermal growth 99.92
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.92
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 99.92
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 99.92
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.92
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.92
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.92
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 99.92
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.92
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.92
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.92
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.92
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.91
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.91
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.91
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.91
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 99.91
3pls_A298 Macrophage-stimulating protein receptor; protein k 99.91
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 99.91
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.91
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 99.91
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 99.91
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.91
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.91
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.91
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.91
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 99.91
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.91
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.91
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.91
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 99.91
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.91
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.91
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.91
3q4u_A301 Activin receptor type-1; structural genomics conso 99.91
2xir_A316 Vascular endothelial growth factor receptor 2; ang 99.91
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.91
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.9
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 99.9
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.9
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 99.9
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.9
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.9
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.9
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.9
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.9
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.9
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.9
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.9
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.9
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.9
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 99.9
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 99.9
3soc_A322 Activin receptor type-2A; structural genomics cons 99.9
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.9
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 99.9
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 99.9
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 99.9
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.9
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.9
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 99.9
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 99.9
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.9
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 99.9
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.9
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.9
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 99.9
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.89
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.89
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.89
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.89
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.89
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 99.89
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.89
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.89
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.89
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.89
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 99.89
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.88
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.88
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 99.88
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 99.88
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 99.88
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 99.88
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 99.87
3a32_A 471 Probable threonyl-tRNA synthetase 1; aeropyrum per 99.87
2i4l_A 458 Proline-tRNA ligase; alpha beta; 2.00A {Rhodopseud 99.86
1nyr_A 645 Threonyl-tRNA synthetase 1; ATP, threonine, ligase 99.85
1evl_A 401 Threonyl-tRNA synthetase; amino acid recognition, 99.84
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.83
2j3l_A 572 Prolyl-tRNA synthetase; class II aminoacyl- T synt 99.83
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.83
1hc7_A 477 Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, 99.83
1nj8_A 459 Proline-tRNA synthetase, proline--tRNA ligase; cla 99.81
1qf6_A 642 THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, m 99.76
3uh0_A 460 Threonyl-tRNA synthetase, mitochondrial; threonine 99.73
3uqc_A286 Probable conserved transmembrane protein; structur 99.72
1nj1_A 501 PROR, proline-tRNA synthetase, proline--tRNA ligas 99.72
3ial_A 518 Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, 99.61
3dsq_A288 Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-t 99.57
4hvc_A 519 Bifunctional glutamate/proline--tRNA ligase; ligas 99.56
2zt5_A 693 Glycyl-tRNA synthetase; ligase, AP4A, glycine, ATP 99.55
2dq3_A425 Seryl-tRNA synthetase; coiled-coil, homodimer, str 99.53
1ati_A 505 Glycyl-tRNA synthetase; protein biosynthesis, liga 99.51
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.5
3qtc_A290 Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthet 99.43
1ses_A421 Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A 99.35
2dq0_A 455 Seryl-tRNA synthetase; coiled-coil, homodimer, str 99.34
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.34
1nnh_A 294 Asparaginyl-tRNA synthetase-related peptide; struc 99.22
2cja_A 522 Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE 99.19
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 99.06
1x54_A 434 Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthe 99.06
1wyd_A 429 Hypothetical aspartyl-tRNA synthetase; archaea, LI 98.99
1n9w_A 422 Aspartyl-tRNA synthetase 2; biosynthetic protein; 98.99
3vbb_A 522 Seryl-tRNA synthetase, cytoplasmic; coiled-coil, l 98.91
1eov_A 487 ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA sy 98.88
1wle_A 501 Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo 98.87
3a74_A 493 Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, 98.76
3qne_A 485 Seryl-tRNA synthetase, cytoplasmic; amino acid bio 98.72
3lss_A 484 Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, 98.71
4gyi_A397 RIO2 kinase; protein kinase, ADP complex, phosphoa 98.64
1e1o_A 504 Lysyl-tRNA synthetase, heat inducible; ligase, ami 98.57
3err_A 536 Fusion protein of microtubule binding domain from 98.52
3a5y_A 345 GENX, putative lysyl-tRNA synthetase; aminoacyl-tR 98.5
1b7y_A350 Phers, protein (phenylalanyl-tRNA synthetase); enz 98.47
3l4g_A508 Phenylalanyl-tRNA synthetase alpha chain; aminoacy 98.42
2du3_A 534 O-phosphoseryl-tRNA synthetase; alpha4 tetramer, l 98.37
2xgt_A 435 Asparaginyl-tRNA synthetase, cytoplasmic; ligase, 98.35
3nem_A 438 Aspartyl-tRNA synthetase; rossmann fold, OB fold, 98.23
2rhq_A294 Phenylalanyl-tRNA synthetase alpha chain; heterote 98.02
2du7_A 549 O-phosphoseryl-tRNA synthetase; alpha4 tetramer, l 98.01
3mf2_A 346 BLL0957 protein; aminoacyl-tRNA synthetase, seryl- 97.98
3m4p_A 456 Ehasnrs, asparaginyl-tRNA synthetase, putative; am 97.97
1g5h_A 454 Mitochondrial DNA polymerase accessory subunit; in 97.93
3bju_A 521 Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, 97.93
4ex5_A 529 Lysine--tRNA ligase; structural genomics, niaid, n 97.92
1c0a_A 585 Aspartyl tRNA synthetase; protein-RNA complex, lig 97.92
1l0w_A 580 Aspartyl-tRNA synthetase; space-grown crystal, dim 97.89
3pco_A327 Phenylalanyl-tRNA synthetase, alpha subunit; amino 97.81
4ah6_A 617 Aspartate--tRNA ligase, mitochondrial; 3.70A {Homo 97.74
3i7f_A 548 Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-bi 97.7
2odr_B 648 Phosphoseryl-tRNA synthetase; phosphoserine tRNA s 97.66
2odr_A 665 Phosphoseryl-tRNA synthetase; phosphoserine tRNA s 97.65
2odr_D 685 Phosphoseryl-tRNA synthetase; phosphoserine tRNA s 97.64
2odr_C 701 Phosphoseryl-tRNA synthetase; phosphoserine tRNA s 97.61
3ica_A213 Phenylalanyl-tRNA synthetase beta chain; APC61692. 97.51
3ig2_A213 Phenylalanyl-tRNA synthetase beta chain; phers, MC 97.48
3l4g_B589 Phenylalanyl-tRNA synthetase beta chain; aminoacyl 97.43
3ikl_A 459 DNA polymerase subunit gamma-2, mitochondrial; tra 97.36
1nd4_A264 Aminoglycoside 3'-phosphotransferase; protein kina 97.3
3tm0_A263 Aminoglycoside 3'-phosphotransferase; protein kina 97.25
3dxp_A359 Putative acyl-COA dehydrogenase; protein kinase-li 97.05
2rhq_B 795 Phenylalanyl-tRNA synthetase beta chain; heterotet 96.87
1b7y_B 785 Phers, protein (phenylalanyl-tRNA synthetase); enz 96.21
2q83_A346 YTAA protein; 2635576, structural genomics, joint 96.05
3sg8_A304 APH(2'')-ID; antibiotic resistance enzyme, transfe 95.8
3r70_A320 Aminoglycoside phosphotransferase; structural geno 95.2
2pyw_A420 Uncharacterized protein; 5-methylthioribose kinase 94.85
3cmq_A 415 Phenylalanyl-tRNA synthetase, mitochondrial; class 94.82
3pco_B 795 Phenylalanyl-tRNA synthetase, beta chain; aminoacy 94.08
2ppq_A322 HSK, HK, homoserine kinase; structural genomics, M 92.61
1zyl_A328 Hypothetical protein YIHE; putative protein kinase 92.58
3tdw_A306 Gentamicin resistance protein; kinase, phosphoryl 92.31
3csv_A333 Aminoglycoside phosphotransferase; YP_614837.1, ph 92.25
3ats_A357 Putative uncharacterized protein; hypothetical pro 91.79
4gkh_A272 Aminoglycoside 3'-phosphotransferase APHA1-IAB; py 90.59
3c5i_A369 Choline kinase; choline, kinase, malaria, transfer 90.36
3ovc_A362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 89.71
3i1a_A339 Spectinomycin phosphotransferase; protein kinase, 89.16
2olc_A397 MTR kinase, methylthioribose kinase; kinase ADP-2H 88.64
2qg7_A458 Ethanolamine kinase PV091845; malaria, SGC, struct 86.75
1nw1_A429 Choline kinase (49.2 KD); phospholipid synthesis, 86.23
3f2s_A401 CK, chetk-alpha, choline kinase alpha; non-protein 86.12
3dxq_A301 Choline/ethanolamine kinase family protein; NP_106 85.64
2yle_A229 Protein spire homolog 1; actin-binding protein, ac 83.38
3feg_A379 Choline/ethanolamine kinase; non-protein kinase, c 83.36
3d1u_A288 Putative fructosamine-3-kinase; YP_290396.1, struc 82.73
3g15_A401 CK, chetk-alpha, choline kinase alpha; non-protein 80.69
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
Probab=100.00  E-value=9.4e-38  Score=310.97  Aligned_cols=163  Identities=24%  Similarity=0.400  Sum_probs=131.4

Q ss_pred             hhHHHHHHHHHHHHHHHHHcCCcccCCCCCcEEEccCCCeEEecccchhhhhhhcCCCccccccCccCCCCCCCCcccCC
Q psy7309           2 GRAWRLLREIIEGLSHIHSQGIIHRDLKPVNIFIDYEDHVKIGDFGLATNILQKHAGPLARELTGYILPPIDSTAFYSHD   81 (454)
Q Consensus         2 ~~i~~i~~qil~gL~~LH~~giiHrDLKp~NILl~~~~~vKL~DFGla~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (454)
                      ++++.+++||+.||+|||++|||||||||+|||++.+|++||+|||+|+.+.                         ...
T Consensus       170 ~~~~~~~~qi~~aL~ylH~~~IiHRDlKp~NILl~~~g~vKl~DFGla~~~~-------------------------~~~  224 (346)
T 4fih_A          170 EQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVS-------------------------KEV  224 (346)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTTEECCCCSGGGEEECTTCCEEECCCTTCEECC-------------------------SSS
T ss_pred             HHHHHHHHHHHHHHHHHHHCCcccccCCHHHEEECCCCCEEEecCcCceecC-------------------------CCC
Confidence            4689999999999999999999999999999999999999999999998653                         122


Q ss_pred             CCCcCcccccceeccccccccccccccccCCccccchhhhHHHHHHHHHhcceeeeeecCCchhhHHHHHHHhhhcCCCC
Q psy7309          82 TSHTGQVGTALYAAPELDSHGVKAMYNQFTPQNYFSKQQKAFYVEILRVLWGYLKAEVYKDRPKTLEELKHNIRRENGPS  161 (454)
Q Consensus        82 ~~~~~~~gT~~Y~aPE~~~~~~~~~~~~~~~~DiwSl~~~~~~~~~~~~~~G~il~el~~~~~~~~~~l~~~i~~~~~p~  161 (454)
                      ...++.+||+.|||||++.   +..|+.++  ||||+              ||++|||++|++               ||
T Consensus       225 ~~~~~~~GTp~YmAPEvl~---~~~y~~~~--DiWSl--------------Gvilyeml~G~~---------------PF  270 (346)
T 4fih_A          225 PRRKSLVGTPYWMAPELIS---RLPYGPEV--DIWSL--------------GIMVIEMVDGEP---------------PY  270 (346)
T ss_dssp             CCBCCCCSCGGGCCHHHHT---TCCBCTHH--HHHHH--------------HHHHHHHHHSSC---------------TT
T ss_pred             CcccccccCcCcCCHHHHC---CCCCCcHH--HHHHH--------------HHHHHHHHHCCC---------------CC
Confidence            3456689999999999998   67899999  99999              999999877654               45


Q ss_pred             CCchhhhhhhhhccCCCCCCCccccccccccccccccccchhHHHHHHHHhhhcCCCCCCCCChhhhhcCcccccCCC
Q psy7309         162 TGSNVQKSLQKFQKSPPSVYREWRSSFEWSTVRNNIKSNFQHFLILIHQQKWCLNHDPSKRPSSEQNLCQPISLEGSS  239 (454)
Q Consensus       162 ~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~li~~~~~~~~L~~dP~~Rpta~e~l~hp~f~~~~~  239 (454)
                      .+.+..+.+..+.....+.++..           ...++++.+||     .+||+.||++|||++|+|+||||.+...
T Consensus       271 ~~~~~~~~~~~i~~~~~~~~~~~-----------~~~s~~~~dli-----~~~L~~dP~~R~ta~e~l~Hp~~~~~~~  332 (346)
T 4fih_A          271 FNEPPLKAMKMIRDNLPPRLKNL-----------HKVSPSLKGFL-----DRLLVRDPAQRATAAELLKHPFLAKAGP  332 (346)
T ss_dssp             TTSCHHHHHHHHHHSSCCCCSCG-----------GGSCHHHHHHH-----HHHSCSSTTTSCCHHHHTTCGGGGGCCC
T ss_pred             CCcCHHHHHHHHHcCCCCCCCcc-----------ccCCHHHHHHH-----HHHcCCChhHCcCHHHHhcCHhhcCCCC
Confidence            55554555555543333332222           12347788999     9999999999999999999999997654



>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>4g85_A Histidine-tRNA ligase, cytoplasmic; synthetase; 3.11A {Homo sapiens} Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3rac_A Histidine-tRNA ligase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, PSI-BIO; 2.30A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3od1_A ATP phosphoribosyltransferase regulatory subunit; structural genomics, PSI-2, protein structure initiative; 1.97A {Bacillus halodurans} Back     alignment and structure
>3net_A Histidyl-tRNA synthetase; aminoacyl-tRNA synthetase, ligase, structural genomics, PSI- nostoc, protein structure initiative; 2.70A {Nostoc SP} Back     alignment and structure
>3lc0_A Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-tRNA synthetase, ligase, structural G medical structural genomics of pathogenic protozoa; HET: HIS; 1.80A {Trypanosoma cruzi} PDB: 3hrk_A* 3hri_A Back     alignment and structure
>4g84_A Histidine--tRNA ligase, cytoplasmic; synthetase; 2.40A {Homo sapiens} Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>1z7m_A ATP phosphoribosyltransferase regulatory subunit; ATP-PRT, histidine biosynthesis, hiszg, alloste evolution; 2.90A {Lactococcus lactis} SCOP: d.104.1.1 PDB: 1z7n_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>1wu7_A Histidyl-tRNA synthetase; ligase, structural genomics, dimer; 2.40A {Thermoplasma acidophilum} SCOP: c.51.1.1 d.104.1.1 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>4e51_A Histidine--tRNA ligase; seattle structural genomics center for infectious disease, S aminoacylation, tRNA activation, charged tRNA; HET: HIS; 2.65A {Burkholderia thailandensis} Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>1h4v_B Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA synthetase, ATP + L-histidine tRNA(His)-> AMP + PPI + L-histidyl-tRNA(His); 2.4A {Thermus thermophilus} SCOP: c.51.1.1 d.104.1.1 PDB: 1ady_A* 1adj_A Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>1htt_A Histidyl-tRNA synthetase; complex (tRNA synthetase/His-adenylate), aminoacyl-tRNA synthase, ligase; HET: HIS AMP; 2.60A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1kmm_A* 1kmn_A* 2el9_A* Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>1usy_A ATP phosphoribosyltransferase regulatory subunit; aminoacyl-tRNA synthetase; HET: HIS; 2.52A {Thermotoga maritima} SCOP: d.104.1.1 PDB: 1usy_C* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>1qe0_A Histidyl-tRNA synthetase; class II tRNA synthetase, beta sheet, ligase; 2.70A {Staphylococcus aureus} SCOP: c.51.1.1 d.104.1.1 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>3a32_A Probable threonyl-tRNA synthetase 1; aeropyrum pernix K1, protein biosynthesis, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; 2.30A {Aeropyrum pernix} PDB: 3a31_A Back     alignment and structure
>2i4l_A Proline-tRNA ligase; alpha beta; 2.00A {Rhodopseudomonas palustris} PDB: 2i4m_A* 2i4n_A* 2i4o_A* Back     alignment and structure
>1nyr_A Threonyl-tRNA synthetase 1; ATP, threonine, ligase; HET: ATP; 2.80A {Staphylococcus aureus} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 PDB: 1nyq_A* Back     alignment and structure
>1evl_A Threonyl-tRNA synthetase; amino acid recognition, zinc ION, adenylate analog, deletion mutant, ligase; HET: TSB; 1.55A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1evk_A* 1fyf_A* 1kog_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2j3l_A Prolyl-tRNA synthetase; class II aminoacyl- T synthetase, editing, translation; HET: P5A; 2.3A {Enterococcus faecalis} PDB: 2j3m_A* Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>1hc7_A Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP + L-proline + tRNA(Pro) AMP + PPI + L-prolyl-tRNA(Pro); 2.43A {Thermus thermophilus} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1h4q_A* 1h4t_A 1h4s_A Back     alignment and structure
>1nj8_A Proline-tRNA synthetase, proline--tRNA ligase; class-II tRNA synthetase; 3.20A {Methanocaldococcus jannaschii} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 Back     alignment and structure
>1qf6_A THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, mRNA, aminoacylati translational regulation, protein/RNA, ligase-RNA complex; HET: H2U AET G7M 5MU PSU AMP; 2.90A {Escherichia coli} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 Back     alignment and structure
>3uh0_A Threonyl-tRNA synthetase, mitochondrial; threonine tRNA, threonyl ADE threonyl sulfamoyl adenylate; HET: TSB; 2.00A {Saccharomyces cerevisiae} PDB: 3ugt_A 3ugq_A* 4eo4_A* Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>1nj1_A PROR, proline-tRNA synthetase, proline--tRNA ligase; protein-aminoacyladenylate complex class-II tRNA synthetase,; HET: 5CA; 2.55A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1nj2_A 1nj5_A* 1nj6_A* Back     alignment and structure
>3ial_A Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, prors, cysrs, RS, translation, ATP-binding, nucleotide-binding; HET: PR8; 2.20A {Giardia lamblia atcc 50803} Back     alignment and structure
>3dsq_A Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-tRNA synthetase, ligase; 2.10A {Desulfitobacterium hafniense} PDB: 2znj_A 2zni_A Back     alignment and structure
>4hvc_A Bifunctional glutamate/proline--tRNA ligase; ligase-ligase inhibitor complex; HET: ANP HFG; 2.00A {Homo sapiens} Back     alignment and structure
>2zt5_A Glycyl-tRNA synthetase; ligase, AP4A, glycine, ATP, Gly-AMP, aminoacyl-tRNA synthetase, ATP-binding, charcot-marie-tooth disease, disease mutation; HET: B4P; 2.50A {Homo sapiens} PDB: 2pme_A* 2zt6_A* 2zt7_A* 2zt8_A* 2zxf_A* 2pmf_A 2q5h_A 2q5i_A Back     alignment and structure
>2dq3_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, nationa on protein structural and functional analyses; HET: SSA; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1ati_A Glycyl-tRNA synthetase; protein biosynthesis, ligase, aminoacyl-tRNA SYN; 2.75A {Thermus thermophilus} SCOP: c.51.1.1 d.104.1.1 PDB: 1b76_A* 1ggm_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>3qtc_A Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP B O-methyl tyrosine binding, magnesium binding, aminoacylatio esterification; HET: 0A1 ANP; 1.75A {Methanosarcina mazei} PDB: 2q7e_A* 2q7g_A* 2q7h_A* 2zim_A* 2zin_A* 2e3c_A* 2zcd_A* 2zce_A* 2zio_A* 3vqv_A* 3vqw_A* 3vqx_A* 3vqy_A* Back     alignment and structure
>1ses_A Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A {Thermus thermophilus} SCOP: a.2.7.1 d.104.1.1 PDB: 1ser_A* 1set_A* 1sry_A Back     alignment and structure
>2dq0_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SSA; 2.60A {Pyrococcus horikoshii} PDB: 2dq1_A* 2dq2_A 2zr2_A* 2zr3_A Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>1nnh_A Asparaginyl-tRNA synthetase-related peptide; structural genomics, PSI, protein structure initiative, southeast COLL for structural genomics; 1.65A {Pyrococcus furiosus} SCOP: d.104.1.1 PDB: 3p8t_A 3p8v_A 3p8y_A 3reu_A* 3rex_A* 3rl6_A* Back     alignment and structure
>2cja_A Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE ATP; 2.2A {Methanosarcina barkeri} PDB: 2cim_A* 2cj9_A* 2cjb_A Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>1x54_A Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics, ligase; HET: 4AD; 1.45A {Pyrococcus horikoshii} PDB: 1x55_A* 1x56_A Back     alignment and structure
>1wyd_A Hypothetical aspartyl-tRNA synthetase; archaea, LIGA; HET: EPE; 2.30A {Sulfolobus tokodaii} Back     alignment and structure
>1n9w_A Aspartyl-tRNA synthetase 2; biosynthetic protein; 2.30A {Thermus thermophilus} SCOP: b.40.4.1 d.104.1.1 PDB: 3kfu_A* Back     alignment and structure
>3vbb_A Seryl-tRNA synthetase, cytoplasmic; coiled-coil, ligase; 2.89A {Homo sapiens} Back     alignment and structure
>1eov_A ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA synthetase, tRNA ligase, APO-enzyme, OB-fold,; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.1 d.104.1.1 PDB: 1asy_A* 1asz_A* Back     alignment and structure
>1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} Back     alignment and structure
>3a74_A Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, ligase, protein biosynthesis, AMI tRNA synthetase, ATP-binding, magnesium; HET: B4P LYN; 1.80A {Geobacillus stearothermophilus} PDB: 3e9h_A* 3e9i_A* Back     alignment and structure
>3qne_A Seryl-tRNA synthetase, cytoplasmic; amino acid biosynthesis, CTG-clade, codon ambiguity, pathoge II aminoacyl-tRNA synthetase family; 2.00A {Candida albicans} PDB: 3qo7_A* 3qo8_A* 3qo5_A Back     alignment and structure
>3lss_A Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, serrs, translation, ATP-binding, nucleotide-binding, structural genomics; HET: ATP; 1.95A {Trypanosoma brucei} PDB: 3lsq_A* Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>1e1o_A Lysyl-tRNA synthetase, heat inducible; ligase, aminoacyl-tRNA synthetase, protein biosynthesis; HET: LYS; 2.12A {Escherichia coli} SCOP: b.40.4.1 d.104.1.1 PDB: 1e1t_A* 1e22_A* 1e24_A* 1lyl_A 1bbu_A* 1bbw_A 1krs_A 1krt_A Back     alignment and structure
>3err_A Fusion protein of microtubule binding domain from mouse cytoplasmic dynein and seryl-tRNA...; coiled coil, ligase; HET: AMP; 2.27A {Mus musculus} PDB: 3j1t_A 3j1u_A Back     alignment and structure
>3a5y_A GENX, putative lysyl-tRNA synthetase; aminoacyl-tRNA synthetase paralog, translation, lysyl- synthetase, lysyladenylate analog; HET: KAA; 1.90A {Escherichia coli} PDB: 3a5z_A* 3g1z_A* Back     alignment and structure
>1b7y_A Phers, protein (phenylalanyl-tRNA synthetase); enzyme, alpha/beta homodimer, ligase; HET: FYA; 2.50A {Thermus thermophilus} SCOP: d.104.1.1 PDB: 1b70_A* 1eiy_A 1jjc_A* 1pys_A 2iy5_A* 3hfz_A* 3teh_A* 2aly_A* 2akw_A* 2amc_A* Back     alignment and structure
>3l4g_A Phenylalanyl-tRNA synthetase alpha chain; aminoacylation, tRNA-binding, DNA-binding domain, four-helix acetylation, aminoacyl-tRNA synthetase; HET: PHE; 3.30A {Homo sapiens} Back     alignment and structure
>2du3_A O-phosphoseryl-tRNA synthetase; alpha4 tetramer, ligase/RNA complex; HET: SEP; 2.60A {Archaeoglobus fulgidus} PDB: 2du4_A 2du5_A* 2du6_A* Back     alignment and structure
>2xgt_A Asparaginyl-tRNA synthetase, cytoplasmic; ligase, ATP-binding, protein biosynthesis; HET: NSS; 1.90A {Brugia malayi} PDB: 2xti_A* Back     alignment and structure
>3nem_A Aspartyl-tRNA synthetase; rossmann fold, OB fold, ligase; HET: AMO ATP; 1.89A {Thermococcus kodakarensis} PDB: 3nel_A* 3nen_A 1b8a_A* Back     alignment and structure
>2rhq_A Phenylalanyl-tRNA synthetase alpha chain; heterotetramer, phenylalanine, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; HET: GAX; 2.20A {Staphylococcus haemolyticus} PDB: 2rhs_A* Back     alignment and structure
>2du7_A O-phosphoseryl-tRNA synthetase; alpha4 tetramer, ligase, structural genomics, NPPSFA; 3.60A {Methanocaldococcus jannaschii} Back     alignment and structure
>3mf2_A BLL0957 protein; aminoacyl-tRNA synthetase, seryl-tRNA synthetase, zinc ION, amino acid:[carrier protein] ligase; HET: AMP; 2.15A {Bradyrhizobium japonicum} PDB: 3mey_A* 3mf1_A* 3pzc_A* Back     alignment and structure
>3m4p_A Ehasnrs, asparaginyl-tRNA synthetase, putative; aminoacyl-tRNA synthetase, tRNA ligase, AARS, translation, ATP-binding, nucleotide-binding; HET: 4AD; 2.83A {Entamoeba histolytica} PDB: 3m4q_A Back     alignment and structure
>1g5h_A Mitochondrial DNA polymerase accessory subunit; intermolecular four helix bundle, DNA binding protein; 1.95A {Mus musculus} SCOP: c.51.1.1 d.104.1.1 PDB: 1g5i_A 2g4c_A* 3ikm_B* Back     alignment and structure
>3bju_A Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP- binding, cytoplasm, ligase, nucleotide-binding, phosphoprotein, polymorphism; HET: LYS ATP; 2.31A {Homo sapiens} Back     alignment and structure
>4ex5_A Lysine--tRNA ligase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LYS; 2.40A {Burkholderia thailandensis} Back     alignment and structure
>1c0a_A Aspartyl tRNA synthetase; protein-RNA complex, ligase/RNA complex; HET: 4SU H2U QUO G7M 5MU PSU AMP AMO; 2.40A {Escherichia coli} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1il2_A* 1eqr_A* Back     alignment and structure
>1l0w_A Aspartyl-tRNA synthetase; space-grown crystal, dimeric enzyme, flexible domains, ligase; 2.01A {Thermus thermophilus} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1efw_A* 1g51_A Back     alignment and structure
>3pco_A Phenylalanyl-tRNA synthetase, alpha subunit; aminoacylation, tRNA-binding, DNA-binding domain, four-helix aminoacyl-tRNA synthetase, ATP-binding; HET: PHE AMP; 3.02A {Escherichia coli} Back     alignment and structure
>4ah6_A Aspartate--tRNA ligase, mitochondrial; 3.70A {Homo sapiens} Back     alignment and structure
>3i7f_A Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-binding, aminoacyl-tRNA synthetase, LI nucleotide-binding, protein biosynthesis; 2.80A {Entamoeba histolytica} Back     alignment and structure
>2odr_B Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis} Back     alignment and structure
>2odr_A Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis} Back     alignment and structure
>2odr_D Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis} Back     alignment and structure
>2odr_C Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis} Back     alignment and structure
>3ica_A Phenylalanyl-tRNA synthetase beta chain; APC61692.1, phenylalanyl-tRNA SYNT beta subunit, structural genomics, PSI-2; HET: TAM; 2.44A {Porphyromonas gingivalis} Back     alignment and structure
>3ig2_A Phenylalanyl-tRNA synthetase beta chain; phers, MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.09A {Bacteroides fragilis} Back     alignment and structure
>3l4g_B Phenylalanyl-tRNA synthetase beta chain; aminoacylation, tRNA-binding, DNA-binding domain, four-helix acetylation, aminoacyl-tRNA synthetase; HET: PHE; 3.30A {Homo sapiens} Back     alignment and structure
>3ikl_A DNA polymerase subunit gamma-2, mitochondrial; transferase; HET: DNA; 3.10A {Homo sapiens} Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>2rhq_B Phenylalanyl-tRNA synthetase beta chain; heterotetramer, phenylalanine, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; HET: GAX; 2.20A {Staphylococcus haemolyticus} PDB: 2rhs_B* Back     alignment and structure
>1b7y_B Phers, protein (phenylalanyl-tRNA synthetase); enzyme, alpha/beta homodimer, ligase; HET: FYA; 2.50A {Thermus thermophilus} SCOP: a.6.1.1 a.6.1.1 b.40.4.4 b.153.1.1 d.58.13.1 d.104.1.1 PDB: 1b70_B* 1eiy_B 1jjc_B* 1pys_B 2akw_B* 2aly_B* 2amc_B* 3hfz_B* 3teh_B* 2iy5_B* Back     alignment and structure
>2q83_A YTAA protein; 2635576, structural genomics, joint center for structu genomics, JCSG, protein structure initiative, PSI-2, transf; HET: ADN CIT UNL; 2.50A {Bacillus subtilis} Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure
>2pyw_A Uncharacterized protein; 5-methylthioribose kinase, plant methionine recycling, refol transferase; HET: SR1 ADP; 1.90A {Arabidopsis thaliana} Back     alignment and structure
>3cmq_A Phenylalanyl-tRNA synthetase, mitochondrial; classii aarss fold, RRM domain, RNA recogntion, aminoacyl-tRNA synthetase, ATP-binding, ligase; HET: FA5; 2.20A {Homo sapiens} PDB: 3hfv_A* 3teg_A* 3tup_A Back     alignment and structure
>3pco_B Phenylalanyl-tRNA synthetase, beta chain; aminoacylation, tRNA-binding, DNA-binding domain, four-helix aminoacyl-tRNA synthetase, ATP-binding; HET: PHE AMP; 3.02A {Escherichia coli} Back     alignment and structure
>2ppq_A HSK, HK, homoserine kinase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: d.144.1.6 Back     alignment and structure
>1zyl_A Hypothetical protein YIHE; putative protein kinase, structural genomics, PSI, protein structure initiative; 2.80A {Escherichia coli} SCOP: d.144.1.6 Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>3csv_A Aminoglycoside phosphotransferase; YP_614837.1, phosphotransferase enzyme family, structural genomics, JOIN for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>3ats_A Putative uncharacterized protein; hypothetical protein, putative aminoglycoside phosphortransf transferase; 1.67A {Mycobacterium tuberculosis} PDB: 3att_A* Back     alignment and structure
>4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* Back     alignment and structure
>3c5i_A Choline kinase; choline, kinase, malaria, transferase, structural genomics, structural genomics consortium; 2.20A {Plasmodium knowlesi} PDB: 3fi8_A* Back     alignment and structure
>3i1a_A Spectinomycin phosphotransferase; protein kinase, aminoglycoside phosphotransferase, antibiotic resistance; HET: MES PG4; 1.70A {Legionella pneumophila} PDB: 3i0q_A* 3i0o_A* 3q2m_A* Back     alignment and structure
>2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* Back     alignment and structure
>2qg7_A Ethanolamine kinase PV091845; malaria, SGC, structural genomics consortium, transferase; 2.41A {Plasmodium vivax} Back     alignment and structure
>1nw1_A Choline kinase (49.2 KD); phospholipid synthesis, protein kinase fold, transferase; 2.02A {Caenorhabditis elegans} SCOP: d.144.1.8 Back     alignment and structure
>3dxq_A Choline/ethanolamine kinase family protein; NP_106042.1, STR genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 2.55A {Mesorhizobium loti} Back     alignment and structure
>2yle_A Protein spire homolog 1; actin-binding protein, actin polymerization; 1.80A {Homo sapiens} PDB: 2ylf_A 3r7g_A 3rbw_A Back     alignment and structure
>3feg_A Choline/ethanolamine kinase; non-protein kinase, choline kinase, structural genomics CONS SGC, hemicholinium-3, phosphorylation; HET: HC7 ADP AMP; 1.30A {Homo sapiens} PDB: 3lq3_A* 2ig7_A* Back     alignment and structure
>3g15_A CK, chetk-alpha, choline kinase alpha; non-protein kinase, structural genomics CONS SGC, hemicholinium-3, transferase; HET: ADP HC6; 1.70A {Homo sapiens} PDB: 3f2r_A* 2i7q_A 2cko_A 2ckp_A* 2ckq_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 454
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 5e-19
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 1e-18
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 5e-18
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 2e-17
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 3e-16
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 1e-15
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 3e-15
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 3e-15
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 6e-15
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 7e-15
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 9e-15
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 1e-14
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 1e-14
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 2e-14
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 2e-14
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 8e-14
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 1e-13
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 3e-13
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 3e-13
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 5e-13
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 7e-13
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 8e-13
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 9e-13
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 9e-13
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 1e-12
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 1e-12
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 2e-12
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 3e-12
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 3e-12
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 3e-12
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 4e-12
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 6e-12
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 7e-12
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 7e-12
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 7e-12
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 2e-11
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 2e-11
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 2e-11
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 2e-11
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 2e-11
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 3e-11
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 4e-11
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 5e-11
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 1e-10
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 1e-10
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 2e-10
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 2e-10
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 2e-10
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 3e-10
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 5e-10
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 7e-10
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 9e-10
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 1e-09
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 1e-09
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 2e-09
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 3e-09
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 3e-09
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 7e-09
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 7e-09
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 2e-08
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 2e-08
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 4e-08
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 1e-07
d1usya_ 275 d.104.1.1 (A:) ATP phosphoribosyltransferase regul 1e-06
d1z7ma1 318 d.104.1.1 (A:6-323) ATP phosphoribosyltransferase 1e-05
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: STE20-like serine/threonine-protein kinase, SLK
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 84.7 bits (209), Expect = 5e-19
 Identities = 42/231 (18%), Positives = 72/231 (31%), Gaps = 72/231 (31%)

Query: 3   RAWRLLREIIEGLSHIHSQGIIHRDLKPVNIFIDYEDHVKIGDFGLATNILQKHAGPLAR 62
           +   + ++ ++ L+++H   IIHRDLK  NI    +  +K+ DFG++             
Sbjct: 111 QIQVVCKQTLDALNYLHDNKIIHRDLKAGNILFTLDGDIKLADFGVSAK----------- 159

Query: 63  ELTGYILPPIDSTAFYSHDTSHTGQVGTALYAAPELDSHGVKAMYNQFTPQNYFSKQ-QK 121
                                    +GT  + APE+       M      + Y  K    
Sbjct: 160 --------------NTRTIQRRDSFIGTPYWMAPEV------VMCETSKDRPYDYKADVW 199

Query: 122 AFYVEILRVLWGYLKAEVYKDRPKTLEELKHNIRRENGPSTGSNVQKSLQKFQKSPPSVY 181
           +  + ++ +                             P    N  + L K  KS P   
Sbjct: 200 SLGITLIEMAEIEP------------------------PHHELNPMRVLLKIAKSEPPTL 235

Query: 182 REWRSSFEWSTVRNNIKSNFQHFLILIHQQKWCLNHDPSKRPSSEQNLCQP 232
            +           +   SNF+ FL      K CL  +   R ++ Q L  P
Sbjct: 236 AQP----------SRWSSNFKDFL------KKCLEKNVDARWTTSQLLQHP 270


>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1usya_ d.104.1.1 (A:) ATP phosphoribosyltransferase regulatory subunit HisZ {Thermotoga maritima [TaxId: 2336]} Length = 275 Back     information, alignment and structure
>d1z7ma1 d.104.1.1 (A:6-323) ATP phosphoribosyltransferase regulatory subunit HisZ {Lactococcus lactis [TaxId: 1358]} Length = 318 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query454
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.98
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.98
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 99.98
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.97
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 99.97
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.97
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 99.97
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.97
d1z7ma1 318 ATP phosphoribosyltransferase regulatory subunit H 99.97
d1wu7a2 327 Histidyl-tRNA synthetase (HisRS) {Archaeon Thermop 99.97
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.97
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.97
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.97
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 99.97
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.97
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 99.97
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.97
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.97
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.97
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.96
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 99.96
d1h4vb2 324 Histidyl-tRNA synthetase (HisRS) {Thermus thermoph 99.96
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.96
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.96
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.96
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.96
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.96
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.96
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.96
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.96
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.96
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.96
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.96
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.96
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.96
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.96
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.96
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.96
d1qe0a2 325 Histidyl-tRNA synthetase (HisRS) {Staphylococcus a 99.96
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.96
d1kmma2 322 Histidyl-tRNA synthetase (HisRS) {Escherichia coli 99.95
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 99.95
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 99.95
d1usya_ 275 ATP phosphoribosyltransferase regulatory subunit H 99.95
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.95
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 99.95
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.94
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.94
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 99.94
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.94
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.93
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.92
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.92
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.38
d1nj8a3268 Prolyl-tRNA synthetase (ProRS) {Archaeon (Methanoc 99.06
d1qf6a4 291 Threonyl-tRNA synthetase (ThrRS) {Escherichia coli 98.9
d1nyra4 291 Threonyl-tRNA synthetase (ThrRS) {Staphylococcus a 98.84
d1nj1a3265 Prolyl-tRNA synthetase (ProRS) {Arhaeon (Methanoth 98.82
d1hc7a2272 Prolyl-tRNA synthetase (ProRS) {Thermus thermophil 98.67
d1b76a2 331 Glycyl-tRNA synthetase (GlyRS) {Thermus thermophil 98.46
d1jjca_266 Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS 98.16
d1c0aa3 346 Aspartyl-tRNA synthetase (AspRS) {Escherichia coli 98.14
d1eova2 353 Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (S 98.1
d1e1oa2 342 Lysyl-tRNA synthetase (LysRS) {Escherichia coli, g 98.06
d1b8aa2 335 Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococ 98.04
d1nnha_ 293 Hypothetical protein PF1951 {Archaeon Pyrococcus f 97.93
d1l0wa3 356 Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph 97.88
d1n9wa2 304 Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph 97.49
d1seta2311 Seryl-tRNA synthetase (SerRS) {Thermus thermophilu 96.67
d1g5ha2290 The aaRS-like accessory subunit of mitochondrial p 96.41
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 94.13
d1jjcb5207 Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, 93.92
d1atia2 394 Glycyl-tRNA synthetase (GlyRS) {Thermus thermophil 93.75
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 90.24
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 90.02
d1zyla1325 RdoA {Escherichia coli [TaxId: 562]} 88.76
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 86.54
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Aurora-related kinase 1 (aurora-2)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=3.2e-36  Score=287.87  Aligned_cols=157  Identities=27%  Similarity=0.427  Sum_probs=127.8

Q ss_pred             hhHHHHHHHHHHHHHHHHHcCCcccCCCCCcEEEccCCCeEEecccchhhhhhhcCCCccccccCccCCCCCCCCcccCC
Q psy7309           2 GRAWRLLREIIEGLSHIHSQGIIHRDLKPVNIFIDYEDHVKIGDFGLATNILQKHAGPLARELTGYILPPIDSTAFYSHD   81 (454)
Q Consensus         2 ~~i~~i~~qil~gL~~LH~~giiHrDLKp~NILl~~~~~vKL~DFGla~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (454)
                      .+++.+++||+.||+|||++||+||||||+|||++.++.+||+|||+|+...                           .
T Consensus       106 ~~~~~i~~qi~~al~~lH~~~ivHrDiKp~Nill~~~~~~kl~DFG~a~~~~---------------------------~  158 (263)
T d2j4za1         106 QRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAP---------------------------S  158 (263)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTTCCCCCCCGGGEEECTTSCEEECCCCSCSCCC---------------------------C
T ss_pred             HHHHHHHHHHHHHHHHHHHCCeeeeeeccccceecCCCCEeecccceeeecC---------------------------C
Confidence            4688999999999999999999999999999999999999999999997432                           1


Q ss_pred             CCCcCcccccceeccccccccccccccccCCccccchhhhHHHHHHHHHhcceeeeeecCCchhhHHHHHHHhhhcCCCC
Q psy7309          82 TSHTGQVGTALYAAPELDSHGVKAMYNQFTPQNYFSKQQKAFYVEILRVLWGYLKAEVYKDRPKTLEELKHNIRRENGPS  161 (454)
Q Consensus        82 ~~~~~~~gT~~Y~aPE~~~~~~~~~~~~~~~~DiwSl~~~~~~~~~~~~~~G~il~el~~~~~~~~~~l~~~i~~~~~p~  161 (454)
                      ......+||+.|||||++.   +..|+.++  ||||+              ||++|||++|++               |+
T Consensus       159 ~~~~~~~Gt~~Y~APE~~~---~~~~~~~~--DiwSl--------------Gvilyell~G~~---------------Pf  204 (263)
T d2j4za1         159 SRRTTLCGTLDYLPPEMIE---GRMHDEKV--DLWSL--------------GVLCYEFLVGKP---------------PF  204 (263)
T ss_dssp             CCCEETTEEGGGCCHHHHT---TCCCCTTH--HHHHH--------------HHHHHHHHHSSC---------------TT
T ss_pred             CcccccCCCCcccCHHHHc---CCCCCchh--hhhhH--------------hHHHHHHhcCCC---------------CC
Confidence            2334568999999999998   67789888  99999              999999877653               45


Q ss_pred             CCchhhhhhhhhccCCCCCCCccccccccccccccccccchhHHHHHHHHhhhcCCCCCCCCChhhhhcCcccccCC
Q psy7309         162 TGSNVQKSLQKFQKSPPSVYREWRSSFEWSTVRNNIKSNFQHFLILIHQQKWCLNHDPSKRPSSEQNLCQPISLEGS  238 (454)
Q Consensus       162 ~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~li~~~~~~~~L~~dP~~Rpta~e~l~hp~f~~~~  238 (454)
                      .+.+....+.++.+ ....+|+..             ++.+.+||     .+||+.||++|||++|+|+||||.+..
T Consensus       205 ~~~~~~~~~~~i~~-~~~~~p~~~-------------s~~~~~li-----~~~L~~dp~~R~t~~eil~hp~~~~~s  262 (263)
T d2j4za1         205 EANTYQETYKRISR-VEFTFPDFV-------------TEGARDLI-----SRLLKHNPSQRPMLREVLEHPWITANS  262 (263)
T ss_dssp             CCSSHHHHHHHHHT-TCCCCCTTS-------------CHHHHHHH-----HHHTCSSGGGSCCHHHHHTCHHHHHHC
T ss_pred             CCCCHHHHHHHHHc-CCCCCCccC-------------CHHHHHHH-----HHHccCCHhHCcCHHHHHcCcCcCCcC
Confidence            55555555555543 334444442             37778888     999999999999999999999998643



>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7ma1 d.104.1.1 (A:6-323) ATP phosphoribosyltransferase regulatory subunit HisZ {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1wu7a2 d.104.1.1 (A:3-329) Histidyl-tRNA synthetase (HisRS) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h4vb2 d.104.1.1 (B:2-325) Histidyl-tRNA synthetase (HisRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qe0a2 d.104.1.1 (A:1-325) Histidyl-tRNA synthetase (HisRS) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kmma2 d.104.1.1 (A:4-325) Histidyl-tRNA synthetase (HisRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1usya_ d.104.1.1 (A:) ATP phosphoribosyltransferase regulatory subunit HisZ {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1nj8a3 d.104.1.1 (A:0-267) Prolyl-tRNA synthetase (ProRS) {Archaeon (Methanocaldococcus jannaschii) [TaxId: 2190]} Back     information, alignment and structure
>d1qf6a4 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nyra4 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1nj1a3 d.104.1.1 (A:19-283) Prolyl-tRNA synthetase (ProRS) {Arhaeon (Methanothermobacter thermautotrophicus) [TaxId: 145262]} Back     information, alignment and structure
>d1hc7a2 d.104.1.1 (A:5-276) Prolyl-tRNA synthetase (ProRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b76a2 d.104.1.1 (A:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jjca_ d.104.1.1 (A:) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1c0aa3 d.104.1.1 (A:107-287,A:421-585) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eova2 d.104.1.1 (A:205-557) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e1oa2 d.104.1.1 (A:161-502) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU [TaxId: 562]} Back     information, alignment and structure
>d1b8aa2 d.104.1.1 (A:104-438) Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d1nnha_ d.104.1.1 (A:) Hypothetical protein PF1951 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1l0wa3 d.104.1.1 (A:105-294,A:415-580) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]} Back     information, alignment and structure
>d1n9wa2 d.104.1.1 (A:111-414) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-2 [TaxId: 274]} Back     information, alignment and structure
>d1seta2 d.104.1.1 (A:111-421) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} Back     information, alignment and structure
>d1g5ha2 d.104.1.1 (A:41-330) The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1jjcb5 d.104.1.1 (B:475-681) Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1atia2 d.104.1.1 (A:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure