Psyllid ID: psy9139


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------
MVGNYTCLADNIFGKDDIYYQVTILSPPGVPNILLQSTTTHSISILWKPSYDGGAIITHYIVSYRDRTEDWQSVHVDAEYREFTLTQLKCGTHYKINIKLVNSIGESKPSKTIAASTKGEDQTDWINIPLSNLDEALEMPLVIENLLPATRYELTISAKNDAGSTNKNYVFATLSVNGGKAFHSWSPIQVHTTLNVA
ccEEEEEEEEcccccEEEEEEEEEEccccccEEEEEEEEcccEEEEEEccccccccccEEEEEEEccccccEEEEEcccccEEEEcccccccEEEEEEEEEcccccccccccEEcEEcccccccccccccccccccccccEEEcccccccEEEEEEEEEcccccccccEEEEEEEcccccccccccccEEEEEEEEc
cccEEEEEEEEcccccccEEEEEEccccccccEEEEEccccEEEEEEcccccccccEEEEEEEEEcccccEEEEEcccccEEEEEcccccccEEEEEEEEEEcccccccccccccccccccccccccccccccccccccEEEEcccccccEEEEEEEEEEccccccccccccEEEcccccccccccccEEEEEEEcc
mvgnytcladnifgkddiyYQVTilsppgvpnillqsttthsisilwkpsydggaiITHYIVSYrdrtedwqsvHVDAEYREFTLtqlkcgthyKINIKLVnsigeskpsktiaastkgedqtdwiniplsnldealemPLVIENLLPATRYELTISakndagstnkNYVFATLSvnggkafhswspiqvhttlnva
MVGNYTCLADNIFGKDDIYYQVTILSPPGVPNILLQSTTTHSISILWKPSYDGGAIITHYIVSYRDRTEDWQSVHVDAEYREFTltqlkcgthYKINIKLvnsigeskpsktiaastkgedqtdwINIPLSNLDEALEMPLVIENLLPATRYELTIsakndagstnKNYVFATLSVNGgkafhswspiqvhttlnva
MVGNYTCLADNIFGKDDIYYQVTILSPPGVPNILLQSTTTHSISILWKPSYDGGAIITHYIVSYRDRTEDWQSVHVDAEYREFTLTQLKCGTHYKINIKLVNSIGESKPSKTIAASTKGEDQTDWINIPLSNLDEALEMPLVIENLLPATRYELTISAKNDAGSTNKNYVFATLSVNGGKAFHSWSPIQVHTTLNVA
***NYTCLADNIFGKDDIYYQVTILSPPGVPNILLQSTTTHSISILWKPSYDGGAIITHYIVSYRDRTEDWQSVHVDAEYREFTLTQLKCGTHYKINIKLVNSI******************TDWINIPLSNLDEALEMPLVIENLLPATRYELTISAKNDAGSTNKNYVFATLSVNGGKAFHSWSPIQVHTT****
MVGNYTCLADNIFGKDDIYYQVTILSPPGVPNILLQSTTTHSISILWKPSYDGGAIITHYIVSYRDRTEDWQSVHVDAEYREFTLTQLKCGTHYKINIKLVNSIGESK***************************ALEMPLVIENLLPATRYELTISAKNDAGSTNKNYVFATLSVNGGKAFHSWSPIQVHT*L***
MVGNYTCLADNIFGKDDIYYQVTILSPPGVPNILLQSTTTHSISILWKPSYDGGAIITHYIVSYRDRTEDWQSVHVDAEYREFTLTQLKCGTHYKINIKLVNSIGE*************EDQTDWINIPLSNLDEALEMPLVIENLLPATRYELTISAKNDAGSTNKNYVFATLSVNGGKAFHSWSPIQVHTTLNVA
MVGNYTCLADNIFGKDDIYYQVTILSPPGVPNILLQSTTTHSISILWKPSYDGGAIITHYIVSYRDRTEDWQSVHVDAEYREFTLTQLKCGTHYKINIKLVNSIGESKPSK*********DQTDWINIPLSNLDEALEMPLVIENLLPATRYELTISAKNDAGSTNKNYVFATLSVNGGKAFHSWSPIQVHTTLNVA
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGNYTCLADNIFGKDDIYYQVTILSPPGVPNILLQSTTTHSISILWKPSYDGGAIITHYIVSYRDRTEDWQSVHVDAEYREFTLTQLKCGTHYKINIKLVNSIGESKPSKTIAASTKGEDQTDWINIPLSNLDEALEMPLVIENLLPATRYELTISAKNDAGSTNKNYVFATLSVNGGKAFHSWSPIQVHTTLNVA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query197 2.2.26 [Sep-21-2011]
Q8TD84 2053 Down syndrome cell adhesi yes N/A 0.893 0.085 0.293 2e-18
Q4VA61 2053 Down syndrome cell adhesi yes N/A 0.893 0.085 0.302 3e-18
O60469 2012 Down syndrome cell adhesi no N/A 0.893 0.087 0.287 6e-18
Q9ERC8 2013 Down syndrome cell adhesi no N/A 0.893 0.087 0.287 7e-18
Q8VHZ8 2013 Down syndrome cell adhesi no N/A 0.893 0.087 0.287 7e-18
Q9VS29 2074 Down syndrome cell adhesi no N/A 0.888 0.084 0.255 2e-13
Q8WZ42 34350 Titin OS=Homo sapiens GN= no N/A 0.436 0.002 0.413 2e-10
A2ASS6 35213 Titin OS=Mus musculus GN= no N/A 0.436 0.002 0.402 3e-09
Q23551 7158 Twitchin OS=Caenorhabditi no N/A 0.527 0.014 0.353 2e-07
Q9R044 1252 Nephrin OS=Rattus norvegi no N/A 0.588 0.092 0.312 2e-07
>sp|Q8TD84|DSCL1_HUMAN Down syndrome cell adhesion molecule-like protein 1 OS=Homo sapiens GN=DSCAML1 PE=1 SV=2 Back     alignment and function desciption
 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 63/215 (29%), Positives = 94/215 (43%), Gaps = 39/215 (18%)

Query: 3    GNYTCLADNIFGKDDIYYQVTILSPPGVPNILLQSTTTHSISILWKPSYDGGAIITHYIV 62
            G YTC A N  G D I   + +  PP  P + +  T+  SI++ W P  +GG+ I  +++
Sbjct: 1359 GYYTCTATNTGGFDTIIVNLLVQVPPDQPRLTVSKTSASSITLTWIPGDNGGSSIRGFVL 1418

Query: 63   SYR-DRTEDWQSVHVDAEYREFTLTQLKCGTHYKINIKLVNSIGESKPSKTIAASTKGED 121
             Y  D +E+W+ V + +  R F L  LKCGT YK+ +   NS+G  + S+ I A T G +
Sbjct: 1419 QYSVDNSEEWKDVFISSSERSFKLDSLKCGTWYKVKLAAKNSVGSGRISEIIEAKTHGRE 1478

Query: 122  QT---------------------DWIN--IPLS---------------NLDEALEMPLVI 143
             +                      W N   P++                L       + +
Sbjct: 1479 PSFSKDQHLFTHINSTHARLNLQGWNNGGCPITAIVLEYRPKGTWAWQGLRANSSGEVFL 1538

Query: 144  ENLLPATRYELTISAKNDAGSTNKNYVFATLSVNG 178
              L  AT YEL + A N AG  N+   FATL  +G
Sbjct: 1539 TELREATWYELRMRACNSAGCGNETAQFATLDYDG 1573




Cell adhesion molecule that plays a role in neuronal self-avoidance. Promotes repulsion between specific neuronal processes of either the same cell or the same subtype of cells. Promotes both isoneuronal self-avoidance for creating an orderly neurite arborization in retinal rod bipolar cells and heteroneuronal self-avoidance to maintain mosaic spacing between AII amacrine cells.
Homo sapiens (taxid: 9606)
>sp|Q4VA61|DSCL1_MOUSE Down syndrome cell adhesion molecule-like protein 1 homolog OS=Mus musculus GN=Dscaml1 PE=1 SV=2 Back     alignment and function description
>sp|O60469|DSCAM_HUMAN Down syndrome cell adhesion molecule OS=Homo sapiens GN=DSCAM PE=1 SV=2 Back     alignment and function description
>sp|Q9ERC8|DSCAM_MOUSE Down syndrome cell adhesion molecule homolog OS=Mus musculus GN=Dscam PE=1 SV=1 Back     alignment and function description
>sp|Q8VHZ8|DSCAM_RAT Down syndrome cell adhesion molecule homolog OS=Rattus norvegicus GN=Dscam PE=1 SV=1 Back     alignment and function description
>sp|Q9VS29|DSCL_DROME Down syndrome cell adhesion molecule-like protein Dscam2 OS=Drosophila melanogaster GN=Dscam2 PE=2 SV=3 Back     alignment and function description
>sp|Q8WZ42|TITIN_HUMAN Titin OS=Homo sapiens GN=TTN PE=1 SV=4 Back     alignment and function description
>sp|A2ASS6|TITIN_MOUSE Titin OS=Mus musculus GN=Ttn PE=1 SV=1 Back     alignment and function description
>sp|Q23551|UNC22_CAEEL Twitchin OS=Caenorhabditis elegans GN=unc-22 PE=1 SV=3 Back     alignment and function description
>sp|Q9R044|NPHN_RAT Nephrin OS=Rattus norvegicus GN=Nphs1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query197
195055999 2029 GH17490 [Drosophila grimshawi] gi|193892 0.898 0.087 0.328 2e-24
195144188 2078 GL23930 [Drosophila persimilis] gi|19410 0.898 0.085 0.337 3e-24
198451327 2077 GA16078 [Drosophila pseudoobscura pseudo 0.898 0.085 0.337 4e-24
270016876 1656 hypothetical protein TcasGA2_TC006845 [T 0.893 0.106 0.324 6e-24
189242122 1700 PREDICTED: similar to CG31190 CG31190-PC 0.893 0.103 0.324 6e-24
195391526 2064 GJ22820 [Drosophila virilis] gi|19415249 0.898 0.085 0.328 2e-23
195497385 2214 GE25266 [Drosophila yakuba] gi|194182177 0.898 0.079 0.333 2e-23
194745280 2078 GF18608 [Drosophila ananassae] gi|190628 0.898 0.085 0.328 2e-23
161078374 2007 down syndrome cell adhesion molecule 3, 0.898 0.088 0.328 2e-23
442619604 2077 down syndrome cell adhesion molecule 3, 0.898 0.085 0.328 3e-23
>gi|195055999|ref|XP_001994900.1| GH17490 [Drosophila grimshawi] gi|193892663|gb|EDV91529.1| GH17490 [Drosophila grimshawi] Back     alignment and taxonomy information
 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 73/222 (32%), Positives = 104/222 (46%), Gaps = 45/222 (20%)

Query: 1    MVGNYTCLADNIFGKDDIYYQVTILSPPGVPNILLQSTTTHSISILWKPSYDGGAIITHY 60
            + GNYTC A+N+FG D+I YQV  + PP  P I++Q  +  SI + W    DGGA +  Y
Sbjct: 1387 LSGNYTCTANNLFGSDEIQYQVIAMKPPAAPQIIVQYASADSIRVSWDAPEDGGAPLQGY 1446

Query: 61   IVSYRDRTEDWQSVHVDAEYREFTLTQLKCGTHYKINIKLVNSIGESKPSKTIAASTKGE 120
             +SY    + W    +  E   +T+T LKCG  Y I +   N +G+  PS+ I   TKG+
Sbjct: 1447 TISYHTAGDTWAQTELLPENNAYTMTGLKCGNQYIIKMSAHNLVGDGAPSEEINVWTKGK 1506

Query: 121  DQ--------------------TDWIN------------IPL------------SNLDEA 136
                                  + W N             PL            SN +E 
Sbjct: 1507 ASQAPNGNELIATNATCVNLKLSSWHNGGCSIHHFSIEHRPLGDIRWTVVTSDISNAEEN 1566

Query: 137  LEMPLVIENLLPATRYELTISAKNDAGSTNKNYVFATLSVNG 178
             E  L+  + LP+  Y+L ISA NDAG T ++Y F+T S++G
Sbjct: 1567 REN-LIFCDFLPSKWYQLRISATNDAGKTTEHYHFSTTSLDG 1607




Source: Drosophila grimshawi

Species: Drosophila grimshawi

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195144188|ref|XP_002013078.1| GL23930 [Drosophila persimilis] gi|194102021|gb|EDW24064.1| GL23930 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|198451327|ref|XP_001358324.2| GA16078 [Drosophila pseudoobscura pseudoobscura] gi|198131438|gb|EAL27462.2| GA16078 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|270016876|gb|EFA13322.1| hypothetical protein TcasGA2_TC006845 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189242122|ref|XP_968319.2| PREDICTED: similar to CG31190 CG31190-PC [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195391526|ref|XP_002054411.1| GJ22820 [Drosophila virilis] gi|194152497|gb|EDW67931.1| GJ22820 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195497385|ref|XP_002096076.1| GE25266 [Drosophila yakuba] gi|194182177|gb|EDW95788.1| GE25266 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|194745280|ref|XP_001955116.1| GF18608 [Drosophila ananassae] gi|190628153|gb|EDV43677.1| GF18608 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|161078374|ref|NP_001097825.1| down syndrome cell adhesion molecule 3, isoform C [Drosophila melanogaster] gi|158030291|gb|ABW08696.1| down syndrome cell adhesion molecule 3, isoform C [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|442619604|ref|NP_732242.2| down syndrome cell adhesion molecule 3, isoform F [Drosophila melanogaster] gi|440217538|gb|AAF55426.3| down syndrome cell adhesion molecule 3, isoform F [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query197
FB|FBgn0261046 2046 Dscam3 "Down syndrome cell adh 0.598 0.057 0.398 1.3e-26
FB|FBgn0263219 1918 Dscam4 "Down syndrome cell adh 0.593 0.061 0.358 8.5e-25
UNIPROTKB|F1MKB9 1859 DSCAM "Uncharacterized protein 0.604 0.064 0.358 4.6e-21
UNIPROTKB|O60469 2012 DSCAM "Down syndrome cell adhe 0.604 0.059 0.358 5.5e-21
MGI|MGI:1196281 2013 Dscam "Down syndrome cell adhe 0.604 0.059 0.358 7.1e-21
RGD|619992 2013 Dscam "Down syndrome cell adhe 0.604 0.059 0.358 7.1e-21
FB|FBgn0033159 2037 Dscam "Down syndrome cell adhe 0.593 0.057 0.294 7.7e-21
UNIPROTKB|F1NY98 1994 DSCAM "Uncharacterized protein 0.604 0.059 0.358 1.1e-20
ZFIN|ZDB-GENE-050310-7 2024 dscama "Down syndrome cell adh 0.604 0.058 0.366 3.7e-18
UNIPROTKB|E1BZF3 1870 E1BZF3 "Uncharacterized protei 0.604 0.063 0.358 1.5e-17
FB|FBgn0261046 Dscam3 "Down syndrome cell adhesion molecule 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 246 (91.7 bits), Expect = 1.3e-26, Sum P(2) = 1.3e-26
 Identities = 47/118 (39%), Positives = 64/118 (54%)

Query:     3 GNYTCLADNIFGKDDIYYQVTILSPPGVPNILLQSTTTHSISILWKPSYDGGAIITHYIV 62
             GNYTC A+N+FG D+I YQV  + PP  P I++Q  +  SI + W    DGGA +  Y +
Sbjct:  1375 GNYTCTANNLFGSDEIQYQVIAMKPPSAPQIIVQYASADSIRVSWDAPDDGGAPLQGYTI 1434

Query:    63 SYRDRTEDWQSVHVDAEYREFTLTQLKCGTHYKINIKLVNSIGESKPSKTIAASTKGE 120
             SY    E W    +  E   FT++ LKCG  Y I +   N +G    S+ I   TKG+
Sbjct:  1435 SYHTAGESWSITELLPENNAFTISGLKCGNQYIIKMSAHNMVGSGVASEEINVWTKGK 1492


GO:0007155 "cell adhesion" evidence=ISS
GO:0005886 "plasma membrane" evidence=ISS
GO:0007156 "homophilic cell adhesion" evidence=IC
GO:0042802 "identical protein binding" evidence=IPI
GO:0005887 "integral to plasma membrane" evidence=ISM
FB|FBgn0263219 Dscam4 "Down syndrome cell adhesion molecule 4" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1MKB9 DSCAM "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O60469 DSCAM "Down syndrome cell adhesion molecule" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1196281 Dscam "Down syndrome cell adhesion molecule" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|619992 Dscam "Down syndrome cell adhesion molecule" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0033159 Dscam "Down syndrome cell adhesion molecule" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1NY98 DSCAM "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050310-7 dscama "Down syndrome cell adhesion molecule a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BZF3 E1BZF3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query197
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 2e-15
smart0006083 smart00060, FN3, Fibronectin type 3 domain 7e-14
pfam0004184 pfam00041, fn3, Fibronectin type III domain 1e-11
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
 Score = 67.9 bits (166), Expect = 2e-15
 Identities = 34/93 (36%), Positives = 53/93 (56%), Gaps = 2/93 (2%)

Query: 27  PPGVPNILLQSTTTHSISILWKPSYDGGAIITHYIVSYRDR-TEDWQSVHVDAEYR-EFT 84
           P    N+ +   T+ S+++ W P  D G  IT Y+V YR++ + DW+ V V       +T
Sbjct: 1   PSPPTNLRVTDVTSTSVTLSWTPPEDDGGPITGYVVEYREKGSGDWKEVEVTPGSETSYT 60

Query: 85  LTQLKCGTHYKINIKLVNSIGESKPSKTIAAST 117
           LT LK GT Y+  ++ VN  GES PS+++  +T
Sbjct: 61  LTGLKPGTEYEFRVRAVNGGGESPPSESVTVTT 93


Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases. Length = 93

>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 197
KOG3513|consensus 1051 99.9
KOG4221|consensus 1381 99.87
KOG4221|consensus 1381 99.82
KOG3513|consensus 1051 99.61
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 99.48
KOG0196|consensus 996 99.39
KOG4222|consensus 1281 99.37
KOG0196|consensus 996 99.07
cd0006393 FN3 Fibronectin type 3 domain; One of three types 98.88
KOG4222|consensus 1281 98.63
smart0006083 FN3 Fibronectin type 3 domain. One of three types 98.56
cd0573588 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down 98.48
KOG4802|consensus 516 98.32
KOG4367|consensus699 98.29
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 97.92
KOG4194|consensus873 97.77
PF09294106 Interfer-bind: Interferon-alpha/beta receptor, fib 97.68
cd0572371 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai 97.59
cd0586367 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain 97.56
cd0587671 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o 97.49
PHA02826227 IL-1 receptor-like protein; Provisional 97.48
cd0572569 Ig3_Robo Third immunoglobulin (Ig)-like domain in 97.45
cd0573171 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom 97.44
cd0586470 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain 97.36
cd0576375 Ig_1 Subgroup of the immunoglobulin (Ig) superfami 97.3
cd0574669 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do 97.28
PHA02785326 IL-beta-binding protein; Provisional 97.25
cd0573676 Ig2_Follistatin_like Second immunoglobulin (Ig)-li 97.17
PF01108107 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH 97.15
cd0497671 Ig2_VEGFR Second immunoglobulin (Ig)-like domain o 97.15
cd0572690 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in 97.14
PHA02785326 IL-beta-binding protein; Provisional 97.09
KOG4802|consensus516 97.08
cd0573969 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li 97.06
PF09067104 EpoR_lig-bind: Erythropoietin receptor, ligand bin 97.05
PF10179 300 DUF2369: Uncharacterised conserved protein (DUF236 96.89
cd0573874 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l 96.85
KOG4194|consensus873 96.73
cd0006393 FN3 Fibronectin type 3 domain; One of three types 96.69
cd0576077 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of 96.67
cd05771139 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain 96.63
smart0006083 FN3 Fibronectin type 3 domain. One of three types 96.6
cd0574378 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai 96.23
PF0749566 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi 95.57
cd0576298 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of 95.48
cd0574874 Ig_Titin_like Immunoglobulin (Ig)-like domain of t 95.14
cd0574378 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai 95.03
KOG4258|consensus1025 94.88
cd0585485 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig 94.79
PF10179300 DUF2369: Uncharacterised conserved protein (DUF236 94.75
cd0573792 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- 94.63
cd0585188 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig 94.35
cd0497290 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o 94.28
cd0589375 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like 94.22
PLN02533 427 probable purple acid phosphatase 94.18
PF0749566 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi 94.16
cd0586184 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like 94.11
cd0574091 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai 94.0
cd0585785 Ig2_FGFR Second immunoglobulin (Ig)-like domain of 94.0
cd0585273 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig 93.98
cd0589275 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like 93.95
cd0573095 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom 93.68
cd0589486 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card 93.5
KOG4258|consensus 1025 93.46
cd0587098 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o 93.31
cd0574475 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain 93.27
cd0589192 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like 93.26
cd0585890 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o 93.19
cd0573296 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom 92.92
cd0586692 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o 92.9
cd0770272 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain 92.84
cd0574574 Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom 92.7
cd0576375 Ig_1 Subgroup of the immunoglobulin (Ig) superfami 92.66
cd0574792 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like 92.6
cd0576077 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of 92.47
cd0573676 Ig2_Follistatin_like Second immunoglobulin (Ig)-li 92.34
cd0576581 Ig_3 Subgroup of the immunoglobulin (Ig) superfami 92.3
cd0575191 Ig1_LILRB1_like First immunoglobulin (Ig)-like dom 91.9
cd0497085 Ig6_Contactin_like Sixth Ig domain of contactin. I 91.75
cd0497876 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like 91.74
cd0496973 Ig5_Contactin_like Fifth Ig domain of contactin. I 91.41
cd0497490 Ig3_FGFR Third immunoglobulin (Ig)-like domain of 91.23
cd0572569 Ig3_Robo Third immunoglobulin (Ig)-like domain in 91.13
COG4733 952 Phage-related protein, tail component [Function un 90.91
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 90.76
KOG1948|consensus 1165 90.55
cd0586776 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do 90.43
cd0573588 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down 90.27
KOG4228|consensus 1087 90.19
cd0572371 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai 90.14
cd0586997 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o 90.1
KOG3632|consensus 1335 90.05
KOG3515|consensus741 89.99
cd0496888 Ig3_Contactin_like Third Ig domain of contactin. I 89.8
cd0573377 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom 89.78
PF0767990 I-set: Immunoglobulin I-set domain; InterPro: IPR0 89.5
PF09294106 Interfer-bind: Interferon-alpha/beta receptor, fib 89.06
cd04975101 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma 88.86
PHA0263363 hypothetical protein; Provisional 88.78
cd0585385 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig 88.59
cd0574669 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do 88.13
cd0573171 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom 87.78
cd0575075 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain 87.68
KOG4152|consensus 830 86.74
cd0586876 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o 86.68
cd0572985 Ig2_FGFR_like Second immunoglobulin (Ig)-like doma 86.37
COG4733 952 Phage-related protein, tail component [Function un 86.23
cd0586596 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o 86.08
cd0587671 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o 85.9
cd0497792 Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom 85.77
cd0587477 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of 85.6
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 85.35
cd0588580 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain 85.23
cd0586367 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain 85.16
cd0573874 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l 84.22
cd0587387 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of 83.93
cd0497671 Ig2_VEGFR Second immunoglobulin (Ig)-like domain o 82.59
cd0572885 Ig4_Contactin-2-like Fourth Ig domain of the neura 81.93
cd05773109 Ig8_hNephrin_like Eighth immunoglobulin-like domai 81.72
KOG4228|consensus 1087 81.48
cd0572486 Ig2_Robo Second immunoglobulin (Ig)-like domain in 81.27
>KOG3513|consensus Back     alignment and domain information
Probab=99.90  E-value=6e-22  Score=158.34  Aligned_cols=180  Identities=23%  Similarity=0.414  Sum_probs=141.4

Q ss_pred             CCeeEEEEEEeCCCCceeEEEEEecCCCCCCE-EEEEeecCCeEEEEeeeCCCCCccccEEEEEEE-eCCCCcEEEEe-C
Q psy9139           1 MVGNYTCLADNIFGKDDIYYQVTILSPPGVPN-ILLQSTTTHSISILWKPSYDGGAIITHYIVSYR-DRTEDWQSVHV-D   77 (197)
Q Consensus         1 ~~g~y~c~a~n~~G~~~~~~~~~~~~~P~~p~-~~~~~~~~~~~~l~W~~~~~~~~~i~~y~v~~~-~~~~~~~~~~~-~   77 (197)
                      |+|.|+|+|.....+.++.+.+++..+|+||. +.+...+.+++.|+|+++.|.+++|..|.|+.+ ...+.|..+.. +
T Consensus       588 ~~G~Y~C~aqT~~Ds~s~~A~l~V~gpPgpP~~v~~~~i~~t~~~lsW~~g~dn~SpI~~Y~iq~rt~~~~~W~~v~~vp  667 (1051)
T KOG3513|consen  588 DSGKYTCVAQTALDSASARADLLVRGPPGPPPDVHVDDISDTTARLSWSPGSDNNSPIEKYTIQFRTPFPGKWKAVTTVP  667 (1051)
T ss_pred             cCceEEEEEEEeecchhcccceEEecCCCCCCceeEeeeccceEEEEeecCCCCCCCceEEeEEecCCCCCcceEeeECC
Confidence            78999999999999999999999999999998 999999999999999999988899999999999 46778987652 2


Q ss_pred             Ccc---cEEEECCCCCCCEEEEEEEEEcCCcCCCCCCce-EeecCCCC--------------------------------
Q psy9139          78 AEY---REFTLTQLKCGTHYKINIKLVNSIGESKPSKTI-AASTKGED--------------------------------  121 (197)
Q Consensus        78 ~~~---~~~~i~~L~p~~~y~~~v~a~~~~g~~~~s~~~-~~~t~~~~--------------------------------  121 (197)
                      ...   ...++.+|.|+..|+|||.|.|..|.+++|.+. ..+|.++.                                
T Consensus       668 ~~~~~~~sa~vv~L~Pwv~YeFRV~AvN~iG~gePS~pS~~~rT~ea~P~~~P~nv~g~g~~~~eLvItW~Pl~~~~qNG  747 (1051)
T KOG3513|consen  668 GNITGDESATVVNLSPWVEYEFRVVAVNSIGIGEPSPPSEKVRTPEAAPSVNPSNVKGGGGSPTELVITWEPLPEEEQNG  747 (1051)
T ss_pred             CcccCccceeEEccCCCcceEEEEEEEcccccCCCCCCccceecCCCCCccCCccccccCCCCceEEEEeccCCHHHccC
Confidence            222   246788999999999999999999999988764 45665443                                


Q ss_pred             --------------CCCeeecCCCCCcccccceEEEc--CCCCCCeEEEEEEEEcCCCCCCcceEEEEeeeCCCcCCC
Q psy9139         122 --------------QTDWINIPLSNLDEALEMPLVIE--NLLPATRYELTISAKNDAGSTNKNYVFATLSVNGGKAFH  183 (197)
Q Consensus       122 --------------~~~w~~~~~~~~~~~~~~~~~i~--~L~p~t~Y~v~V~a~n~~G~~~~~~~~~t~~~~~~~~~p  183 (197)
                                    ...|........   +...|.+.  ...|.+.|+++|+|+|..|.|+.+.......-++.|+.+
T Consensus       748 ~gfgY~Vswr~~g~~~~W~~~~v~~~---d~~~~V~~~~st~~~tpyevKVqa~N~~GeGp~s~~~v~~S~Ed~P~~a  822 (1051)
T KOG3513|consen  748 PGFGYRVSWRPQGADKEWKEVIVSNQ---DQPRYVVSNESTEPFTPYEVKVQAINDQGEGPESQVTVGYSGEDEPPVA  822 (1051)
T ss_pred             CCceEEEEEEeCCCCcccceeEeccc---CCceEEEcCCCCCCcceeEEEEEEecCCCCCCCCceEEEEcCCCCCCCC
Confidence                          123433222211   13344444  556699999999999999999977776666666666443



>KOG4221|consensus Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>KOG3513|consensus Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>KOG4802|consensus Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology Back     alignment and domain information
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) Back     alignment and domain information
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>PHA02826 IL-1 receptor-like protein; Provisional Back     alignment and domain information
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) Back     alignment and domain information
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R Back     alignment and domain information
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) Back     alignment and domain information
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>KOG4802|consensus Back     alignment and domain information
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>PF09067 EpoR_lig-bind: Erythropoietin receptor, ligand binding; InterPro: IPR015152 Members of this entry include the growth hormone and erythropoietin receptors Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 Back     alignment and domain information
>PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators Back     alignment and domain information
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) Back     alignment and domain information
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 Back     alignment and domain information
>KOG4258|consensus Back     alignment and domain information
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 Back     alignment and domain information
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin Back     alignment and domain information
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators Back     alignment and domain information
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) Back     alignment and domain information
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 Back     alignment and domain information
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin Back     alignment and domain information
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) Back     alignment and domain information
>KOG4258|consensus Back     alignment and domain information
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) Back     alignment and domain information
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin Back     alignment and domain information
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) Back     alignment and domain information
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) Back     alignment and domain information
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins Back     alignment and domain information
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 Back     alignment and domain information
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) Back     alignment and domain information
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins Back     alignment and domain information
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin Back     alignment and domain information
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) Back     alignment and domain information
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin Back     alignment and domain information
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>COG4733 Phage-related protein, tail component [Function unknown] Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>KOG1948|consensus Back     alignment and domain information
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>KOG3515|consensus Back     alignment and domain information
>cd04968 Ig3_Contactin_like Third Ig domain of contactin Back     alignment and domain information
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology Back     alignment and domain information
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins Back     alignment and domain information
>PHA02633 hypothetical protein; Provisional Back     alignment and domain information
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 Back     alignment and domain information
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) Back     alignment and domain information
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>COG4733 Phage-related protein, tail component [Function unknown] Back     alignment and domain information
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 Back     alignment and domain information
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins Back     alignment and domain information
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4, also known as cell adhesion molecule 4 (CADM4)) Back     alignment and domain information
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) Back     alignment and domain information
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D Back     alignment and domain information
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) Back     alignment and domain information
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query197
2nzi_A305 Crystal Structure Of Domains A168-A170 From Titin L 1e-07
2edb_A116 Solution Structure Of The Fourth Fibronectin Type I 2e-05
3lpw_A197 Crystal Structure Of The Fniii-Tandem A77-A78 From 2e-05
1x5i_A126 The Solution Structure Of The Fourth Fibronectin Ty 2e-05
1x4z_A121 Solution Structure Of The 2nd Fibronectin Type Iii 5e-05
3uto_A 573 Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- 5e-05
2jll_A389 Crystal Structure Of Ncam2 Igiv-Fn3ii Length = 389 6e-05
2kbg_A114 Solution Structure Of The Second Fibronectin Type-I 1e-04
1bpv_A112 Titin Module A71 From Human Cardiac Muscle, Nmr, 50 6e-04
2xyc_A291 Crystal Structure Of Ncam2 Igiv-Fn3i Length = 291 7e-04
>pdb|2NZI|A Chain A, Crystal Structure Of Domains A168-A170 From Titin Length = 305 Back     alignment and structure

Iteration: 1

Score = 52.8 bits (125), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 40/128 (31%), Positives = 61/128 (47%), Gaps = 4/128 (3%) Query: 3 GNYTCLADNIFGKDDIYYQVTILSPPGVPN-ILLQSTTTHSISILW-KPSYDGGAIITHY 60 G Y A N FG D ++ + P P + + + S+++ W +P+ DGG+ IT+Y Sbjct: 174 GFYVVCAKNRFGIDQKTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNY 233 Query: 61 IVSYRDRT-EDWQSVHVDAEYREFTLTQLKCGTHYKINIKLVNSIGESKPSKTIAASTKG 119 IV T E W V E R +T+ L T Y+ + N G SKPS+ + Sbjct: 234 IVEKCATTAERWLRVGQARETR-YTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITK 292 Query: 120 EDQTDWIN 127 ED+T +N Sbjct: 293 EDKTRAMN 300
>pdb|2EDB|A Chain A, Solution Structure Of The Fourth Fibronectin Type Iii Domain Of Human Netrin Receptor Dcc Length = 116 Back     alignment and structure
>pdb|3LPW|A Chain A, Crystal Structure Of The Fniii-Tandem A77-A78 From The A-Band Of Titin Length = 197 Back     alignment and structure
>pdb|1X5I|A Chain A, The Solution Structure Of The Fourth Fibronectin Type Iii Domain Of Human Neogenin Length = 126 Back     alignment and structure
>pdb|1X4Z|A Chain A, Solution Structure Of The 2nd Fibronectin Type Iii Domain From Mouse Biregional Cell Adhesion Molecule-RelatedDOWN- Regulated Oncogenes (Cdon) Binding Protein Length = 121 Back     alignment and structure
>pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 Back     alignment and structure
>pdb|2JLL|A Chain A, Crystal Structure Of Ncam2 Igiv-Fn3ii Length = 389 Back     alignment and structure
>pdb|2KBG|A Chain A, Solution Structure Of The Second Fibronectin Type-Iii Module Of Ncam2 Length = 114 Back     alignment and structure
>pdb|1BPV|A Chain A, Titin Module A71 From Human Cardiac Muscle, Nmr, 50 Structures Length = 112 Back     alignment and structure
>pdb|2XYC|A Chain A, Crystal Structure Of Ncam2 Igiv-Fn3i Length = 291 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query197
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 2e-26
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 2e-24
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 3e-17
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 5e-24
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 6e-23
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 3e-22
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 3e-21
1x3d_A118 Fibronectin type-III domain containing protein 3A; 3e-21
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 8e-21
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 7e-20
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 9e-20
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 2e-19
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 3e-14
1x4x_A106 Fibronectin type-III domain containing protein 3A; 4e-19
2crm_A120 Fibronectin type-III domain containing protein 3A; 5e-19
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 1e-18
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 1e-18
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 1e-18
1x5x_A109 Fibronectin type-III domain containing protein 3A; 2e-18
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 5e-18
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 5e-18
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 7e-11
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 3e-09
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 6e-07
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 1e-17
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 2e-17
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 3e-17
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 4e-17
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 8e-17
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 4e-16
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 9e-17
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 9e-17
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 2e-16
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 3e-16
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 3e-16
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 4e-16
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 1e-14
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 2e-11
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 4e-16
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 1e-11
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 5e-16
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 5e-16
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 6e-16
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 1e-15
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 5e-11
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 1e-10
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 3e-05
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 1e-15
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 1e-15
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 1e-14
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 3e-15
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 3e-13
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 6e-13
1fnf_A 368 Fibronectin; RGD, extracellular matrix, cell adhes 8e-10
2crz_A110 Fibronectin type-III domain containing protein 3A; 4e-15
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 4e-15
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 5e-15
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 2e-13
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 6e-15
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 7e-15
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 5e-14
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 3e-12
3t1w_A 375 Four-domain fibronectin fragment; human fibronecti 2e-09
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 9e-15
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 1e-14
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 1e-14
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 2e-14
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 1e-14
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 1e-12
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 3e-12
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 1e-10
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 3e-10
3k2m_C101 Monobody HA4; engineered binding protein, antibody 2e-14
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 2e-14
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 2e-14
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 2e-14
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 1e-13
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 3e-14
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 8e-12
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 1e-08
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 4e-14
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 6e-14
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 1e-13
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 1e-13
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 1e-13
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 2e-13
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 2e-13
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 2e-13
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 2e-13
3t04_D103 Monobody 7C12; engineered binding protein, antibod 3e-13
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 3e-13
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 3e-13
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 1e-12
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 4e-13
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 5e-13
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 5e-13
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 6e-11
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 1e-10
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 8e-13
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 1e-12
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 2e-12
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 2e-12
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 3e-12
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 8e-12
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 3e-12
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 5e-12
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 5e-12
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 7e-12
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 9e-12
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 1e-11
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 1e-11
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 2e-11
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 3e-11
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 4e-11
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 5e-11
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 5e-08
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 5e-11
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 7e-11
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 8e-11
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 8e-11
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 8e-11
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 1e-10
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 2e-10
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 2e-10
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 5e-10
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 6e-10
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 3e-09
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 1e-08
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 4e-08
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 1e-08
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 3e-08
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 5e-07
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 5e-06
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 5e-07
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 8e-07
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 1e-06
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 4e-06
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 1e-05
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 1e-05
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 3e-05
1eer_B227 Epobp, erythropoietin receptor; signal transductio 3e-05
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 9e-05
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 1e-04
1wwb_X103 Protein (brain derived neurotrophic factor recepto 1e-04
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 1e-04
2gys_A419 Cytokine receptor common beta chain; dimer of inte 2e-04
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 3e-04
1he7_A126 High affinity nerve growth factor receptor; transf 4e-04
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 6e-04
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 9e-04
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
 Score = 99.5 bits (248), Expect = 2e-26
 Identities = 27/122 (22%), Positives = 46/122 (37%), Gaps = 6/122 (4%)

Query: 3   GNYTCLADNIFGKDDIYYQVTILSPPGVPNILLQSTTTHSISILWK-PSYDGGAIITHYI 61
           GNY C A N  G++ + + +     P  P+I      + +  + +  P   GG  I  Y 
Sbjct: 89  GNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYK 148

Query: 62  VSYRDRTED-----WQSVHVDAEYREFTLTQLKCGTHYKINIKLVNSIGESKPSKTIAAS 116
             +R   E+     W      +     T+  LK  T Y + +  +N  G  + S      
Sbjct: 149 AEWRAVGEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFK 208

Query: 117 TK 118
           T+
Sbjct: 209 TQ 210


>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Length = 103 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Length = 88 Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query197
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.93
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 99.89
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 99.89
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 99.88
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 99.86
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 99.85
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 99.85
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 99.84
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 99.83
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 99.82
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 99.82
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 99.81
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 99.81
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 99.81
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 99.81
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 99.8
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 99.8
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 99.79
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 99.78
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 99.78
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 99.78
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 99.78
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 99.78
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 99.77
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 99.76
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 99.76
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 99.76
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 99.75
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 99.74
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 99.72
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 99.71
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 99.7
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 99.69
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 99.68
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 99.68
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.68
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 99.67
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 99.66
1x4x_A106 Fibronectin type-III domain containing protein 3A; 99.66
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 99.66
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 99.65
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 99.65
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 99.65
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.64
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 99.64
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 99.64
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 99.64
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 99.64
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 99.63
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 99.63
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 99.63
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 99.63
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 99.63
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 99.63
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 99.62
2crz_A110 Fibronectin type-III domain containing protein 3A; 99.62
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 99.62
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 99.61
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 99.61
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 99.61
1x3d_A118 Fibronectin type-III domain containing protein 3A; 99.61
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 99.6
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 99.6
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 99.6
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 99.6
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 99.6
3t04_D103 Monobody 7C12; engineered binding protein, antibod 99.59
1x5x_A109 Fibronectin type-III domain containing protein 3A; 99.59
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 99.59
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 99.59
2crm_A120 Fibronectin type-III domain containing protein 3A; 99.59
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 99.58
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 99.58
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 99.58
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 99.58
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 99.57
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 99.57
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 99.57
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 99.57
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 99.57
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 99.56
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 99.56
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 99.56
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 99.55
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 99.55
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 99.54
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 99.54
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 99.54
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 99.54
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 99.54
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 99.54
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.54
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 99.54
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 99.53
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 99.53
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 99.53
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 99.52
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 99.52
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 99.52
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.51
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 99.51
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 99.51
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 99.51
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 99.5
3k2m_C101 Monobody HA4; engineered binding protein, antibody 99.5
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 99.5
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 99.49
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 99.49
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 99.48
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 99.48
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.47
2dtg_E 897 Insulin receptor; IR ectodomain, X-RAY crystallogr 99.47
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 99.46
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 99.46
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 99.46
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 99.46
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 99.45
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 99.45
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 99.45
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 99.44
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 99.43
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 99.42
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 99.42
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 99.42
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 99.42
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 99.41
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.41
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 99.39
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 99.39
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 99.38
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 99.38
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 99.36
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 99.36
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 99.36
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 99.35
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 99.35
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 99.35
3se4_A 414 Interferon alpha/beta receptor 1; type I interfero 99.35
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 99.33
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 99.32
3lb6_C 380 IL-13, interleukin-13 receptor subunit alpha-2; cy 99.31
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 99.3
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 99.3
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 99.28
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 99.28
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 99.25
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 99.2
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 99.19
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 99.18
1eer_B227 Epobp, erythropoietin receptor; signal transductio 99.17
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 99.17
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 99.17
1oww_A98 FN, fibronectin first type III module, CIG; fibron 99.09
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 99.09
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 99.09
2gys_A 419 Cytokine receptor common beta chain; dimer of inte 99.09
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 99.06
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 99.05
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 99.05
2erj_C247 Cytokine receptor common gamma chain; immune syste 99.03
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 99.02
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 99.01
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 98.98
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 98.97
1q38_A89 Fibronectin; amyloid fibril, anastellin, extracell 98.96
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 98.93
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 98.92
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 98.92
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 98.91
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 98.89
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 98.86
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 98.86
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 98.84
3csg_A461 MBP, maltose-binding protein monobody YS1 fusion, 98.82
1eer_B227 Epobp, erythropoietin receptor; signal transductio 98.8
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 98.78
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 98.74
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 98.71
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 98.7
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 98.69
2gys_A419 Cytokine receptor common beta chain; dimer of inte 98.68
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 98.67
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 98.67
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 98.66
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 98.65
1x3d_A118 Fibronectin type-III domain containing protein 3A; 98.64
1x4x_A106 Fibronectin type-III domain containing protein 3A; 98.64
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 98.61
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 98.58
2crz_A110 Fibronectin type-III domain containing protein 3A; 98.57
2crm_A120 Fibronectin type-III domain containing protein 3A; 98.56
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 98.55
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 98.55
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 98.53
1x5x_A109 Fibronectin type-III domain containing protein 3A; 98.53
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 98.52
1wft_A123 1700129L13RIK protein; FN3 domain, similar to HOST 98.52
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 98.52
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 98.51
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 98.51
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 98.5
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 98.5
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 98.5
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 98.48
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 98.48
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 98.45
1ugn_A198 LIR1, leukocyte immunoglobulin-like receptor 1; im 98.45
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 98.44
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 98.44
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 98.44
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 98.44
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 98.44
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 98.43
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 98.43
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 98.43
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 98.42
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 98.41
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 98.41
4fa8_A203 Secreted protein BARF1; immunoglobulin-like domain 98.4
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 98.4
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 98.39
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 98.39
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 98.39
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 98.39
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 98.39
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 98.39
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 98.37
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 98.37
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 98.35
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 98.34
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 98.34
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 98.33
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 98.33
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 98.31
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 98.3
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 98.3
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 98.29
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 98.29
4fom_A308 Poliovirus receptor-related protein 3; immunoglobu 98.29
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 98.29
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 98.29
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 98.28
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 98.27
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 98.27
3p2t_A196 Leukocyte immunoglobulin-like receptor subfamily 4 98.26
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 98.25
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 98.25
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 98.24
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 98.23
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 98.23
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 98.23
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 98.22
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 98.22
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 98.2
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 98.19
1oll_A188 NK receptor; immune system/receptor, NK cell trigg 98.18
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 98.18
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 98.18
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 98.18
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 98.18
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 98.16
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 98.14
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 98.13
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 98.13
2d3v_A196 Leukocyte immunoglobulin-like receptor subfamily A 98.13
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 98.12
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 98.12
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 98.12
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 98.12
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 98.11
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 98.11
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 98.09
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 98.09
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 98.08
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 98.07
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 98.06
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 98.06
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 98.06
1uct_A218 Immunoglobulin alpha FC receptor; beta stands, imm 98.06
2fbo_J250 V1V2;, variable region-containing chitin-binding p 98.06
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 98.05
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 98.05
4fqp_A313 Poliovirus receptor; immunoglobulin-like domain, I 98.04
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 98.04
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 98.04
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 98.04
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 98.03
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 98.03
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 98.03
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 98.02
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 98.02
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 98.02
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 98.0
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 97.99
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 97.98
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 97.98
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 97.98
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 97.97
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 97.97
3t04_D103 Monobody 7C12; engineered binding protein, antibod 97.97
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 97.96
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 97.96
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 97.96
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 97.96
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 97.95
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 97.95
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 97.95
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 97.94
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 97.94
2gi7_A184 GPVI protein; IG-like domains, blood clotting, cel 97.93
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 97.93
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 97.92
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 97.92
1p6f_A242 NKP46, natural cytotoxicity triggering receptor 1; 97.91
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 97.91
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 97.91
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 97.9
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 97.9
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 97.88
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 97.86
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 97.85
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 97.85
3vh8_G316 Killer cell immunoglobulin-like receptor 3DL1; imm 97.85
2erj_C247 Cytokine receptor common gamma chain; immune syste 97.84
3k2m_C101 Monobody HA4; engineered binding protein, antibody 97.84
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 97.83
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 97.83
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 97.81
3vh8_G316 Killer cell immunoglobulin-like receptor 3DL1; imm 97.81
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 97.8
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 97.8
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 97.8
4fom_A308 Poliovirus receptor-related protein 3; immunoglobu 97.79
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 97.79
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 97.78
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 97.78
3mjg_X289 Beta-type platelet-derived growth factor receptor; 97.77
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 97.77
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 97.76
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 97.76
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 97.76
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 97.75
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 97.74
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 97.74
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 97.7
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 97.7
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 97.67
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 97.66
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 97.65
3og6_B226 Interleukin 28 receptor, alpha (interferon, lambd 97.65
3s9d_B199 Interferon alpha/beta receptor 2; human, type I in 97.64
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 97.64
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 97.63
1oww_A98 FN, fibronectin first type III module, CIG; fibron 97.63
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 97.6
1nkr_A201 P58-CL42 KIR; inhibitory receptor, natural killer 97.6
4fqp_A313 Poliovirus receptor; immunoglobulin-like domain, I 97.6
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 97.59
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 97.57
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 97.57
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 97.55
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 97.55
1he7_A126 High affinity nerve growth factor receptor; transf 97.54
3mjg_X289 Beta-type platelet-derived growth factor receptor; 97.53
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 97.5
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 97.5
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 97.5
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 97.49
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 97.48
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 97.47
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 97.46
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 97.45
1b6u_A257 KIR2DL3, P58 killer cell inhibitory receptor; natu 97.44
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 97.44
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 97.44
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 97.43
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 97.43
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 97.41
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 97.38
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 97.37
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 97.36
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 97.34
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 97.32
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 97.32
2pet_A231 Lutheran blood group glycoprotein; immunoglobulin 97.31
1fyh_B229 Interferon-gamma receptor alpha chain; cytokine-re 97.29
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 97.29
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 97.29
2rcj_C 523 Light chain; immunoglobulin M, polymeric antibodie 97.27
1nqb_A256 Single-chain antibody fragment; multivalent antibo 97.24
2ghw_B247 Anti-SARS SCFV antibody, 80R; S protein, neutraliz 97.24
4i0k_A222 CD276 antigen; immunoglobulin domain, glycoprotein 97.24
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 97.24
3pv7_A248 B7-H6, IG-like domain-containing protein DKFZP686O 97.23
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 97.22
4hwu_A95 Fibroblast growth factor receptor 2; FGFR2, KGFR, 97.22
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 97.2
1z7z_I 450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 97.14
2zg1_A214 Sialic acid-binding IG-like lectin 5; siglec-5 inh 97.13
3o3u_N581 Maltose-binding periplasmic protein, advanced Gly 97.1
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 97.08
3tf7_C256 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; 97.06
3umt_A256 SCFV heavy chain and light chain; stability engine 97.05
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 97.03
1qok_A282 MFE-23 recombinant antibody fragment; immunoglobul 97.01
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 96.99
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 96.97
1y6k_R214 Interleukin-10 receptor alpha chain; helix bundle, 96.97
3eow_R221 Poliovirus receptor; immunoglobulin super family, 96.96
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 96.96
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 96.95
3b4n_A 344 Endo-pectate lyase; pectin, galacturonic acid, rig 96.94
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 96.94
1iam_A185 ICAM-1, CD54, intercellular adhesion molecule-1; r 96.91
3uzq_A253 Anti-dengue MAB 4E11; dengue antibody neutralizati 96.91
3juy_B256 3B3 single chain variant HIV-1 antibody; envelope 96.89
2p1y_A238 Bispecific alpha/beta TCR; autoimmunity, immunoglo 96.88
2rcj_C 523 Light chain; immunoglobulin M, polymeric antibodie 96.86
4frw_A218 Poliovirus receptor-related protein 4; immunoglobu 96.84
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 96.84
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 96.84
1f3r_B257 FV antibody fragment; IG-fold, immuno complex, ant 96.81
3mj8_L213 Stimulatory hamster antibody HL4E10 FAB light CHA; 96.8
2wng_A327 Tyrosine-protein phosphatase non-receptor type sub 96.79
1q38_A89 Fibronectin; amyloid fibril, anastellin, extracell 96.79
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 96.78
3gkz_A257 Anti-methamphetamine single chain FV; therapeutic 96.75
2dru_A180 Chimera of CD48 antigen and T-cell surface antige; 96.71
1qgc_4438 Protein (immunoglobulin); virus-antibody complex, 96.7
3d9a_L213 Light chain of hyhel10 antibody fragment (FAB); ly 96.68
2c1o_A254 IGK-C protein; FAB fragment, enantioselective, fin 96.67
2wng_A327 Tyrosine-protein phosphatase non-receptor type sub 96.63
3auv_A276 SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid 96.62
3rbg_A124 Cytotoxic and regulatory T-cell molecule; IGV, crt 96.61
1gsm_A210 Madcam-1, mucosal addressin cell adhesion molecule 96.59
2xzc_L216 FAB A.17 light chain; immune system; HET: XOP; 1.3 96.58
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 96.54
3ux9_B256 SCFV antibody; five helices, long loop connecting 96.54
1moe_A240 Anti-CEA MAB T84.66; anti carcinoembryonic antigen 96.5
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 96.49
3nl4_L213 Antigen binding fragment, immunoglobulin IGG - LI; 96.45
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 96.43
4fmk_A225 Poliovirus receptor-related protein 2; immunoglobu 96.39
1svz_A247 Immunoglobulin;, single-chain FV fragment 1696; an 96.38
1lk3_L210 9D7 light chain; antigen-antibody complex, immune 96.28
3bn3_B196 ICAM-5, intercellular adhesion molecule 5, telence 96.26
1q9r_B222 S25-2 FAB (IGG1K) heavy chain; antigen-binding fra 96.22
2c1o_A254 IGK-C protein; FAB fragment, enantioselective, fin 96.19
1qgc_4 438 Protein (immunoglobulin); virus-antibody complex, 96.15
3d9a_H210 Heavy chain of hyhel10 antibody fragment (FAB); ly 96.08
2csp_A130 RIM-BP2, RIM binding protein 2; FN3 domain, struct 95.94
1dee_B223 IGM RF 2A2; FAB-IBP complex 2.7A resolution bindin 95.87
2znx_A242 SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s 95.85
1pz5_B220 Heavy chain of FAB (SYA/J6); antibody-antigen stru 95.84
2uvf_A 608 Exopolygalacturonase; GH28, pectin, cell WALL, hyd 95.8
2gki_A291 Nuclease; anti-DNA antibody, catalytic antibody, i 95.73
1mq8_A291 ICAM-1, intercellular adhesion molecule-1, CD54 an 95.72
3esu_F250 Antibody 14B7* light chain and antibody 14B7* heav 95.66
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 95.59
1iga_A475 IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg 95.55
3csg_A461 MBP, maltose-binding protein monobody YS1 fusion, 95.53
2gjj_A264 A21 single-chain antibody fragment against ERBB2; 95.4
3s96_B218 3B5H10 FAB light chain; huntingtin, immune system; 95.38
3fku_X280 Neutralizing antibody F10; influenza, hemagglutini 95.37
3tv3_L211 PGT128 light chain, IG lambda-2 chain C regions; F 95.28
1iga_A 475 IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg 95.25
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 95.15
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 95.06
1q0x_L212 FAB 9B1, light chain; anti-morphine antibody, FAB 94.94
2j6e_L234 IGM, FAB light chain; autoimmune complex human IGM 94.91
3r06_A213 Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; 94.89
1igt_B 444 IGG2A intact antibody - MAB231; intact immunoglobu 94.87
1c1e_H219 Catalytic antibody 1E9 (heavy chain); diels-alder, 94.87
3omz_A259 Human vdelta1 gamma delta T cell receptor delta1A; 94.85
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 94.8
3sob_L237 Antibody light chain; beta propeller, protein bind 94.73
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 94.69
2vol_A207 Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, 94.68
3knb_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, AT 94.62
3m8o_H221 Immunoglobulin A1 heavy chain; immunoglobulin fold 94.49
3nl4_H215 Antigen binding fragment,immunoglobulin IGG - HEA; 94.48
2fbj_H220 IGA-kappa J539 FAB (heavy chain); immunoglobulin; 94.48
1hzh_H 457 IGG, immunoglobulin heavy chain; antibody, immune 94.44
1fyh_B229 Interferon-gamma receptor alpha chain; cytokine-re 94.32
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 94.26
3bqu_C233 3H6 FAB light chain; beta sheet, immune system; 3. 94.26
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 94.15
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 94.0
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 93.97
4gns_A290 Chitin biosynthesis protein CHS5; FN3, BRCT, tetra 93.97
4go6_A45 HCF N-terminal chain 1; tandem fibronectin repeat, 93.93
1za6_B344 IGG heavy chain; immunoglobulin fold, CH2-domain-d 93.9
1igy_B 434 IGG1 intact antibody MAB61.1.3; intact immunoglobu 93.88
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 93.79
2rgs_A218 I, IG gamma-2B heavy chain; FC-fragment, immunoglo 93.76
1l6x_A207 Immunoglobulin gamma-1 heavy chain constant regio; 93.68
1mju_H227 Immunoglobulin MS6-12; catalytic antibody, ester h 93.63
1x9q_A268 SCFV, 4M5.3 anti-fluorescein single chain antibody 93.57
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 93.56
1op3_H225 FAB 2G12, heavy chain; domain-swapped FAB 2G12, an 93.49
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
Probab=99.93  E-value=4.2e-23  Score=154.67  Aligned_cols=170  Identities=22%  Similarity=0.302  Sum_probs=133.6

Q ss_pred             CCeeEEEEEEeCCCCceeEEEEEecCCCCCCE-EEEEeecCCeEEEEeeeCC-CCCccccEEEEEEEe-CCCCcEEEEeC
Q psy9139           1 MVGNYTCLADNIFGKDDIYYQVTILSPPGVPN-ILLQSTTTHSISILWKPSY-DGGAIITHYIVSYRD-RTEDWQSVHVD   77 (197)
Q Consensus         1 ~~g~y~c~a~n~~G~~~~~~~~~~~~~P~~p~-~~~~~~~~~~~~l~W~~~~-~~~~~i~~y~v~~~~-~~~~~~~~~~~   77 (197)
                      +.|.|+|.|.|..|.....+.+.+..+|.+|. +.+......++.|.|.++. +++.++..|.++|+. ....|......
T Consensus       169 d~G~Y~C~a~N~~G~~~~~~~l~v~~~P~~P~~~~~~~~~~~~~~l~w~~p~~~~g~pi~~y~v~~~~~~~~~~~~~~~~  248 (389)
T 2jll_A          169 DFGRYNCTATNHIGTRFQEYILALADVPSSPYGVKIIELSQTTAKVSFNKPDSHGGVPIHHYQVDVKEVASEIWKIVRSH  248 (389)
T ss_dssp             SSEEEEEEEEETTEEEEEEEEEEECCCCCCCEEEEEEEECSSCEEEEEECCSCCTTSCEEEEEEEEEETTCSCCEEEECS
T ss_pred             hCEEEEEEEEcCCCcEEEEEEEEecCCCCCCcceEEeeccCCEEEEEEeCCCCCCCcceEEEEEEEEECCCcccEEeecc
Confidence            47999999999999988888899999999996 8888888899999999875 555688899999984 45678876666


Q ss_pred             CcccEEEECCCCCCCEEEEEEEEEcCCcCCCCCCceEeecCCC--C---------------CCCeeecCCCC--------
Q psy9139          78 AEYREFTLTQLKCGTHYKINIKLVNSIGESKPSKTIAASTKGE--D---------------QTDWINIPLSN--------  132 (197)
Q Consensus        78 ~~~~~~~i~~L~p~~~y~~~v~a~~~~g~~~~s~~~~~~t~~~--~---------------~~~w~~~~~~~--------  132 (197)
                      .....+.|.+|.+++.|.|+|.|.|..|.+.++....+.+.+.  +               ...|.......        
T Consensus       249 ~~~~~~~i~~l~~~~~y~~~v~A~N~~G~~~~s~~~~~~t~~~~~p~~p~~~~~~~~~~~v~l~W~~p~~~~~~i~~Y~v  328 (389)
T 2jll_A          249 GVQTMVVLNNLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKLSITKQDDGGAPILEYIV  328 (389)
T ss_dssp             TTCSEEEECSCCTTCEEEEEEEEEESSCBCCCCCCEEEECCCCCCCCCCCEEEEEETTTEEEEEECCCCCCSSCCCEEEE
T ss_pred             CCcceEEECCccCCCEEEEEEEEEcCCccCCCCcceEEEecCCCCCCCCccccccCcCCEEEEEEECCCCCCCcccEEEE
Confidence            6678899999999999999999999999998887776665332  1               23343211000        


Q ss_pred             --------------CcccccceEEEcCCCCCCeEEEEEEEEcCCCCCCcceE
Q psy9139         133 --------------LDEALEMPLVIENLLPATRYELTISAKNDAGSTNKNYV  170 (197)
Q Consensus       133 --------------~~~~~~~~~~i~~L~p~t~Y~v~V~a~n~~G~~~~~~~  170 (197)
                                    ........++|.+|+|++.|.|+|+|.|..|.|+++..
T Consensus       329 ~~~~~~~~~~~~~~~~~~~~~~~~i~~L~~~t~Y~~~V~A~n~~G~s~~s~~  380 (389)
T 2jll_A          329 KYRSKDKEDQWLEKKVQGNKDHIILEHLQWTMGYEVQITAANRLGYSEPTVY  380 (389)
T ss_dssp             EEEC-----CCBCCEECTTCCEEEECSCCTTCEEEEEEEEEC-CCBCCCEEE
T ss_pred             EEEeCCCCcceeEeeccCCcceEEeCCcCCCCEEEEEEEEEcCCcCCCceee
Confidence                          00012457899999999999999999999999997643



>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Back     alignment and structure
>1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Back     alignment and structure
>1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wft_A 1700129L13RIK protein; FN3 domain, similar to HOST cell factor 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Back     alignment and structure
>1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Back     alignment and structure
>1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Back     alignment and structure
>4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* Back     alignment and structure
>3s9d_B Interferon alpha/beta receptor 2; human, type I interferons, IFNA2, ifnar2, SUB-complex of the interferon signaling complex; 2.00A {Homo sapiens} PDB: 1n6u_A 1n6v_A 2hym_A 2ksx_B 2kz1_B 2lag_B 3se4_C* 3se3_C* 3s8w_A* Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Back     alignment and structure
>1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Back     alignment and structure
>1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A Back     alignment and structure
>4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Back     alignment and structure
>1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Back     alignment and structure
>1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Back     alignment and structure
>2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} Back     alignment and structure
>1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H Back     alignment and structure
>2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Back     alignment and structure
>4hwu_A Fibroblast growth factor receptor 2; FGFR2, KGFR, CD332, IG-C2 type 1 domain, IG superfamily, IMM system, structural genomics, PSI-biology; 2.90A {Mus musculus} Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A Back     alignment and structure
>3o3u_N Maltose-binding periplasmic protein, advanced Gly END product-specific receptor; RAGE, AGER, scavenger receptor; HET: MLR; 1.50A {Escherichia coli} PDB: 3s59_A 3s58_A 3cjj_A 2l7u_A* 2e5e_A Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Back     alignment and structure
>3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} Back     alignment and structure
>3umt_A SCFV heavy chain and light chain; stability engineering, anthrax, anti-BCLA antibody, immunoglobulin fold (VH and VL domains), antibody, immune S; HET: NHE; 1.80A {Mus musculus} PDB: 1xiw_D Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1qok_A MFE-23 recombinant antibody fragment; immunoglobulin, single-chain FV, anti-carcinoembryonic antigen; 2.4A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Back     alignment and structure
>1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Back     alignment and structure
>3b4n_A Endo-pectate lyase; pectin, galacturonic acid, right-handed parallel beta helix fold; 1.45A {Erwinia chrysanthemi} PDB: 3b8y_A* 3b90_A Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Back     alignment and structure
>1iam_A ICAM-1, CD54, intercellular adhesion molecule-1; rhinovirus receptor, cell adhesion, integrin ligand, glycopr LFA-1 ligand, immunoglobulin fold; HET: NAG; 2.10A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ic1_A* 1d3l_A 1d3e_I 1d3i_I 3tcx_A Back     alignment and structure
>3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A Back     alignment and structure
>3juy_B 3B3 single chain variant HIV-1 antibody; envelope protein GP120, broadly neutralizing antibody, 3B3 single chain variable fragment, immune system; 2.50A {Homo sapiens} Back     alignment and structure
>2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A Back     alignment and structure
>2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} Back     alignment and structure
>4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Back     alignment and structure
>1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Back     alignment and structure
>1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Back     alignment and structure
>3gkz_A Anti-methamphetamine single chain FV; therapeutic antibody, MDMA, IGG, immune system; HET: B40; 1.90A {Mus musculus} PDB: 3gm0_A* 1rvf_L 3ab0_C 2a0l_C 3iy5_A Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Back     alignment and structure
>1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 Back     alignment and structure
>3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... Back     alignment and structure
>2c1o_A IGK-C protein; FAB fragment, enantioselective, finrozole, immune system, antibody, ENA11His antibody, immunoglobulin domain; 2.75A {Mus musculus} Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Back     alignment and structure
>3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L Back     alignment and structure
>3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Back     alignment and structure
>1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* Back     alignment and structure
>2xzc_L FAB A.17 light chain; immune system; HET: XOP; 1.36A {Homo sapiens} PDB: 2xza_L* 3kdm_L* 3nps_C 1dn0_A 1qlr_A* 2v7n_A 3eo0_A 3eo1_A 2agj_L* 2fx7_L 1tzg_L 2fx8_L 2fx9_L* 1u6a_L 3hi1_L* 3kym_A 3kyk_L 3qwo_L* 3ixt_L* 3qeg_L ... Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Back     alignment and structure
>3ux9_B SCFV antibody; five helices, long loop connecting helix, hydrophobic intera cytokine-immune system complex; 2.80A {Homo sapiens} Back     alignment and structure
>1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Back     alignment and structure
>4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* Back     alignment and structure
>1svz_A Immunoglobulin;, single-chain FV fragment 1696; antibody-antigen complex, HIV inhibiting antibody; 1.89A {Mus musculus} PDB: 1jp5_A Back     alignment and structure
>1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* Back     alignment and structure
>3bn3_B ICAM-5, intercellular adhesion molecule 5, telencephalin; I domain, integrin, allosteric mobility, cell adhesi immune system; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>1q9r_B S25-2 FAB (IGG1K) heavy chain; antigen-binding fragment, anti-carbohydrate, anti-LPS, antibody, immunoglobulin, KDO, complex, immune system; HET: KDA KDO; 1.45A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q9l_B 1q9k_B* 1q9q_B* 1q9v_B* 2r1w_B* 2r1x_B* 2r1y_B* 2r2b_B* 2r2e_B* 2r2h_B* 3bpc_B* 3sy0_B* 3t4y_B* 3t65_B* 2r23_B* 1q9t_B* 3t77_B* 3okl_B* 3okk_B* 3okm_B ... Back     alignment and structure
>2c1o_A IGK-C protein; FAB fragment, enantioselective, finrozole, immune system, antibody, ENA11His antibody, immunoglobulin domain; 2.75A {Mus musculus} Back     alignment and structure
>1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 Back     alignment and structure
>3d9a_H Heavy chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_H 1gpo_H 3ks0_H* 1dqd_H 1ndm_B 1nak_H 1dqq_B 1dqm_H 1dqj_B 1nby_B 1nbz_B 1xgu_B 1ndg_B 1xgt_B 1xgp_B 1xgq_B 1xgr_B 1s5i_H 1f8t_H 1f90_H ... Back     alignment and structure
>2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1dee_B IGM RF 2A2; FAB-IBP complex 2.7A resolution binding outside the antigen combining site superantigen FAB VH3 specificity; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1hez_B 1adq_H Back     alignment and structure
>2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* Back     alignment and structure
>1pz5_B Heavy chain of FAB (SYA/J6); antibody-antigen structure, peptide-carbohydrate mimicry, VA design, immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1m7d_B* 1m71_B* 1m7i_B* 1r24_B 1uz6_F 1uz8_B* 1clz_H* Back     alignment and structure
>2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* Back     alignment and structure
>2gki_A Nuclease; anti-DNA antibody, catalytic antibody, immune system; 2.88A {Mus musculus} Back     alignment and structure
>1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Back     alignment and structure
>3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Back     alignment and structure
>1iga_A IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg_A 2qtj_A 3chn_A 1r70_B 3cm9_A Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* Back     alignment and structure
>2gjj_A A21 single-chain antibody fragment against ERBB2; IG family, SCFV, immune system; 2.10A {Mus musculus} PDB: 3h3b_C Back     alignment and structure
>3s96_B 3B5H10 FAB light chain; huntingtin, immune system; 1.90A {Mus musculus} PDB: 2qhr_L 3ffd_B 4dcq_A Back     alignment and structure
>3fku_X Neutralizing antibody F10; influenza, hemagglutinin, SCFV, F membrane, envelope protein, fusion protein, membrane, trans virion; HET: NAG BMA; 3.20A {Homo sapiens} Back     alignment and structure
>3tv3_L PGT128 light chain, IG lambda-2 chain C regions; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_L* 3twc_L* 3tnm_L 2mcg_1 1mcw_M 1a8j_L 3mcg_1 1dcl_A 1mcb_A* 1mcc_A* 1mcd_A* 1mce_A* 1mcf_A* 1mch_A 1mci_A* 1mcj_A* 1mck_A 1mcl_A* 1mcn_A* 1mcq_A ... Back     alignment and structure
>1iga_A IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg_A 2qtj_A 3chn_A 1r70_B 3cm9_A Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>1q0x_L FAB 9B1, light chain; anti-morphine antibody, FAB fragment, immune system; HET: PG4; 1.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q0y_L* 1ngp_L* 1ngq_L 3ks0_L* 1gig_L 2vir_A 2vis_A* 2vit_A 1sm3_L 4a6y_L 1ind_L* 1ine_L* 1yuh_L* 2zpk_L 3rhw_K* 3ri5_K* 3ria_K* 3rif_K* 1mfe_L* 1mfb_L* ... Back     alignment and structure
>2j6e_L IGM, FAB light chain; autoimmune complex human IGM rheumatoid factor IGG1-FC, immunoglobulin C region, membrane, glycoprotein, transmembrane; HET: NAG FUL BMA MAN NDG GAL; 3.0A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>3r06_A Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; anti-CD3epsilon, T-cell receptor, signalling, IMMU; 2.50A {Cricetulus migratorius} PDB: 3r08_L 3ld8_B 3ldb_B* Back     alignment and structure
>1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>1c1e_H Catalytic antibody 1E9 (heavy chain); diels-alder, immunoglobulin, immune system; HET: ENH; 1.90A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1dbb_H* 1dba_H* 1dbj_H* 1dbk_H* 1dbm_H* 2dbl_H* 3ojd_B 1jgl_H* 1jhk_H 1ghf_H 1tet_H* 3e8u_H 1fj1_B 1cl7_H Back     alignment and structure
>3omz_A Human vdelta1 gamma delta T cell receptor delta1A; immunoglobulin fold, immune surveillance of cell stress PROT A/B, MIC-A/B binding, epithelium; 3.04A {Homo sapiens} Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Back     alignment and structure
>3sob_L Antibody light chain; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_A 3u1s_L* Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2vol_A Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, cytoplasm, mouse IGG, zinc-finger, DNA-binding, RNA-binding, tripartite motif (TRIM) protein; HET: NAG MAN GAL FUC; 1.95A {Mus musculus} PDB: 3hkf_A 1i1a_C* 1cqk_A Back     alignment and structure
>3knb_B Obscurin-like protein 1; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2wp3_O* 2wwm_C 2wwk_O Back     alignment and structure
>3m8o_H Immunoglobulin A1 heavy chain; immunoglobulin fold, immune system; 1.55A {Homo sapiens} PDB: 3qnx_B 3qny_B Back     alignment and structure
>2fbj_H IGA-kappa J539 FAB (heavy chain); immunoglobulin; HET: NAG FUC; 1.95A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mcp_H 2mcp_H* Back     alignment and structure
>1hzh_H IGG, immunoglobulin heavy chain; antibody, immune system; HET: NAG BMA MAN GAL FUC; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 PDB: 2ig2_H 1mco_H* Back     alignment and structure
>1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Back     alignment and structure
>3bqu_C 3H6 FAB light chain; beta sheet, immune system; 3.00A {Mus musculus} Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Back     alignment and structure
>4gns_A Chitin biosynthesis protein CHS5; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4go6_A HCF N-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>1za6_B IGG heavy chain; immunoglobulin fold, CH2-domain-deletion, immune system; 2.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 Back     alignment and structure
>1igy_B IGG1 intact antibody MAB61.1.3; intact immunoglobulin, V region, C region, hinge region, immunoglobulin; HET: NAG FUL NDG BMA MAN GAL FUC; 3.20A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Back     alignment and structure
>2rgs_A I, IG gamma-2B heavy chain; FC-fragment, immunoglobulin, glycosylation, immune system; HET: NAG FUC MAN GAL; 2.13A {Mus musculus} Back     alignment and structure
>1l6x_A Immunoglobulin gamma-1 heavy chain constant regio; IGG1 FC, FC complex, immune system; HET: NAG BMA MAN GAL FUL; 1.65A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2iwg_A* 3v7m_A* 3d6g_A* 3agv_A* 1oqo_A* 1oqx_A* 3v95_A* 2wah_A* 3sgj_A* 3sgk_A* 2dtq_A* 2dts_A* 3ave_A* 3ay4_A* 3do3_A* 2gj7_A* 1t83_A* 1t89_A* 1dn2_A* 3dnk_A ... Back     alignment and structure
>1mju_H Immunoglobulin MS6-12; catalytic antibody, ester hydrolysis, esterolytic, FAB, immune system; 1.22A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mjj_B 1mie_H 1mj7_H* 1mj8_H 1mh5_B* 4aeh_H 2y5t_A 2vwe_E 2op4_H 2ntf_H 3loh_C 1e4x_H 2vl5_A 1e4x_I 1e4w_H 3opz_H 3oz9_H 1plg_H 1hi6_B 1cfn_B ... Back     alignment and structure
>1x9q_A SCFV, 4M5.3 anti-fluorescein single chain antibody fragment; VERY high affinity, antibody binding, electrostatics, directed evolution; HET: FLU; 1.50A {Homo sapiens} Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Back     alignment and structure
>1op3_H FAB 2G12, heavy chain; domain-swapped FAB 2G12, anti-carbohydrate antibody, immune system; HET: MAN; 1.75A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1om3_H* 1op5_H* 3oay_M* 1zlu_H* 1zlv_H* 1zlw_H* 2oqj_B 1zls_H* 3ob0_H* 3oau_H* 3oaz_H* 3ghe_H 3eyf_B 3eyo_B 3ghb_H 3c2a_H 1q1j_H 2fl5_H* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 197
d1wf5a1108 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) 4e-16
d2crza197 b.1.2.1 (A:8-104) Fibronectin type-III domain cont 6e-16
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 1e-14
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 2e-14
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 2e-14
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 3e-14
d1x3da1105 b.1.2.1 (A:8-112) Fibronectin type-III domain cont 3e-13
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 3e-13
d2djsa195 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human 6e-13
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 1e-12
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 1e-12
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 8e-12
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 8e-12
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 1e-11
d1qg3a192 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum 9e-11
d1x5ya198 b.1.2.1 (A:8-105) Myosin binding protein C, fast-t 1e-10
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 1e-10
d1fnfa194 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m 2e-10
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 2e-10
d2cuma193 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) 2e-10
d1tdqa386 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic 3e-10
d1x4xa193 b.1.2.1 (A:8-100) Fibronectin type-III domain cont 4e-10
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 4e-10
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 2e-06
d2crma1107 b.1.2.1 (A:8-114) Fibronectin type-III domain cont 6e-10
d1x5aa194 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse 6e-10
d1x5ia1113 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [ 1e-09
d1wk0a_137 b.1.2.1 (A:) Fibronectin type-III domain containin 1e-09
d1x5ha1119 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ 1e-09
d1x5xa196 b.1.2.1 (A:8-103) Fibronectin type-III domain cont 3e-09
d1cfba2105 b.1.2.1 (A:710-814) Neuroglian, two amino proximal 3e-09
d1bqua195 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine- 4e-09
d1x5ja1100 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ 4e-09
d1fnfa389 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m 7e-09
d1qr4a187 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) 8e-09
d1tdqa292 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu 8e-09
d1cd9b1107 b.1.2.1 (B:1-107) Granulocyte colony-stimulating f 9e-09
d1owwa_93 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 9e-09
d1x4ya1101 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { 1e-08
d1fnfa291 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m 1e-08
d1wfta_123 b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus 1e-08
d2ic2a1107 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit 2e-08
d1uc6a_109 b.1.2.1 (A:) Ciliary neurotrophic factor receptor 2e-08
d1qr4a288 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu 2e-08
d1cfba1100 b.1.2.1 (A:610-709) Neuroglian, two amino proximal 2e-08
d1f6fb2103 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu 3e-08
d1wfua_120 b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat 3e-08
d1n26a3104 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c 3e-08
d1fnha290 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu 6e-08
d2haza1101 b.1.2.1 (A:489-589) Neural cell adhesion molecule 9e-08
d1v5ja_108 b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId 2e-07
d1fnaa_91 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 2e-07
d1ueya_127 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 2e-07
d1fnha190 b.1.2.1 (A:3-92) Fibronectin, different Fn3 module 2e-07
d1j8ka_94 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 2e-07
d1fnha389 b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod 3e-07
d1ujta_120 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 5e-07
d1tena_90 b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId 6e-07
d1wisa1111 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) 7e-07
d1wj3a_117 b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo s 1e-06
d2fnba_95 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 1e-06
d2cuia1101 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) 1e-06
d1tdqa193 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) 2e-06
d2vkwa293 b.1.2.1 (A:601-693) Neural cell adhesion molecule 2e-06
d2dtge1102 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo 6e-06
d2ibga195 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit 7e-06
d1fyhb198 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha 8e-06
d1bpva_104 b.1.2.1 (A:) Type I titin module {Human (Homo sapi 1e-05
d1qg3a2103 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum 3e-05
d1k85a_88 b.1.2.1 (A:) Fibronectin type III domain from chit 8e-05
d2cuha1102 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) 8e-05
d2dtge3125 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo 1e-04
d2cqva1101 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T 1e-04
d2gysa4100 b.1.2.1 (A:317-416) Common beta-chain in the GM-CS 3e-04
d1erna2105 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor 5e-04
d2gysa2114 b.1.2.1 (A:104-217) Common beta-chain in the GM-CS 9e-04
d1y6kr199 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10 0.001
d2cspa1117 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Ho 0.002
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Fibronectin type III
family: Fibronectin type III
domain: Sidekick 2
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 68.7 bits (167), Expect = 4e-16
 Identities = 21/97 (21%), Positives = 38/97 (39%), Gaps = 2/97 (2%)

Query: 26  SPPGVPNILLQSTTTHSISILWKPSYDGGAIITHYIVSYRDRTEDWQS--VHVDAEYREF 83
             P  P   L +    +I++ W   +DG + +  YI+   +    W      VD +    
Sbjct: 12  HAPEHPVATLSTVERRAINLTWTKPFDGNSPLIRYILEMSENNAPWTVLLASVDPKATSV 71

Query: 84  TLTQLKCGTHYKINIKLVNSIGESKPSKTIAASTKGE 120
           T+  L     Y+  +  VN +G+ + SK     +  E
Sbjct: 72  TVKGLVPARSYQFRLCAVNDVGKGQFSKDTERVSLPE 108


>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query197
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.73
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.73
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 99.7
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.69
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 99.69
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.69
d1x3da1105 Fibronectin type-III domain containing protein 3a, 99.68
d1x4xa193 Fibronectin type-III domain containing protein 3a, 99.68
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 99.68
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.67
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 99.67
d2crza197 Fibronectin type-III domain containing protein 3a, 99.66
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.66
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1x5xa196 Fibronectin type-III domain containing protein 3a, 99.64
d2crma1107 Fibronectin type-III domain containing protein 3a, 99.64
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 99.63
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 99.61
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.6
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.6
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.59
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.59
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.58
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.57
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.57
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.56
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.55
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 99.54
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.54
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.53
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.52
d1va9a1109 Down syndrome cell adhesion molecule-like protein 99.52
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 99.52
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 99.52
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.52
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 99.52
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 99.51
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 99.51
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 99.5
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.5
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 99.5
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 99.5
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 99.5
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 99.5
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 99.48
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.47
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.47
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.46
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 99.46
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 99.46
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 99.45
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 99.44
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.44
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 99.43
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 99.42
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.42
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 99.41
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 99.41
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 99.4
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 99.39
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 99.39
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 99.38
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.37
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 99.37
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.36
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 99.35
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 99.34
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 99.33
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 99.31
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 99.31
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 99.29
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.28
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 99.24
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 99.17
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.13
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 99.12
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 98.95
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 98.89
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 98.89
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 98.64
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 98.56
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 98.55
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.53
d2crza197 Fibronectin type-III domain containing protein 3a, 98.52
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 98.52
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 98.5
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.5
d1x5xa196 Fibronectin type-III domain containing protein 3a, 98.49
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 98.48
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 98.46
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 98.45
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 98.45
d1x4xa193 Fibronectin type-III domain containing protein 3a, 98.44
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 98.44
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.41
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 98.39
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 98.37
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 98.36
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 98.33
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.31
d1va9a1109 Down syndrome cell adhesion molecule-like protein 98.3
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.3
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 98.3
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 98.3
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 98.29
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 98.28
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 98.26
d2crma1107 Fibronectin type-III domain containing protein 3a, 98.26
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 98.26
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 98.25
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 98.24
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 98.24
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 98.24
d1x3da1105 Fibronectin type-III domain containing protein 3a, 98.22
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 98.21
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 98.21
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 98.21
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 98.21
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 98.2
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 98.19
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 98.18
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 98.18
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 98.18
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 98.17
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 98.15
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.13
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 98.13
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 98.12
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 98.1
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 98.1
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 98.1
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 98.1
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 98.09
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 98.08
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 98.07
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 98.07
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 98.06
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 98.05
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 98.04
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 98.04
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 98.03
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 98.03
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 98.03
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 97.99
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 97.99
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 97.96
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 97.94
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 97.92
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 97.91
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 97.91
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 97.88
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 97.87
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 97.85
d2qfra1112 Purple acid phosphatase, N-terminal domain {Kidney 97.84
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 97.74
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 97.68
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 97.66
d1xzwa1119 Purple acid phosphatase, N-terminal domain {Sweet 97.65
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 97.58
d2nxyb284 CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 97.58
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 97.5
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 97.43
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 97.39
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 97.28
d1f6fb196 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 97.27
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 97.26
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 97.13
d2hyma1109 Interferon-alpha/beta receptor beta chain {Human ( 96.38
d1olza192 Semaphorin 4d Ig-like domain {Human (Homo sapiens) 96.37
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 96.01
d2c4fu1116 Extracellular region of human tissue factor {Human 96.0
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 95.84
d1iray2103 Type-1 interleukin-1 receptor {Human (Homo sapiens 95.63
d2qfra1112 Purple acid phosphatase, N-terminal domain {Kidney 95.6
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 95.36
d1f97a2110 Junction adhesion molecule, JAM, C-terminal domain 95.34
d1xzwa1119 Purple acid phosphatase, N-terminal domain {Sweet 95.03
d1fhga_102 Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 94.93
d1koaa197 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 94.56
d1g1ca_98 Titin {Human (Homo sapiens), different modules [Ta 94.47
d2hfta1106 Extracellular region of human tissue factor {Human 94.38
d1f2qa289 IgE high affinity receptor alpha subunit {Human (H 94.32
d1gsma190 Mucosal addressin cell adhesion molecule-1 (MADCAM 94.04
d1a21a1103 Extracellular region of human tissue factor {Rabbi 93.88
d3b5ha1101 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 92.85
d1tnna_91 Titin {Human (Homo sapiens), different modules [Ta 92.84
d1biha397 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 91.88
d1wiua_93 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 91.44
d1cs6a391 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 90.3
d1axib199 Growth hormone receptor {Human (Homo sapiens) [Tax 90.28
d3dara197 Fibroblast growth factor receptor, FGFR {Human (Ho 89.92
d1qz1a3100 Neural cell adhesion molecule (NCAM) {Rat (Rattus 89.88
d1rhfa191 Tyrosine-protein kinase receptor tyro3, N-terminal 89.79
d1epfa197 Neural cell adhesion molecule (NCAM) {Rat (Rattus 89.66
d1nbqa2104 Junction adhesion molecule, JAM, C-terminal domain 89.11
d2c4fu1116 Extracellular region of human tissue factor {Human 88.82
d2fdbp2109 Fibroblast growth factor receptor, FGFR {Human (Ho 88.52
d1gl4b_89 Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 88.5
d1biha489 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 88.44
d2c9aa196 Receptor-type tyrosine-protein phosphatase mu {Hum 88.09
d1vcaa290 Vascular cell adhesion molecule-1 (VCAM-1) {Human 87.53
d1cs6a489 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 87.47
d1l6za296 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t 86.09
d1f6fb196 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 85.46
d1ucta199 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 84.62
d1olla195 Ligand binding domain of NK receptor NKp46 {Human 84.58
d1x44a190 Myosin-binding protein C, slow-type {Human (Homo s 83.11
d1cs6a2105 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 82.5
d1biha194 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 81.65
d1pd6a_94 Cardiac myosin binding protein C, different domain 80.61
d2nxyb284 CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 80.12
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Fibronectin type III
family: Fibronectin type III
domain: Sidekick 2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.73  E-value=5.9e-18  Score=103.08  Aligned_cols=98  Identities=20%  Similarity=0.437  Sum_probs=78.3

Q ss_pred             EEEEecCCCCCCE---EEEEeecCCeEEEEeeeCCCCCccccEEEEEEEeCCCCcEEEE--eCCcccEEEECCCCCCCEE
Q psy9139          20 YQVTILSPPGVPN---ILLQSTTTHSISILWKPSYDGGAIITHYIVSYRDRTEDWQSVH--VDAEYREFTLTQLKCGTHY   94 (197)
Q Consensus        20 ~~~~~~~~P~~p~---~~~~~~~~~~~~l~W~~~~~~~~~i~~y~v~~~~~~~~~~~~~--~~~~~~~~~i~~L~p~~~y   94 (197)
                      +.+.++..|.+|.   +.+...+.+++.|.|.+|.+++++|.+|.|+++.....|....  .....+.++|.+|.|++.|
T Consensus         3 ~~l~v~~~P~~P~~p~~~~~~~~~~sv~l~W~~P~~~~~~I~~Y~v~~~~~~~~~~~~~~~~~~~~~~~~i~~L~p~t~Y   82 (108)
T d1wf5a1           3 AHLRVRQLPHAPEHPVATLSTVERRAINLTWTKPFDGNSPLIRYILEMSENNAPWTVLLASVDPKATSVTVKGLVPARSY   82 (108)
T ss_dssp             CCSSCCCCCCCCSSCEEEECSSSTTEEEEECCCCCCCSSCEEEEEEEEECTTCCCEEEESSCCTTCCEEEEESCCTTCEE
T ss_pred             cccEEecCCCCCCCCEEEEEeccCCEEEEEEECCCCCCCccEEEEEEEEeccCCceEEeeeecCCccEEEECCCCCCCEE
Confidence            4456677777765   4455677889999999998888899999999997666666554  3455678999999999999


Q ss_pred             EEEEEEEcCCcCCCCCCceEeec
Q psy9139          95 KINIKLVNSIGESKPSKTIAAST  117 (197)
Q Consensus        95 ~~~v~a~~~~g~~~~s~~~~~~t  117 (197)
                      .|+|.|.|..|.|.++......+
T Consensus        83 ~frV~A~N~~G~s~~S~~~~~~t  105 (108)
T d1wf5a1          83 QFRLCAVNDVGKGQFSKDTERVS  105 (108)
T ss_dssp             EEEEEEEESSCEEEECCCCSCEE
T ss_pred             EEEEEEEcCCcCCCCcCCcCCEE
Confidence            99999999999988877655444



>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyma1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d2hfta1 b.1.2.1 (A:1-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1axib1 b.1.2.1 (B:32-130) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure