Psyllid ID: psy9228


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830----
NAYIKWSRADGLPLQRYAEGNVLRITNARLQDSGKYKCEIQGHDSFRGSDYVKLNVERMMFVDGIGPFSGESQGAFQGLDLSELVYIGAVPDFGEIHPSAGFSNGFKGCVSRLKYNKTEFELFKMAVERVGVDSCNTCKSSKHNNCINNGLCQDAATRIGYTCICPPGFSGDRCSVLGEPCYPGACGDGSCQDVDGAMKCLCPIGTAGKRCEQKIKILQPAFKHGSYLAYPTPKTMRKFKVSLRLNPRDVRDGIILYSGQSDDGLGDFISLAIREKHMEFRFDTGSATPLYSNDAPAFNPVSTKEAPYGSKITLTCNNDLEAPVEYTWSKRSNGHVLPFGAFSRENTLTLQEIKNSDAGMYVCKVSNKDMTVEIPSILLVTDSVPLFTQKPLSYLALPTLTDAHLHFSIELSFKPTDYNGLIMYTGDSNMKSYKGKGDFVSFGLEDGYPVFRFDVGLVVLRSKVTLVPHEWVVVTIIKDFKEGKLSVGGEPLIVGSTPGEKLQVLNLRTPLYLGGYNIYHVTPSLSVEVTEGFHGCISTIDVLGSELDLINSAVDSANIMDCSDLESSPVCAPKPCQNYGICYPTDTSERGYNCSCLTGYSGDHCEKENNMCMKGDVCKNGGMCKVTPDSYECLCSLGYAPPNCAKRVSIGSEVHFLGEGYVELKKELIEERRNEETIAFDFVTDDKNALLLWNGQPSYKNGIGREFIAVAVVNGYLEYSYDLGDGVVTIKFSKKPVNDGIKHSVNVTRINKFGSLEVDSVIVGKGESPGSQDVINTRGNIYLGGTPNMDLMTGGRYVHPMSGLMMNIHIQNKHISNIGSSASSGLHVMPWIRK
ccEEEEEEEccEEEEEEccccEEEEEEcEEEcccEEEEEEEEccccccccEEEEEEEEEEEEcccccEEEEEccccccccccccEEEccccccccccccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccEEccccccccEEEEcccccccccccccccccccccccccEEEccccccEEEcccccccccccccccccccccccccEEEEEccccccEEEEEEEEcccccccccEEEEEEEccccccEEEEEEEccEEEEEEEccccccccccccccccccEEEEcccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccEEccccccccccccEEEEccccccccEEEEEEEEEccccccEEEEEEcccccccccccccEEEEEEEccEEEEEEEcccEEEEEEEEEEcccEEEEEEEEEccEEEEEEcccccEEEccccccccEEccccccEEccccccccccccccccccccEEEEEcEEEccccccccccccccccccccccccccccccccccccccEEEEcccccccEEEEcccccccccccccccccccccccccccEEEEcccccEEEccccccccccccccccccccccccccEEEEccccccccccccEEEEEEEEcccccEEEEcccccccccccccEEEEEEEccEEEEEEEcccccEEEEEccccccccccEEEEEEEEccEEEEEEccEEEEEEEccccccEEEccccEEEccccccccccccccccccEEEEEEEEEccEEcccccccccccccccccccc
ccEEEEEEcccEEEEEEccccEEEEccccccccccEEEEEEEccccccccEEEEEEEEEEEEcccccEccccccccEEEEccccEEEcccccccccccccccccccEEEEEEEEEcccccHHHHHHHHHcccccccccccccccccccccEEEccccccccEEccccccccccccccccccccccccccEEcccccccEEcccccccccccccccEEEEccccccEEEEEccccccccccEEEEEEEccccccEEEEEEccccccccEEEEEEEccEEEEEEEcccccEEEEcccccccccEEEEEEcccEEEEEEcccccccccccccEEcccccEcccccccccccccccccccccccEEEEccccccEEEccccEEccccccccccccccEEEccccccccccEEEEEEEEcccccEEEEEEcccccccccccccEEEEEEEccEEEEEEEccccEEEcccccccccEEEEEEEEcccEEEEEEcccccccccccccccEEEEccccEEEccccccccccccccccccccEEEEEEEEEccccccHHHHHHccccccccccccccccccccccccccEEcccccccccEEEEcccccccccccccccccccccccccccEEEEcccccEEEcccccccccccccccccEEcccccccEEEEccccccccccccEEEEEEEcccccEEEEEEccccccccccccEEEEEEEccEEEEEEEcccccEEEEEcccccccccEEEEEEEEcccEEEEEEccccccccccccccEEEEcccEEEEccccccccccccccccccEEEEEEEEEccccHHHHHHHccccccEcccccc
nayikwsradglplqryaegnVLRITNarlqdsgkykceiqghdsfrgsdyVKLNVERMMfvdgigpfsgesqgafqgldlSELVyigavpdfgeihpsagfsngfKGCVSRLKYNKTEFELFKMAVERVgvdscntcksskhnncinnglcqdaatrigytcicppgfsgdrcsvlgepcypgacgdgscqdvdgamkclcpigtagkRCEQKIKILQpafkhgsylayptpktmRKFKVSlrlnprdvrDGIILysgqsddglGDFISLAIREKHMefrfdtgsatplysndapafnpvstkeapygskitltcnndleapveytwskrsnghvlpfgafsrentltlqeiknsdagmyvckvsnkdmtveipsillvtdsvplftqkplsylalptltdaHLHFSIelsfkptdynglimytgdsnmksykgkgdfvsfgledgypvfrfDVGLVVLRSKVTLVPHEWVVVTIIKDfkegklsvggeplivgstpgeklqvlnlrtplylggyniyhvtpslsvevtegfhgcISTIDVLGSELDLINSavdsanimdcsdlesspvcapkpcqnygicyptdtsergyncscltgysgdhcekennmcmkgdvcknggmckvtpdsyeclcslgyappncakrvsigsevhfLGEGYVELKKELIEERRNeetiafdfvtddkNALLLwngqpsykngigREFIAVAVVNGYLeysydlgdgvvtikfskkpvndgikhsvNVTRINKFGSLEVDSvivgkgespgsqdvintrgniylggtpnmdlmtggryvhpmsglMMNIHIQNKhisnigssassglhvmpwirk
nayikwsradglplqryaEGNVLRITnarlqdsgkykceiqghdsfrgsDYVKLNVERMMFVDGIGPFSGESQGAFQGLDLSELVYIGAVPDFGEIHPSAGFSNGFKGCVSRLKYNKTEFELFKMAVERVGVDSCNTCKSSKHNNCINNGLCQDAATRIGYTCICPPGFSGDRCSVLGEPCYPGACGDGSCQDVDGAMKCLCPIGTAGKRCEQKIKILqpafkhgsylayptpkTMRKFKVSLRLNPRDVRDGIILysgqsddglGDFISLAIREKHMEFRFDTGSATPLYSNDAPAFNPVSTKEAPYGSKITLTCNNDLEAPVEYTWSKRSNGHVLPFGAFSRENTLTLQeiknsdagmYVCKVSNKDMTVEIPSILLVTDSVPLFTQKPLSYLALPTLTDAHLHFSIELSFKPTDYNGLIMYTGDSNMKSYKGKGDFVSFGLEDGYPVFRFDVGLVVLRSkvtlvphewVVVTIIKdfkegklsvggeplivgstpgekLQVLNLRTPLYLGGYNIYHVTPSLSVEVTEGFHGCISTIDVLGSELDLINSAVDSANIMDCSDLESSPVCAPKPCQNYGICYPTDTSERGYNCSCLTGYSGDHCEKENNMCMKGDVCKNGGMCKVTPDSYECLCSLGYAPPNCAKRVSIGSEVHFLGEGYVELKKELIEERRNEETIAFDFVTDDKNALLLWNGQPSYKNGIGREFIAVAVVNGYLEYSYDLGDGVVTIKFSkkpvndgikhsvnvtrinkfgsLEVDSVIVGkgespgsqdvintRGNIYLGGTPNMDLMTGGRYVHPMSGLMMNIHIQNKHISNigssassglhvmpwirk
NAYIKWSRADGLPLQRYAEGNVLRITNARLQDSGKYKCEIQGHDSFRGSDYVKLNVERMMFVDGIGPFSGESQGAFQGLDLSELVYIGAVPDFGEIHPSAGFSNGFKGCVSRLKYNKTEFELFKMAVERVGVDSCNTCKSSKHNNCINNGLCQDAATRIGYTCICPPGFSGDRCSVLGEPCYPGACGDGSCQDVDGAMKCLCPIGTAGKRCEQKIKILQPAFKHGSYLAYPTPKTMRKFKVSLRLNPRDVRDGIILYSGQSDDGLGDFISLAIREKHMEFRFDTGSATPLYSNDAPAFNPVSTKEAPYGSKITLTCNNDLEAPVEYTWSKRSNGHVLPFGAFSRENTLTLQEIKNSDAGMYVCKVSNKDMTVEIPSILLVTDSVPLFTQKPLSYLALPTLTDAHLHFSIELSFKPTDYNGLIMYTGDSNMKSYKGKGDFVSFGLEDGYPVFRFDVGLVVLRSKVTLVPHEWVVVTIIKDFKEGKLSVGGEPLIVGSTPGEKLQVLNLRTPLYLGGYNIYHVTPSLSVEVTEGFHGCISTIDVLGSELDLINSAVDSANIMDCSDLESSPVCAPKPCQNYGICYPTDTSERGYNCSCLTGYSGDHCEKENNMCMKGDVCKNGGMCKVTPDSYECLCSLGYAPPNCAKRVSIGSEVHFLGEGYVELKKELIEERRNEETIAFDFVTDDKNALLLWNGQPSYKNGIGREFIAVAVVNGYLEYSYDLGDGVVTIKFSKKPVNDGIKHSVNVTRINKFGSLEVDSVIVGKGESPGSQDVINTRGNIYLGGTPNMDLMTGGRYVHPMSGLMMNIHIQNKHISNIGSSASSGLHVMPWIRK
**YIKWSRADGLPLQRYAEGNVLRITNARLQDSGKYKCEIQGHDSFRGSDYVKLNVERMMFVDGIGPFSGESQGAFQGLDLSELVYIGAVPDFGEIHPSAGFSNGFKGCVSRLKYNKTEFELFKMAVERVGVDSCNTCKSSKHNNCINNGLCQDAATRIGYTCICPPGFSGDRCSVLGEPCYPGACGDGSCQDVDGAMKCLCPIGTAGKRCEQKIKILQPAFKHGSYLAYPTPKTMRKFKVSLRLNPRDVRDGIILYSGQSDDGLGDFISLAIREKHMEFRFDTGSATPLY**************APYGSKITLTCNNDLEAPVEYTWSKRSNGHVLPFGAFSRENTLTLQEIKNSDAGMYVCKVSNKDMTVEIPSILLVTDSVPLFTQKPLSYLALPTLTDAHLHFSIELSFKPTDYNGLIMYTGDSNMKSYKGKGDFVSFGLEDGYPVFRFDVGLVVLRSKVTLVPHEWVVVTIIKDFKEGKLSVGGEPLIVGSTPGEKLQVLNLRTPLYLGGYNIYHVTPSLSVEVTEGFHGCISTIDVLGSELDLINSAVDSANIMDCSDLESSPVCAPKPCQNYGICYPTDTSERGYNCSCLTGYSGDHCEKENNMCMKGDVCKNGGMCKVTPDSYECLCSLGYAPPNCAKRVSIGSEVHFLGEGYVELKKELIEERRNEETIAFDFVTDDKNALLLWNGQPSYKNGIGREFIAVAVVNGYLEYSYDLGDGVVTIKFSKKPVNDGIKHSVNVTRINKFGSLEVDSVIVGK*******DVINTRGNIYLGGTPNMDLMTGGRYVHPMSGLMMNIHIQ***********************
NAYIKWSRADGLPLQRYAEGNVLRITNARLQDSGKYKCEIQGHDSFRGSDYVKLNVERMMFVDGIGPFS*********LDLSELVYIGAVPDFGEIHPSAGFSNGFKGCVSRLKYNKTEFELFKMAVERVGVDSCNTCKSSKHNNCINNGLCQDAATRIGYTCICPPGFSGDRCSVLGEPCYPGACGDGSCQDVDGAMKCLCPIGTAGKRCEQKIKILQPAFKHGSYLAYPTPKTMRKFKVSLRLNPRDVRDGIILYSGQSDDGLGDFISLAIREKHMEFRFDTGSATPLYSNDAPAFNPVSTKEAPYGSKITLTCNNDLEAPVEYTWSKRSNGHVLPFGAFSRENTLTLQEIKNSDAGMYVCKVSNKDMTVEIPSILLVTDSVPLFTQKPLSYLALPTLTDAHLHFSIELSFKPTDYNGLIMYTGDSNMKSYKGKGDFVSFGLEDGYPVFRFDVGLVVLRSKVTLVPHEWVVVTIIKDFKEGKLSVGGEPLIVGSTPGEKLQVLNLRTPLYLGGYNIYHVTPSLSVEVTEGFHGCISTIDVLGSELDLINSAVDSANIMDCSDLESSPVCAPKPCQNYGICYPTDTSERGYNCSCLTGYSGDHCEKENNMCMKGDVCKNGGMCKVTPDSYECLCSLGYAPPNCAKRVSIGSEVHFLGEGYVELKKELIEERRNEETIAFDFVTDDKNALLLWNGQPSYKNGIGREFIAVAVVNGYLEYSYDLGDGVVTIKFSKKPVNDGIKHSVNVTRINKFGSLEVDSVIVG****P****VINTRGNIYLGGTPNMDLMTGGRYVHPMSGLMMNIHIQNKHISN************P****
NAYIKWSRADGLPLQRYAEGNVLRITNARLQDSGKYKCEIQGHDSFRGSDYVKLNVERMMFVDGIGPFSGESQGAFQGLDLSELVYIGAVPDFGEIHPSAGFSNGFKGCVSRLKYNKTEFELFKMAVERVGVDSCNTCKSSKHNNCINNGLCQDAATRIGYTCICPPGFSGDRCSVLGEPCYPGACGDGSCQDVDGAMKCLCPIGTAGKRCEQKIKILQPAFKHGSYLAYPTPKTMRKFKVSLRLNPRDVRDGIILYSGQSDDGLGDFISLAIREKHMEFRFDTGSATPLYSNDAPAFNPVSTKEAPYGSKITLTCNNDLEAPVEYTWSKRSNGHVLPFGAFSRENTLTLQEIKNSDAGMYVCKVSNKDMTVEIPSILLVTDSVPLFTQKPLSYLALPTLTDAHLHFSIELSFKPTDYNGLIMYTGDSNMKSYKGKGDFVSFGLEDGYPVFRFDVGLVVLRSKVTLVPHEWVVVTIIKDFKEGKLSVGGEPLIVGSTPGEKLQVLNLRTPLYLGGYNIYHVTPSLSVEVTEGFHGCISTIDVLGSELDLINSAVDSANIMDCSDLESSPVCAPKPCQNYGICYPTDTSERGYNCSCLTGYSGDHCEKENNMCMKGDVCKNGGMCKVTPDSYECLCSLGYAPPNCAKRVSIGSEVHFLGEGYVELKKELIEERRNEETIAFDFVTDDKNALLLWNGQPSYKNGIGREFIAVAVVNGYLEYSYDLGDGVVTIKFSKKPVNDGIKHSVNVTRINKFGSLEVDSVIVGKGESPGSQDVINTRGNIYLGGTPNMDLMTGGRYVHPMSGLMMNIHIQNKHISNIGSSASSGLHVMPWIRK
NAYIKWSRADGLPLQRYAEGNVLRITNARLQDSGKYKCEIQGHDSFRGSDYVKLNVERMMFVDGIGPFSGESQGAFQGLDLSELVYIGAVPDFGEIHPSAGFSNGFKGCVSRLKYNKTEFELFKMAVERVGVDSCNTCKSSKHNNCINNGLCQDAATRIGYTCICPPGFSGDRCSVLGEPCYPGACGDGSCQDVDGAMKCLCPIGTAGKRCEQKIKILQPAFKHGSYLAYPTPKTMRKFKVSLRLNPRDVRDGIILYSGQSDDGLGDFISLAIREKHMEFRFDTGSATPLYSNDAPAFNPVSTKEAPYGSKITLTCNNDLEAPVEYTWSKRSNGHVLPFGAFSRENTLTLQEIKNSDAGMYVCKVSNKDMTVEIPSILLVTDSVPLFTQKPLSYLALPTLTDAHLHFSIELSFKPTDYNGLIMYTGDSNMKSYKGKGDFVSFGLEDGYPVFRFDVGLVVLRSKVTLVPHEWVVVTIIKDFKEGKLSVGGEPLIVGSTPGEKLQVLNLRTPLYLGGYNIYHVTPSLSVEVTEGFHGCISTIDVLGSELDLINSAVDSANIMDCSDLESSPVCAPKPCQNYGICYPTDTSERGYNCSCLTGYSGDHCEKENNMCMKGDVCKNGGMCKVTPDSYECLCSLGYAPPNCAKRVSIGSEVHFLGEGYVELKKELIEERRNEETIAFDFVTDDKNALLLWNGQPSYKNGIGREFIAVAVVNGYLEYSYDLGDGVVTIKFSKKPVNDGIKHSVNVTRINKFGSLEVDSVIVGKGESPGSQDVINTRGNIYLGGTPNMDLMTGGRYVHPMSGLMMNIHIQNKHISNIGSSASSG*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAYIKWSRADGLPLQRYAEGNVLRITNARLQDSGKYKCEIQGHDSFRGSDYVKLNVERMMFVDGIGPFSGESQGAFQGLDLSELVYIGAVPDFGEIHPSAGFSNGFKGCVSRLKYNKTEFELFKMAVERVGVDSCNTCKSSKHNNCINNGLCQDAATRIGYTCICPPGFSGDRCSVLGEPCYPGACGDGSCQDVDGAMKCLCPIGTAGKRCEQKIKILQPAFKHGSYLAYPTPKTMRKFKVSLRLNPRDVRDGIILYSGQSDDGLGDFISLAIREKHMEFRFDTGSATPLYSNDAPAFNPVSTKEAPYGSKITLTCNNDLEAPVEYTWSKRSNGHVLPFGAFSRENTLTLQEIKNSDAGMYVCKVSNKDMTVEIPSILLVTDSVPLFTQKPLSYLALPTLTDAHLHFSIELSFKPTDYNGLIMYTGDSNMKSYKGKGDFVSFGLEDGYPVFRFDVGLVVLRSKVTLVPHEWVVVTIIKDFKEGKLSVGGEPLIVGSTPGEKLQVLNLRTPLYLGGYNIYHVTPSLSVEVTEGFHGCISTIDVLGSELDLINSAVDSANIMDCSDLESSPVCAPKPCQNYGICYPTDTSERGYNCSCLTGYSGDHCEKENNMCMKGDVCKNGGMCKVTPDSYECLCSLGYAPPNCAKRVSIGSEVHFLGEGYVELKKELIEERRNEETIAFDFVTDDKNALLLWNGQPSYKNGIGREFIAVAVVNGYLEYSYDLGDGVVTIKFSKKPVNDGIKHSVNVTRINKFGSLEVDSVIVGKGESPGSQDVINTRGNIYLGGTPNMDLMTGGRYVHPMSGLMMNIHIQNKHISNIGSSASSGLHVMPWIRK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query834 2.2.26 [Sep-21-2011]
Q057933707 Basement membrane-specifi no N/A 0.478 0.107 0.337 5e-56
P981604391 Basement membrane-specifi yes N/A 0.474 0.090 0.336 6e-56
A2ASQ1 1950 Agrin OS=Mus musculus GN= no N/A 0.473 0.202 0.321 7e-42
P25304 1959 Agrin OS=Rattus norvegicu yes N/A 0.494 0.210 0.310 1e-41
A3KN331018 Pikachurin OS=Bos taurus no N/A 0.673 0.552 0.238 1e-38
O00468 2067 Agrin OS=Homo sapiens GN= no N/A 0.466 0.188 0.297 5e-37
Q904041328 Agrin (Fragment) OS=Diplo N/A N/A 0.411 0.258 0.280 3e-33
Q63HQ21017 Pikachurin OS=Homo sapien no N/A 0.466 0.382 0.271 4e-31
P316962081 Agrin OS=Gallus gallus GN no N/A 0.443 0.177 0.275 4e-31
Q4VBE4 1017 Pikachurin OS=Mus musculu no N/A 0.462 0.379 0.257 1e-30
>sp|Q05793|PGBM_MOUSE Basement membrane-specific heparan sulfate proteoglycan core protein OS=Mus musculus GN=Hspg2 PE=1 SV=1 Back     alignment and function desciption
 Score =  220 bits (560), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 148/439 (33%), Positives = 219/439 (49%), Gaps = 40/439 (9%)

Query: 393  SYLALPTLTDAHLHFSIELSFKPTDYNGLIMYTGDSNMKSYKGKGDFVSFGLEDGYPVFR 452
            SYLALP LT+ H    +++ FKP + NG+++++G  +        DFVS  +  G+  FR
Sbjct: 3254 SYLALPALTNTHHELRLDVEFKPLEPNGILLFSGGKSGPVE----DFVSLAMVGGHLEFR 3309

Query: 453  FDVG--LVVLRSKVTLVPHEWVVVTIIKDFKEGKLSVGGEPLIVGSTPGEKLQVLNLRTP 510
            +++G  L VLRS   L    W  V+  +  K+G L V G   ++ S+PG K Q LNL T 
Sbjct: 3310 YELGSGLAVLRSHEPLALGRWHRVSAERLNKDGSLRVDGGRPVLRSSPG-KSQGLNLHTL 3368

Query: 511  LYLGGYNIYHVTPSLSVEVTEGFHGCISTIDVLGSELDLINSAVDSANIMDCSDLESSPV 570
            LYLGG     V  S +  ++  FHGC+  + V G  LDL  S + S  +  C D  SSP 
Sbjct: 3369 LYLGGVEP-SVQLSPATNMSAHFHGCVGEVSVNGKRLDLTYSFLGSQGVGQCYD--SSP- 3424

Query: 571  CAPKPCQNYGICYPTDTSERGYNCSCLTGYSGDHCEKENNMCMKGDVCKNGGMCKVTPDS 630
            C  +PC+N   C P    E  + C C  G+ GD CE E N C   + C NGG C+     
Sbjct: 3425 CERQPCRNGATCMPAGEYE--FQCLCQDGFKGDLCEHEENPCQLHEPCLNGGTCR----G 3478

Query: 631  YECLCSLGYAPPNCAKRVSIG---SEVH----------------FLGEGYVELKKELIEE 671
              CLC  G++ P C +    G   S+ H                F   G++ L       
Sbjct: 3479 ARCLCLPGFSGPRCQQGAGYGVVESDWHPEGSGGNDAPGQYGAYFYDNGFLGLPGNSFSR 3538

Query: 672  RRNE--ETIAFDFVTDDKNALLLWNGQPSYKNGIGREFIAVAVVNGYLEYSYDLGDGVVT 729
               E  ETI F+  T   + LLLW G    +    ++FI++ + +G+L +SY LG G   
Sbjct: 3539 SLPEVPETIEFEVRTSTADGLLLWQGV-VREASRSKDFISLGLQDGHLVFSYQLGSGEAR 3597

Query: 730  IKFSKKPVNDGIKHSVNVTRINKFGSLEVDSVIVGKGESPGSQDVINTRGNIYLGGTPNM 789
            +  S  P+NDG  H +   R  + GS++VD   +  G SPG    +NT+  IY+GG P++
Sbjct: 3598 L-VSGDPINDGEWHRITALREGQRGSIQVDGEDLVTGRSPGPNVAVNTKDIIYIGGAPDV 3656

Query: 790  DLMTGGRYVHPMSGLMMNI 808
              +T G++   ++G + N+
Sbjct: 3657 ATLTRGKFSSGITGCIKNL 3675




The LG3 peptide has anti-angiogenic properties that require binding of calcium ions for full activity.
Mus musculus (taxid: 10090)
>sp|P98160|PGBM_HUMAN Basement membrane-specific heparan sulfate proteoglycan core protein OS=Homo sapiens GN=HSPG2 PE=1 SV=4 Back     alignment and function description
>sp|A2ASQ1|AGRIN_MOUSE Agrin OS=Mus musculus GN=Agrn PE=1 SV=1 Back     alignment and function description
>sp|P25304|AGRIN_RAT Agrin OS=Rattus norvegicus GN=Agrn PE=1 SV=2 Back     alignment and function description
>sp|A3KN33|EGFLA_BOVIN Pikachurin OS=Bos taurus GN=EGFLAM PE=2 SV=1 Back     alignment and function description
>sp|O00468|AGRIN_HUMAN Agrin OS=Homo sapiens GN=AGRN PE=1 SV=5 Back     alignment and function description
>sp|Q90404|AGRIN_DIPOM Agrin (Fragment) OS=Diplobatis ommata GN=AGRN PE=2 SV=1 Back     alignment and function description
>sp|Q63HQ2|EGFLA_HUMAN Pikachurin OS=Homo sapiens GN=EGFLAM PE=1 SV=2 Back     alignment and function description
>sp|P31696|AGRIN_CHICK Agrin OS=Gallus gallus GN=AGRN PE=1 SV=3 Back     alignment and function description
>sp|Q4VBE4|EGFLA_MOUSE Pikachurin OS=Mus musculus GN=Egflam PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query834
189237255 4254 PREDICTED: similar to AGAP003656-PA [Tri 0.517 0.101 0.394 3e-86
270008326 3943 hypothetical protein TcasGA2_TC030735 [T 0.515 0.109 0.391 2e-84
321479130819 hypothetical protein DAPPUDRAFT_186952 [ 0.509 0.518 0.370 1e-74
307203130 3454 Basement membrane-specific heparan sulfa 0.504 0.121 0.361 3e-71
307169661 3395 Basement membrane-specific heparan sulfa 0.515 0.126 0.347 1e-69
380020744489 PREDICTED: pikachurin-like [Apis florea] 0.474 0.809 0.370 2e-68
332025352 3377 Basement membrane-specific heparan sulfa 0.503 0.124 0.340 4e-68
328783871492 PREDICTED: pikachurin-like [Apis mellife 0.474 0.804 0.363 3e-67
350402224519 PREDICTED: pikachurin-like isoform 1 [Bo 0.495 0.795 0.344 1e-65
340729482454 PREDICTED: pikachurin-like [Bombus terre 0.491 0.903 0.344 1e-65
>gi|189237255|ref|XP_972068.2| PREDICTED: similar to AGAP003656-PA [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  326 bits (836), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 186/472 (39%), Positives = 275/472 (58%), Gaps = 40/472 (8%)

Query: 393  SYLALPTLTDAHLHFSIELSFKPTD-YNGLIMYTGDSNMKSYKGKGDFVSFGLEDGYPVF 451
            +Y+A P +      F   L  KPTD  +G+++Y  +++    +G GDFVS  ++D +  F
Sbjct: 3792 AYIAYP-VPKLQRRFKAALKIKPTDNRDGILLYCAETD----EGHGDFVSLAIKDRHIEF 3846

Query: 452  RFDVG--LVVLRSKVTLVPHEWVVVTIIKDFKEGKLSVGGEPLIVGSTPGEKLQVLNLRT 509
             F+VG   V +RS+  + P EW V+T  +   EG+L V GE    G+TPG   + LNL T
Sbjct: 3847 NFNVGGRPVTIRSEKEVRPGEWHVLTATRSLSEGRLIVDGE-TTFGTTPGNH-KTLNLLT 3904

Query: 510  PLYLGGYNIYHVTPSLSVEVTEGFHGCISTIDVLGSELDLINSAVDSANIMDCSDL---- 565
             LY+GGY+  ++  +  V V  GF+GCIS I + G +LD+INSA DSAN+M+CS L    
Sbjct: 3905 RLYVGGYDSENIKINDKVGVHSGFNGCISEIKMSGLDLDVINSAEDSANVMECSSLDNEV 3964

Query: 566  -----------ESSPV-----------CAPKPCQNYGICYPTDTSERGYNCSCLTGYSGD 603
                       E++P            C+  PC+N G CYP   S   YNC+CL+G+SG 
Sbjct: 3965 DNNVGGFEYVHENTPTTSQPYNSRRTGCSSNPCKNGGQCYPL--SPMDYNCNCLSGFSGK 4022

Query: 604  HCEKENNMCMKGDVCKNGGMCKVTPDSYECLCSLGYAPPNCAKRVSIGSEVHFLGEGYVE 663
             CE E N+C +   C+NGG C      YEC C L ++  NC  RV + ++ HF G+GY+E
Sbjct: 4023 DCEIEMNICEQKIPCQNGGTCSGNATGYECSCPLLFSGKNCELRVELRNDAHFNGKGYLE 4082

Query: 664  LKKELIEE-RRNE-ETIAFDFVTDDKNALLLWNGQPSYKNGIGREFIAVAVVNGYLEYSY 721
              ++L++  + NE E IA +  T+  + L+ W+GQ   ++G G+ +I++ VVNGYLE+SY
Sbjct: 4083 FDRDLLDHIKENEDELIAVELSTNSSDGLVFWHGQTPNEDGQGKNYISLGVVNGYLEFSY 4142

Query: 722  DLGDGVVTIKFSKKPVNDGIKHSVNVTRINKFGSLEVDSVIVGKGESPGSQDVINTRGNI 781
            DLG G   I+ ++K V+DG +HS  + R  + GS+E+D+     GESPG  + ++  GNI
Sbjct: 4143 DLGSGPAIIRNTQKRVDDGQRHSAILKRRGRVGSIEIDNAYTQTGESPGFTNTLSCAGNI 4202

Query: 782  YLGGTPNMDLMTGGRYVHPMSGLMMNIHIQNKHISNIGSSASSGLHVMPWIR 833
            YLGG PN+ LMTG R+ H   G +    +QN    ++G  A SG++V P  R
Sbjct: 4203 YLGGAPNIGLMTGRRFSHGFDGCVHAFELQNLKTLDLGIRAISGVNVKPCSR 4254




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270008326|gb|EFA04774.1| hypothetical protein TcasGA2_TC030735 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|321479130|gb|EFX90086.1| hypothetical protein DAPPUDRAFT_186952 [Daphnia pulex] Back     alignment and taxonomy information
>gi|307203130|gb|EFN82310.1| Basement membrane-specific heparan sulfate proteoglycan core protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307169661|gb|EFN62243.1| Basement membrane-specific heparan sulfate proteoglycan core protein [Camponotus floridanus] Back     alignment and taxonomy information
>gi|380020744|ref|XP_003694239.1| PREDICTED: pikachurin-like [Apis florea] Back     alignment and taxonomy information
>gi|332025352|gb|EGI65519.1| Basement membrane-specific heparan sulfate proteoglycan core protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|328783871|ref|XP_003250356.1| PREDICTED: pikachurin-like [Apis mellifera] Back     alignment and taxonomy information
>gi|350402224|ref|XP_003486411.1| PREDICTED: pikachurin-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340729482|ref|XP_003403030.1| PREDICTED: pikachurin-like [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query834
FB|FBgn0261451 4629 trol "terribly reduced optic l 0.406 0.073 0.322 3.1e-49
ZFIN|ZDB-GENE-080807-43422 hspg2 "heparan sulfate proteog 0.5 0.121 0.351 3.8e-75
UNIPROTKB|F1MER74374 HSPG2 "Uncharacterized protein 0.483 0.092 0.348 1.5e-64
UNIPROTKB|P98160 4391 HSPG2 "Basement membrane-speci 0.586 0.111 0.301 2e-58
MGI|MGI:96257 3707 Hspg2 "perlecan (heparan sulfa 0.585 0.131 0.305 4.3e-56
UNIPROTKB|E1BQW41022 EGFLAM "Uncharacterized protei 0.252 0.206 0.302 7.6e-51
ZFIN|ZDB-GENE-030131-1033 2028 agrn "agrin" [Danio rerio (tax 0.459 0.188 0.278 2.5e-39
UNIPROTKB|F1LQ53 963 Agrn "Agrin" [Rattus norvegicu 0.494 0.427 0.315 4.7e-41
UNIPROTKB|F1NAT61213 HSPG2 "Uncharacterized protein 0.501 0.344 0.311 3.4e-48
UNIPROTKB|F1MSI2 2032 AGRN "Uncharacterized protein" 0.461 0.189 0.319 1.6e-39
FB|FBgn0261451 trol "terribly reduced optic lobes" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 492 (178.3 bits), Expect = 3.1e-49, Sum P(4) = 3.1e-49
 Identities = 116/360 (32%), Positives = 184/360 (51%)

Query:   306 APYGSKITLTCNNDLEAPVEYTWSKRSNGHVLPFGAFSRENTLTLQEIKNSDAGMYVCKV 365
             A  G+   L C  D      Y WS R  G  L  G       L+L  ++ +DAG Y+C  
Sbjct:  3848 AKVGANADLQCGADESRQPTYRWS-RQYGQ-LQAGRSLMNEKLSLDSVQANDAGTYICTA 3905

Query:   366 SNKD-MTVEIPSILLVTDSVPLFTQKPLSYLALPTLTDAHLHFSIELSFKPTDYNGLIMY 424
                D  T + P+IL+VT ++P F Q+P SY++ PTL ++   F+ EL+F+P + +GL+++
Sbjct:  3906 QYADGETADFPNILVVTGAIPQFRQEPRSYMSFPTLPNSSFKFNFELTFRPENGDGLLLF 3965

Query:   425 TGDSNMKSYKGKGDFVSFGLEDGYPVFRFDVG--LVVLRSKVTLVPHEWVVVTIIKDFKE 482
              G +     +G GD+++  L+D Y  FRFD G   +++R++  L  +EW  V + +  ++
Sbjct:  3966 NGQT-----RGSGDYIALSLKDRYAEFRFDFGGKPMLVRAEEPLALNEWHTVRVSRFKRD 4020

Query:   483 GKLSVGGEPLIVGSTPGEKLQVLNLRTPLYLGGYNIYHVTPSLSVEVTEGFHGCISTIDV 542
             G + V  +  +   T  +++  L+L   LY+GG   + + P+ +V    GF GCIS + +
Sbjct:  4021 GYIQVDEQHPVAFPTL-QQIPQLDLIEDLYIGGVPNWELLPADAVSQQVGFVGCISRLTL 4079

Query:   543 LGSELDLINSAVDSANIMDCSDLESSPVCAPKPCQNYGICYPTDTSERGYNCSCLTGYSG 602
              G  ++LI  A     I DC      P CA  PCQN G+C  + T E+ Y C C  G++G
Sbjct:  4080 QGRTVELIREAKYKEGITDCR-----P-CAQGPCQNKGVCLESQT-EQAYTCICQPGWTG 4132

Query:   603 DHCEKENNMCMKGDVCKNGGMCKVTPDSYECLCSLGYAPPNCAKRVSIGSE-VHFLGEGY 661
               C  E   C  G VC   G C+ T +  ECLC L  +   C     +    ++F G  +
Sbjct:  4133 RDCAIEGTQCTPG-VC-GAGRCENTENDMECLCPLNRSGDRCQYNEILNEHSLNFKGNSF 4190


GO:0005578 "proteinaceous extracellular matrix" evidence=NAS
GO:0005604 "basement membrane" evidence=ISS
GO:0055059 "asymmetric neuroblast division" evidence=NAS
GO:0045199 "maintenance of epithelial cell apical/basal polarity" evidence=IMP
GO:0005811 "lipid particle" evidence=IDA
GO:0072347 "response to anesthetic" evidence=IMP
ZFIN|ZDB-GENE-080807-4 hspg2 "heparan sulfate proteoglycan 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MER7 HSPG2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P98160 HSPG2 "Basement membrane-specific heparan sulfate proteoglycan core protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:96257 Hspg2 "perlecan (heparan sulfate proteoglycan 2)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BQW4 EGFLAM "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-1033 agrn "agrin" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1LQ53 Agrn "Agrin" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NAT6 HSPG2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MSI2 AGRN "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query834
cd00110151 cd00110, LamG, Laminin G domain; Laminin G-like do 6e-28
cd00110151 cd00110, LamG, Laminin G domain; Laminin G-like do 4e-27
smart00282132 smart00282, LamG, Laminin G domain 2e-26
smart00282132 smart00282, LamG, Laminin G domain 2e-25
pfam02210124 pfam02210, Laminin_G_2, Laminin G domain 1e-23
pfam02210124 pfam02210, Laminin_G_2, Laminin G domain 3e-21
pfam00054131 pfam00054, Laminin_G_1, Laminin G domain 7e-21
pfam00054131 pfam00054, Laminin_G_1, Laminin G domain 2e-18
cd00110151 cd00110, LamG, Laminin G domain; Laminin G-like do 3e-08
smart00282132 smart00282, LamG, Laminin G domain 9e-08
smart0040863 smart00408, IGc2, Immunoglobulin C-2 Type 6e-07
cd00110151 cd00110, LamG, Laminin G domain; Laminin G-like do 2e-06
smart0041085 smart00410, IG_like, Immunoglobulin like 2e-06
smart0040985 smart00409, IG, Immunoglobulin 2e-06
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 4e-06
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 7e-06
pfam0000832 pfam00008, EGF, EGF-like domain 7e-06
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 3e-05
smart00282132 smart00282, LamG, Laminin G domain 4e-05
cd0575485 cd05754, Ig3_Perlecan_like, Third immunoglobulin ( 4e-05
pfam02210124 pfam02210, Laminin_G_2, Laminin G domain 5e-05
cd0005336 cd00053, EGF, Epidermal growth factor domain, foun 5e-05
cd0009674 cd00096, Ig, Immunoglobulin domain 6e-05
cd0573296 cd05732, Ig5_NCAM-1_like, Fifth immunoglobulin (Ig 7e-05
cd0496888 cd04968, Ig3_Contactin_like, Third Ig domain of co 2e-04
cd0005336 cd00053, EGF, Epidermal growth factor domain, foun 4e-04
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 4e-04
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 4e-04
pfam13385156 pfam13385, Laminin_G_3, Concanavalin A-like lectin 4e-04
cd0005336 cd00053, EGF, Epidermal growth factor domain, foun 6e-04
pfam1389580 pfam13895, Ig_2, Immunoglobulin domain 8e-04
cd0585682 cd05856, Ig2_FGFRL1-like, Second immunoglobulin (I 8e-04
cd05714106 cd05714, Ig_CSPGs_LP, Immunoglobulin (Ig)-like dom 9e-04
pfam1392774 pfam13927, Ig_3, Immunoglobulin domain 0.001
smart0040863 smart00408, IGc2, Immunoglobulin C-2 Type 0.002
cd05713100 cd05713, Ig_MOG_like, Immunoglobulin (Ig)-like dom 0.002
pfam0004762 pfam00047, ig, Immunoglobulin domain 0.002
cd0586997 cd05869, Ig5_NCAM-1, Fifth immunoglobulin (Ig)-lik 0.003
>gnl|CDD|238058 cd00110, LamG, Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans Back     alignment and domain information
 Score =  109 bits (275), Expect = 6e-28
 Identities = 53/157 (33%), Positives = 76/157 (48%), Gaps = 8/157 (5%)

Query: 654 VHFLGEGYVELKKELIEERRNEETIAFDFVTDDKNALLLWNGQPSYKNGIGREFIAVAVV 713
           V F G  YV L        R   +I+F F T   N LLL+ G     +  G +F+A+ + 
Sbjct: 2   VSFSGSSYVRLPTL--PAPRTRLSISFSFRTTSPNGLLLYAG-----SQNGGDFLALELE 54

Query: 714 NGYLEYSYDLGDGVVTIKFSKKPVNDGIKHSVNVTRINKFGSLEVDSVIVGKGESPGSQD 773
           +G L   YDLG G + +  SK P+NDG  HSV+V R  +  +L VD   V +  SPG   
Sbjct: 55  DGRLVLRYDLGSGSLVLS-SKTPLNDGQWHSVSVERNGRSVTLSVDGERVVESGSPGGSA 113

Query: 774 VINTRGNIYLGGTPNMDLMTGGRYVHPMSGLMMNIHI 810
           ++N  G +YLGG P      G        G + ++ +
Sbjct: 114 LLNLDGPLYLGGLPEDLKSPGLPVSPGFVGCIRDLKV 150


Proteins that contain LamG domains serve a variety of purposes including signal transduction via cell-surface steroid receptors, adhesion, migration and differentiation through mediation of cell adhesion molecules. Length = 151

>gnl|CDD|238058 cd00110, LamG, Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans Back     alignment and domain information
>gnl|CDD|214598 smart00282, LamG, Laminin G domain Back     alignment and domain information
>gnl|CDD|214598 smart00282, LamG, Laminin G domain Back     alignment and domain information
>gnl|CDD|216930 pfam02210, Laminin_G_2, Laminin G domain Back     alignment and domain information
>gnl|CDD|216930 pfam02210, Laminin_G_2, Laminin G domain Back     alignment and domain information
>gnl|CDD|215681 pfam00054, Laminin_G_1, Laminin G domain Back     alignment and domain information
>gnl|CDD|215681 pfam00054, Laminin_G_1, Laminin G domain Back     alignment and domain information
>gnl|CDD|238058 cd00110, LamG, Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans Back     alignment and domain information
>gnl|CDD|214598 smart00282, LamG, Laminin G domain Back     alignment and domain information
>gnl|CDD|197706 smart00408, IGc2, Immunoglobulin C-2 Type Back     alignment and domain information
>gnl|CDD|238058 cd00110, LamG, Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans Back     alignment and domain information
>gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like Back     alignment and domain information
>gnl|CDD|214652 smart00409, IG, Immunoglobulin Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|215652 pfam00008, EGF, EGF-like domain Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|214598 smart00282, LamG, Laminin G domain Back     alignment and domain information
>gnl|CDD|143231 cd05754, Ig3_Perlecan_like, Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins Back     alignment and domain information
>gnl|CDD|216930 pfam02210, Laminin_G_2, Laminin G domain Back     alignment and domain information
>gnl|CDD|238010 cd00053, EGF, Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|143209 cd05732, Ig5_NCAM-1_like, Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins Back     alignment and domain information
>gnl|CDD|143169 cd04968, Ig3_Contactin_like, Third Ig domain of contactin Back     alignment and domain information
>gnl|CDD|238010 cd00053, EGF, Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|222092 pfam13385, Laminin_G_3, Concanavalin A-like lectin/glucanases superfamily Back     alignment and domain information
>gnl|CDD|238010 cd00053, EGF, Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>gnl|CDD|206066 pfam13895, Ig_2, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|143264 cd05856, Ig2_FGFRL1-like, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) Back     alignment and domain information
>gnl|CDD|143191 cd05714, Ig_CSPGs_LP, Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins Back     alignment and domain information
>gnl|CDD|222457 pfam13927, Ig_3, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|197706 smart00408, IGc2, Immunoglobulin C-2 Type Back     alignment and domain information
>gnl|CDD|143190 cd05713, Ig_MOG_like, Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) Back     alignment and domain information
>gnl|CDD|215677 pfam00047, ig, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|143277 cd05869, Ig5_NCAM-1, Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 834
KOG3514|consensus 1591 100.0
KOG4289|consensus 2531 100.0
KOG3516|consensus 1306 100.0
KOG3516|consensus 1306 100.0
KOG3514|consensus 1591 100.0
KOG1219|consensus 4289 100.0
KOG4289|consensus 2531 99.97
PF00054131 Laminin_G_1: Laminin G domain; InterPro: IPR012679 99.92
smart00282135 LamG Laminin G domain. 99.9
cd00110151 LamG Laminin G domain; Laminin G-like domains are 99.9
PF00054131 Laminin_G_1: Laminin G domain; InterPro: IPR012679 99.86
PF02210128 Laminin_G_2: Laminin G domain; InterPro: IPR012680 99.85
KOG1219|consensus 4289 99.84
smart00282135 LamG Laminin G domain. 99.78
cd00110151 LamG Laminin G domain; Laminin G-like domains are 99.76
PF02210128 Laminin_G_2: Laminin G domain; InterPro: IPR012680 99.68
KOG3509|consensus 964 99.33
smart00210184 TSPN Thrombospondin N-terminal -like domains. Hepa 99.03
PF13385157 Laminin_G_3: Concanavalin A-like lectin/glucanases 98.7
KOG1214|consensus1289 98.6
KOG1217|consensus487 98.56
PF0000832 EGF: EGF-like domain This is a sub-family of the P 98.52
smart00159206 PTX Pentraxin / C-reactive protein / pentaxin fami 98.48
KOG1214|consensus1289 98.47
PF0000832 EGF: EGF-like domain This is a sub-family of the P 98.47
cd00152201 PTX Pentraxins are plasma proteins characterized b 98.4
KOG3509|consensus964 98.32
smart00210184 TSPN Thrombospondin N-terminal -like domains. Hepa 98.32
PF00354195 Pentaxin: Pentaxin family; InterPro: IPR001759 Pen 98.26
KOG1225|consensus525 98.04
cd0572569 Ig3_Robo Third immunoglobulin (Ig)-like domain in 98.04
KOG1225|consensus525 98.03
cd0585273 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig 97.96
cd0587671 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o 97.94
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.91
KOG1217|consensus487 97.9
KOG0994|consensus 1758 97.89
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.88
cd0574574 Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom 97.87
cd0586367 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain 97.85
PF13385157 Laminin_G_3: Concanavalin A-like lectin/glucanases 97.82
cd0585188 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig 97.8
cd0586470 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain 97.79
cd0770272 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain 97.79
cd0574669 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do 97.78
cd0497671 Ig2_VEGFR Second immunoglobulin (Ig)-like domain o 97.75
cd0573171 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom 97.75
cd0572371 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai 97.74
cd0576375 Ig_1 Subgroup of the immunoglobulin (Ig) superfami 97.73
PF02973190 Sialidase: Sialidase, N-terminal domain; InterPro: 97.7
cd0576077 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of 97.7
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 97.7
cd0496973 Ig5_Contactin_like Fifth Ig domain of contactin. I 97.69
cd0585579 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of T 97.67
cd0589375 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like 97.65
cd0586776 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do 97.64
cd0497181 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of 97.63
cd0573874 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l 97.63
cd0574874 Ig_Titin_like Immunoglobulin (Ig)-like domain of t 97.6
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 97.6
cd0497379 Ig1_FGFR First immunoglobulin (Ig)-like domain of 97.6
cd0496888 Ig3_Contactin_like Third Ig domain of contactin. I 97.6
cd0574378 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai 97.59
cd0589275 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like 97.59
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 97.57
cd0587387 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of 97.56
cd00152201 PTX Pentraxins are plasma proteins characterized b 97.55
cd0576474 Ig_2 Subgroup of the immunoglobulin (Ig) superfami 97.53
cd0574091 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai 97.52
smart00159206 PTX Pentraxin / C-reactive protein / pentaxin fami 97.51
cd0586876 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o 97.51
cd0575485 Ig3_Perlecan_like Third immunoglobulin (Ig)-like d 97.51
cd0575075 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain 97.5
cd0575792 Ig2_IL1R_like Second immunoglobulin (Ig)-like doma 97.48
cd0576298 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of 97.47
cd0585385 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig 97.47
cd0573479 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain 97.43
cd0575694 Ig1_IL1R_like First immunoglobulin (Ig)-like domai 97.42
cd04975101 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma 97.41
cd0497876 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like 97.38
cd0574475 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain 97.36
cd0586692 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o 97.36
cd0572885 Ig4_Contactin-2-like Fourth Ig domain of the neura 97.36
smart0018135 EGF Epidermal growth factor-like domain. 97.35
smart00560133 LamGL LamG-like jellyroll fold domain. 97.34
cd0572690 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in 97.34
KOG3513|consensus1051 97.34
cd0573377 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom 97.33
cd0573969 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li 97.32
cd05859101 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do 97.29
cd0005336 EGF Epidermal growth factor domain, found in epide 97.27
cd0572486 Ig2_Robo Second immunoglobulin (Ig)-like domain in 97.26
cd0589576 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai 97.26
smart0018135 EGF Epidermal growth factor-like domain. 97.24
cd0585682 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do 97.24
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 97.23
cd0584993 Ig1_Contactin-1 First Ig domain of contactin-1. Ig 97.22
cd0586596 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o 97.22
cd0497792 Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom 97.2
cd0573792 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- 97.2
cd0497085 Ig6_Contactin_like Sixth Ig domain of contactin. I 97.19
cd0589486 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card 97.19
cd0573095 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom 97.19
cd0585485 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig 97.18
cd0584894 Ig1_Contactin-5 First Ig domain of contactin-5. Ig 97.15
cd0585785 Ig2_FGFR Second immunoglobulin (Ig)-like domain of 97.14
KOG4260|consensus350 97.14
cd0589795 Ig2_IL1R2_like Second immunoglobulin (Ig)-like dom 97.14
cd0585094 Ig1_Contactin-2 First Ig domain of contactin-2. Ig 97.13
cd0573676 Ig2_Follistatin_like Second immunoglobulin (Ig)-li 97.11
cd0005336 EGF Epidermal growth factor domain, found in epide 97.1
PF0004764 ig: Immunoglobulin domain The Prosite family only 97.08
cd0574792 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like 97.08
cd0587577 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-li 97.07
cd0497490 Ig3_FGFR Third immunoglobulin (Ig)-like domain of 97.03
cd0573588 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down 97.02
smart0040863 IGc2 Immunoglobulin C-2 Type. 97.0
cd0496791 Ig1_Contactin First Ig domain of contactin. Ig1_Co 96.96
cd0497290 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o 96.95
KOG1226|consensus783 96.93
cd0586997 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o 96.91
cd0572796 Ig2_Contactin-2-like Second Ig domain of the neura 96.9
cd0497989 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of 96.86
cd0587477 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of 96.84
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 96.83
cd0573296 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom 96.82
PF0767990 I-set: Immunoglobulin I-set domain; InterPro: IPR0 96.81
cd0574981 Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom 96.81
cd0587098 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o 96.75
cd0574284 Ig1_VEGFR_like First immunoglobulin (Ig)-like doma 96.73
cd0584595 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do 96.67
PF00354195 Pentaxin: Pentaxin family; InterPro: IPR001759 Pen 96.66
KOG4260|consensus350 96.65
cd0585890 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o 96.64
KOG4194|consensus873 96.63
cd0589192 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like 96.62
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 96.62
cd0586184 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like 96.6
cd0572295 Ig1_Neogenin First immunoglobulin (Ig)-like domain 96.59
PHA02826227 IL-1 receptor-like protein; Provisional 96.58
cd0576581 Ig_3 Subgroup of the immunoglobulin (Ig) superfami 96.57
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 96.55
cd0587191 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do 96.51
cd05773109 Ig8_hNephrin_like Eighth immunoglobulin-like domai 96.5
cd05896104 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like 96.49
cd0588295 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- 96.47
PHA03099139 epidermal growth factor-like protein (EGF-like pro 96.39
cd0575383 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like 96.38
cd0587285 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of 96.34
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 96.34
cd0575278 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do 96.33
PF1266224 cEGF: Complement Clr-like EGF-like 96.32
KOG1834|consensus 952 96.2
KOG3513|consensus1051 96.15
cd0575898 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do 95.93
PHA02887126 EGF-like protein; Provisional 95.87
cd0586286 Ig1_VEGFR First immunoglobulin (Ig)-like domain of 95.75
cd0770195 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- 95.66
cd0572985 Ig2_FGFR_like Second immunoglobulin (Ig)-like doma 95.63
cd0769094 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I 95.51
PF02973190 Sialidase: Sialidase, N-terminal domain; InterPro: 95.43
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 95.41
cd07693100 Ig1_Robo First immunoglobulin (Ig)-like domain in 95.39
cd05900112 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the 95.3
PHA02826227 IL-1 receptor-like protein; Provisional 95.3
cd0588580 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain 95.24
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 95.23
smart00560133 LamGL LamG-like jellyroll fold domain. 95.0
cd05774105 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain 94.87
PHA02887126 EGF-like protein; Provisional 94.62
PHA02785326 IL-beta-binding protein; Provisional 94.46
cd05901117 Ig_Versican Immunoglobulin (Ig)-like domain of the 94.43
cd0575191 Ig1_LILRB1_like First immunoglobulin (Ig)-like dom 94.35
PHA03099139 epidermal growth factor-like protein (EGF-like pro 94.21
PHA02785326 IL-beta-binding protein; Provisional 94.19
smart0041086 IG_like Immunoglobulin like. IG domains that canno 93.61
smart0040986 IG Immunoglobulin. 93.61
PF1392775 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1V 93.6
KOG4222|consensus 1281 93.56
smart0005163 DSL delta serrate ligand. 93.49
PHA0263363 hypothetical protein; Provisional 93.48
cd05879116 Ig_P0 Immunoglobulin (Ig)-like domain of Protein z 93.33
PF06439185 DUF1080: Domain of Unknown Function (DUF1080); Int 93.06
KOG1836|consensus1705 93.0
PF07354271 Sp38: Zona-pellucida-binding protein (Sp38); Inter 92.7
PF1389580 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V 92.62
cd0589898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain 92.6
KOG1836|consensus 1705 92.49
cd0588699 Ig1_Nectin-1_like First immunoglobulin (Ig) domain 92.45
cd05888100 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain 92.19
cd05714106 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of cho 92.05
cd0574192 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like d 92.02
PF1266224 cEGF: Complement Clr-like EGF-like 91.78
cd0575982 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like d 91.78
KOG0994|consensus1758 91.78
cd05713100 Ig_MOG_like Immunoglobulin (Ig)-like domain of mye 91.6
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 91.36
cd0009674 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) 91.36
smart0005163 DSL delta serrate ligand. 91.28
KOG4221|consensus 1381 91.2
cd0588796 Ig1_Nectin-3_like First immunoglobulin (Ig) domain 91.15
KOG4194|consensus873 91.1
KOG1226|consensus783 91.09
cd05880115 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithel 91.08
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 90.9
cd0571795 Ig1_Necl-1-3_like First (N-terminal) immunoglobuli 90.81
cd0588195 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- 90.75
cd0577597 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig) 90.34
cd0588996 Ig1_DNAM-1_like First immunoglobulin (Ig) domain o 90.22
cd05877106 Ig_LP_like Immunoglobulin (Ig)-like domain of huma 89.94
cd0571898 Ig1_PVR_like First immunoglobulin (Ig) domain of p 89.89
cd05715116 Ig_P0-like Immunoglobulin (Ig)-like domain of Prot 89.78
cd05878110 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain o 89.78
KOG4222|consensus 1281 89.58
cd00099105 IgV Immunoglobulin variable domain (IgV). IgV: Imm 89.2
cd05902110 Ig_Neurocan Immunoglobulin (Ig)-like domain of the 88.74
cd0005550 EGF_Lam Laminin-type epidermal growth factor-like 88.41
cd0571194 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of 88.32
cd0584697 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain 87.77
cd04983109 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V 87.64
smart0040681 IGv Immunoglobulin V-Type. 87.48
PF0005349 Laminin_EGF: Laminin EGF-like (Domains III and V); 87.32
cd05771139 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain 87.21
cd0498498 IgV_L_lambda Immunoglobulin (Ig) lambda light chai 86.19
KOG3546|consensus 1167 85.81
KOG4221|consensus 1381 85.63
cd05899110 IgV_TCR_beta Immunoglobulin (Ig) variable (V) doma 85.57
cd0769265 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of 85.44
PF0141463 DSL: Delta serrate ligand; InterPro: IPR001774 Lig 85.13
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 85.02
smart0018046 EGF_Lam Laminin-type epidermal growth factor-like 84.78
cd04980106 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa 84.74
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 84.41
PF06439185 DUF1080: Domain of Unknown Function (DUF1080); Int 84.0
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 83.85
PF0141463 DSL: Delta serrate ligand; InterPro: IPR001774 Lig 83.57
PF07686114 V-set: Immunoglobulin V-set domain; InterPro: IPR0 83.48
cd05712119 Ig_Siglec_N Immunoglobulin (Ig) domain at the N te 83.27
cd0571698 Ig_pIgR Immunoglobulin (Ig)-like domain in the pol 82.38
cd0009895 IgC Immunoglobulin Constant domain. IgC: Immunoglo 81.73
cd05720104 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD 81.68
cd04982116 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) dom 80.16
>KOG3514|consensus Back     alignment and domain information
Probab=100.00  E-value=1.2e-63  Score=542.82  Aligned_cols=689  Identities=23%  Similarity=0.408  Sum_probs=517.6

Q ss_pred             CceeEEEcCCcceeeeeCCcccCCCcceeeeeCCCCCCCcCC----CCccCCCCccceEEEEEEcCEEEEeecccccccC
Q psy9228          56 VERMMFVDGIGPFSGESQGAFQGLDLSELVYIGAVPDFGEIH----PSAGFSNGFKGCVSRLKYNKTEFELFKMAVERVG  131 (834)
Q Consensus        56 ~~g~~cvd~~~~~~~~~~~~~~g~~~~~~~~~gg~p~~~~~~----~~~~~~~gf~gCi~~~~~~~~~~~~~~~~~~~~~  131 (834)
                      +|-.|-||++..+.-.-...|.-.+.-.++||||+|....++    +.....+.|.|-+..|.+...+-.+...+....+
T Consensus       117 e~t~L~vDgv~~~~~~~~~~f~fg~iasdvfVGGlP~~~~la~l~lp~v~yep~frg~~rnl~y~~~p~g~t~~q~l~~~  196 (1591)
T KOG3514|consen  117 ENTKLEVDGVLVFKILNQRSFVFGNIASDVFVGGLPNMHMLAVLSLPLVRYEPRFRGNVRNLMYRQYPQGVTSPQLLEVG  196 (1591)
T ss_pred             ccceEEechhhhhhhhhcceeeeeeeehheeecCCChHHhhhhhcCcccccccccCccceeeeeecCCCCcCChhhhhcc
Confidence            577899999877766666667666666799999999655433    2356677888999988887766554443222222


Q ss_pred             CCCCCccCCCCCCCCCCCCEeccCCCCCceEeeCCCCCCCCCCCCCCCCccC-CCCCC-CeeecCCCCeEEeCCCCcccC
Q psy9228         132 VDSCNTCKSSKHNNCINNGLCQDAATRIGYTCICPPGFSGDRCSVLGEPCYP-GACGD-GSCQDVDGAMKCLCPIGTAGK  209 (834)
Q Consensus       132 ~~~c~~C~~~~~~pC~n~g~C~~~~~~~~~~C~C~~g~~G~~Ce~~~~~C~~-~~C~~-g~C~~~~~~~~C~C~~g~~G~  209 (834)
                      ..  ..|.   +.+|...                             ..|.. .+|++ |.|.....+.+|.|..-+.|.
T Consensus       197 ~d--~~c~---d~~~~~~-----------------------------~~~~~~~~c~~~g~c~s~d~gp~c~c~~~~dgq  242 (1591)
T KOG3514|consen  197 TD--TNCD---DHCKSKS-----------------------------MSSREQFVCLNDGECYSSDDGPHCDCQFDHDGQ  242 (1591)
T ss_pred             cC--CCCc---CCCCCcc-----------------------------ccccccceeccCCeEecCCCCCccccccccCcc
Confidence            11  1233   2222221                             11221 34554 677777777888888888889


Q ss_pred             cccccccccccCCCCcceEEcCCCCCc---ceEEEEEEEcccCCCceEEEeecccCCCCCCeEEEEEecCeEEEEEecCC
Q psy9228         210 RCEQKIKILQPAFKHGSYLAYPTPKTM---RKFKVSLRLNPRDVRDGIILYSGQSDDGLGDFISLAIREKHMEFRFDTGS  286 (834)
Q Consensus       210 ~Ce~~~~~~~~~F~g~~y~~~~~~~~~---~~~~i~l~f~t~~~~~glll~~~~~~~~~~d~~~l~l~~G~v~~~~~~g~  286 (834)
                      +||++.....+.|.|.-|+.|....+.   ...+|+|.|||. +.+|||||.+..    .||+.|.|++|.|.+.+++++
T Consensus       243 ~cekeK~~~eaTF~G~ef~~YDls~npI~s~~d~itl~FrT~-q~ngllfytG~~----~dYlnlaL~dGaV~l~~~l~~  317 (1591)
T KOG3514|consen  243 NCEKEKNDGEATFGGDEFVGYDLSQNPIRSKKDNITLTFRTV-QGNGLLFYTGDE----KDYLNLALQDGAVSLSSKLDG  317 (1591)
T ss_pred             ccccccCcceEEecCceEEEeeccCCcccccccceEEEEEEe-cCceeEEEccCC----cceeeEeecCCcEEEEEecCC
Confidence            999888788999999999999986543   678899999999 699999999976    599999999999999999998


Q ss_pred             Cc--ceecCCCC--Ccccccce-eccCCCeEEEEecCCCC----CCceeeeeecCCCceeccccccccccccccccccCC
Q psy9228         287 AT--PLYSNDAP--AFNPVSTK-EAPYGSKITLTCNNDLE----APVEYTWSKRSNGHVLPFGAFSRENTLTLQEIKNSD  357 (834)
Q Consensus       287 ~~--~~~~~~~~--~~~~~~~~-~~~~~~~v~l~vd~~~~----~~~~~~~~~~~~~~~~~~gg~~~~~~~~~~~~~~~~  357 (834)
                      +.  .+..+...  +.+.||.+ ..|+-..+++.||....    ...+++|...  ...+|.|+.+....     ...+.
T Consensus       318 g~~e~~~~p~~~rfdD~~WH~V~v~R~~~m~t~~VDg~~t~~~~~a~~~tmlss--s~~fyvgg~~~~~~-----l~gsr  390 (1591)
T KOG3514|consen  318 GDAEIIRMPNSFRFDDDSWHTVIVERSLQMMTLIVDGRRTEIRQYAPELTMLSS--SDFFYVGGSPNTAD-----LPGSR  390 (1591)
T ss_pred             ccceeEEccccccccCCcceEEEEEeeeEEEEEEEccEEecccccccceeEeec--cceEEecCCCCccc-----cCCCc
Confidence            86  23334333  44557755 55666778889987543    3345555332  22345555442211     11112


Q ss_pred             CceEEEEeCCC-------------------------CceeEeeEEeeeeccccccCCCcccccccCCccccceeEEEEEE
Q psy9228         358 AGMYVCKVSNK-------------------------DMTVEIPSILLVTDSVPLFTQKPLSYLALPTLTDAHLHFSIELS  412 (834)
Q Consensus       358 ~~~~~C~~~~~-------------------------~~~~~~~~~~~~~~~~~~f~~~~~s~l~~~~~~~~~~~~~i~~~  412 (834)
                      ..+.+|++...                         ++...|+..   ..-.|..|..+.||+.+|.|... ..-+|+|.
T Consensus       391 VsF~GClkkV~y~~d~~rl~L~~LAk~g~~~~k~~G~l~y~C~n~---~~~DpvtFtt~es~l~LP~Wnt~-~~gSiSf~  466 (1591)
T KOG3514|consen  391 VSFMGCLKKVVYKNDDTRLELSRLAKQGDSKMKTEGDLSYSCENV---AQLDPVTFTTPESYLTLPRWNTK-KSGSISFD  466 (1591)
T ss_pred             eeeeeeeeeeEeccCceeehhhHHhhcCCceeEeeceEEEecCCC---CccCceeeecccceeeccccccC-CcceeEEE
Confidence            23556665421                         111122211   12267788999999999999754 45789999


Q ss_pred             EeeCCCCeeEEEeccCCccccCCCCCeEEEEEECcEEEEEEeccc--EEEE-eeeeecCCCeEEEEEEEECCeEEEEECC
Q psy9228         413 FKPTDYNGLIMYTGDSNMKSYKGKGDFVSFGLEDGYPVFRFDVGL--VVLR-SKVTLVPHEWVVVTIIKDFKEGKLSVGG  489 (834)
Q Consensus       413 frt~~~~GlLl~~~~~~~~~~~~~~d~~~l~L~~G~l~~~~~~G~--~~i~-s~~~~~dg~wH~V~v~~~~~~~~l~VD~  489 (834)
                      |||+++||||+|.....    ....||++++|.||++.+.+++|+  +.++ +..+++||+||+|.+.|+++.+++.||.
T Consensus       467 FRTtepnGlil~~~g~~----~~~~d~~A~ELldghlyl~ldlGSG~iklras~rkv~DGeWhhv~l~R~gR~gsvsVd~  542 (1591)
T KOG3514|consen  467 FRTTEPNGLILFHGGPQ----ANATDYFAIELLDGHLYLLLDLGSGVIKLRASSRKVNDGEWHHVDLQRDGRTGSVSVDA  542 (1591)
T ss_pred             EeecCCCceEEEccCcc----cccccEEEEEEeCCeEEEEEecCCceEEeeeecccccCCceEEEEeeccCccceEEEee
Confidence            99999999999998754    568999999999999999999985  4444 5678999999999999999999999998


Q ss_pred             eeeeeeecCCCccccccCCCceeeccccCCCcccC---cCcccccCceeEEeeeEEcCeeeeeccc--ccccCCcc-cCC
Q psy9228         490 EPLIVGSTPGEKLQVLNLRTPLYLGGYNIYHVTPS---LSVEVTEGFHGCISTIDVLGSELDLINS--AVDSANIM-DCS  563 (834)
Q Consensus       490 ~~~~~~~~~g~~~~~l~~~~~l~iGG~~~~~~~~~---~~~~~~~gF~GCi~~v~ing~~~~~~~~--~~~~~~~~-~C~  563 (834)
                      ..... ..||. ...|+++.++|+|-.+.. ...+   +......||.|||+++.|+|+..++...  +..++++. .|.
T Consensus       543 ~~~df-~tpG~-s~iL~ld~~mylG~~~n~-l~~P~~vWta~L~~GyvGCirdl~i~G~s~di~q~ae~q~sagvkpsCs  619 (1591)
T KOG3514|consen  543 IKTDF-STPGD-SEILDLDDPMYLGEVPNN-LVYPSEVWTAALRKGYVGCIRDLFIDGVSTDIRQEAEAQNSAGVKPSCS  619 (1591)
T ss_pred             eecCc-cCCCc-ceeEeecCceeeccCCCC-ccCcHHHHHHHHhccchheehhheecceehhhHHHhhhccccccCcccc
Confidence            76654 46777 889999999999966664 2222   2234578999999999999999998764  44556664 677


Q ss_pred             CCCCCCCCCCCCCCCCCeecccCCCCCceeeecC-CCCCCCCCccCccCCC-----------------------------
Q psy9228         564 DLESSPVCAPKPCQNYGICYPTDTSERGYNCSCL-TGYSGDHCEKENNMCM-----------------------------  613 (834)
Q Consensus       564 ~~~~~~~C~~~pC~ngg~C~~~~~~~~~~~C~C~-~G~~G~~Ce~~~~~C~-----------------------------  613 (834)
                      ... ...|.+|||+|+|+|.+.|+   .|.|+|. .+|.|+.||.+...=.                             
T Consensus       620 ~~~-~~~C~~nPC~N~g~C~egwN---rfiCDCs~T~~~G~~CerE~t~ls~nGs~~m~i~L~~~~~tq~E~v~iRF~t~  695 (1591)
T KOG3514|consen  620 LSN-EKICESNPCQNGGKCSEGWN---RFICDCSGTGFEGRTCEREATALSYNGSMSMKIVLPHTMHTQAEDVSIRFRTQ  695 (1591)
T ss_pred             hhh-ccccCCCcccCCCCcccccc---ccccccccCcccCccccceeeeEEEcCeeeEEEEecccceeecceEEEEEEec
Confidence            533 23899999999999999999   9999998 8999999997311000                             


Q ss_pred             --------------------------------------------------------------------------------
Q psy9228         614 --------------------------------------------------------------------------------  613 (834)
Q Consensus       614 --------------------------------------------------------------------------------  613 (834)
                                                                                                      
T Consensus       696 r~~Gll~~Tta~~s~D~l~l~L~~g~vkl~v~ls~~~nlfag~~LnDN~WHtvrv~Rrg~~L~L~vD~~~~~~~~~~g~h  775 (1591)
T KOG3514|consen  696 RAYGLLFATTARGSADTLRLELDAGQVKLFVNLSGPENLFAGQSLNDNEWHTVRVVRRGKSLLLYVDFWSVSIYTMNGIH  775 (1591)
T ss_pred             ccceeEEEeccCCCCceEEEEEecceEEEEEecCCCcceeccccccCCcceEEEEEEcccceEEEeccccceeeeecCce
Confidence                                                                                            


Q ss_pred             ---------------------------------------------------CC---------------------------
Q psy9228         614 ---------------------------------------------------KG---------------------------  615 (834)
Q Consensus       614 ---------------------------------------------------~~---------------------------  615 (834)
                                                                         ..                           
T Consensus       776 ~~le~~~i~~g~e~~~~s~~~~nFiG~l~~LvFNG~~Yld~~K~~~~~ls~l~a~fkl~~iv~~paTf~sk~Sy~~la~L  855 (1591)
T KOG3514|consen  776 VRLEFHNIETGTESRAPSSVPSNFIGHLSGLVFNGQDYLDKCKMGDIQLSELSARFKLRAIVADPATFKSKSSYVKLATL  855 (1591)
T ss_pred             EEEEEeeeccccccccCCCCChhhhhhhhheEECcHHHHHHHhcCCcchhhcchhhCceEEeeccceeeechhhhhhhhh
Confidence                                                               00                           


Q ss_pred             --------------------------------------------------------------------------------
Q psy9228         616 --------------------------------------------------------------------------------  615 (834)
Q Consensus       616 --------------------------------------------------------------------------------  615 (834)
                                                                                                      
T Consensus       856 ~ay~s~~l~Fqfkt~sp~gll~fn~gd~ndfi~velvnG~ihYtfdlg~gp~~~k~~sr~hlnDnrWHnV~I~rd~~~~H  935 (1591)
T KOG3514|consen  856 QAYFSMHLFFQFKTTSPDGLLLFNSGDGNDFIAVELVNGYIHYTFDLGNGPTSMKGPSRQHLNDNRWHNVLIYRDKTNTH  935 (1591)
T ss_pred             heeeEEEEEEEEeecCCCeEEEecCCCCCceEEEEEeCcEEEEEEEcCCCcccccCcccCcCccccceeEEEEcCCCCce
Confidence                                                                                            


Q ss_pred             --------------------------------------------------------------------------------
Q psy9228         616 --------------------------------------------------------------------------------  615 (834)
Q Consensus       616 --------------------------------------------------------------------------------  615 (834)
                                                                                                      
T Consensus       936 tL~vD~s~~t~~~~g~~~l~l~g~LyiGGv~k~m~~~~p~~~asR~g~~g~~~s~dl~~r~p~L~~~a~~~s~lv~~~~s 1015 (1591)
T KOG3514|consen  936 TLKVDNSSTTQIIDGAVNLDLKGKLYIGGVSKPMYSFLPKLVASRSGFQGCLASLDLGGRLPDLISDALFESGLVEVGCS 1015 (1591)
T ss_pred             EEEecCceEEEEecCccccccccceecccccccccccccceeeccCCCCCCcCccCccccchhHHHHhhhhccceeeecc
Confidence                                                                                            


Q ss_pred             --------CccCCCceeeecCCCcEEcCCC-CCCCCCcccccccceeeEEcC-Cceeeec--hhhhhhccCcceEEEEEE
Q psy9228         616 --------DVCKNGGMCKVTPDSYECLCSL-GYAPPNCAKRVSIGSEVHFLG-EGYVELK--KELIEERRNEETIAFDFV  683 (834)
Q Consensus       616 --------~pC~ngg~C~~~~~~~~C~C~~-g~~G~~Ce~~~~~~~~~~F~g-~s~~~~~--~~~~~~~~~~~~i~~~fr  683 (834)
                              +-|.|.|.|+..|++|.|.|.+ .|+|+.|..+-   ..+.|++ .|-|.|.  ++.. .......|.+.|+
T Consensus      1016 gpst~c~~~acanhG~c~q~w~~~~c~csmtS~~Gp~C~d~g---tTYiFgk~gglI~YtwPpNdR-psTr~DrlAvGFs 1091 (1591)
T KOG3514|consen 1016 GPSTTCSEDACANHGVCIQQWNGIACDCSMTSYSGPRCNDPG---TTYIFGKSGGLITYTWPPNDR-PSTRKDRLAVGFS 1091 (1591)
T ss_pred             CCCcccchhhhhccceeeeeecceeeeccccccCCCccCCCc---eEEEECCCCceEEEecCCCCC-CCcccceEEEEEE
Confidence                    1389999999999999999998 89999998663   3678987 4566664  2221 2347789999999


Q ss_pred             eCCCCeeEEecCCCCCCCCCCcceEEEEEECCEEEEEEEcCCcEEEEEeCCceecCCCcEEEEEEEECCEEEEEEcCeee
Q psy9228         684 TDDKNALLLWNGQPSYKNGIGREFIAVAVVNGYLEYSYDLGDGVVTIKFSKKPVNDGIKHSVNVTRINKFGSLEVDSVIV  763 (834)
Q Consensus       684 T~~~~GlLl~~~~~~~~~~~~~~~~~l~l~~G~l~~~~~~g~~~~~l~~s~~~~nDg~wH~V~i~r~~~~~~l~VD~~~~  763 (834)
                      |..++|+|+.+.....    -+||+.|.|..|+|-+.||+|+..+.|...+..||||++|.|+|+|.+..++|+||..++
T Consensus      1092 Ttq~daVLvRVdSAsg----lgDYlqLhI~qG~igvvfNiGt~Diti~E~~~ivNDgkYHVVRFtR~GGNATLQVD~wpV 1167 (1591)
T KOG3514|consen 1092 TTQPDAVLVRVDSASG----LGDYLQLHINQGKIGVVFNIGTDDITISEHNAIVNDGKYHVVRFTRSGGNATLQVDSWPV 1167 (1591)
T ss_pred             eccCceEEEEEeccCC----CCceEEEEEeccEEEEEEeccCcccccccccccccCCceEEEEEEecCCceEEEecccch
Confidence            9999999999876541    379999999999999999999998888877889999999999999999999999999998


Q ss_pred             ecccCCCC-ccceecCCceEEcCcCCCCCCCCCccCCCceEEEEEEEECCceecccCCCC
Q psy9228         764 GKGESPGS-QDVINTRGNIYLGGTPNMDLMTGGRYVHPMSGLMMNIHIQNKHISNIGSSA  822 (834)
Q Consensus       764 ~~~~~~~~-~~~l~~~~~lyiGG~p~~~~~~~~~~~~~F~GCi~~v~in~~~~~~l~~~a  822 (834)
                      ......+. ...+|....|-|||.-..         ..|.|-|..|.+||-.+++|....
T Consensus      1168 ~e~yP~grqlTiFNtqa~I~IGGk~qG---------RpFqGqiSGLyyNgLkVLdlAaE~ 1218 (1591)
T KOG3514|consen 1168 NERYPAGRQLTIFNSQARISIGGKFQG---------RPFQGQISGLYYNGLKVLDLAAEN 1218 (1591)
T ss_pred             hhccCCCceeEEeeccceEEecccccC---------CcccceecceEEcceeeeehhhcc
Confidence            77655544 356888899999996522         479999999999999999997654



>KOG4289|consensus Back     alignment and domain information
>KOG3516|consensus Back     alignment and domain information
>KOG3516|consensus Back     alignment and domain information
>KOG3514|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>PF00054 Laminin_G_1: Laminin G domain; InterPro: IPR012679 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] Back     alignment and domain information
>smart00282 LamG Laminin G domain Back     alignment and domain information
>cd00110 LamG Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans Back     alignment and domain information
>PF00054 Laminin_G_1: Laminin G domain; InterPro: IPR012679 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] Back     alignment and domain information
>PF02210 Laminin_G_2: Laminin G domain; InterPro: IPR012680 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>smart00282 LamG Laminin G domain Back     alignment and domain information
>cd00110 LamG Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans Back     alignment and domain information
>PF02210 Laminin_G_2: Laminin G domain; InterPro: IPR012680 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information
>smart00210 TSPN Thrombospondin N-terminal -like domains Back     alignment and domain information
>PF13385 Laminin_G_3: Concanavalin A-like lectin/glucanases superfamily; PDB: 4DQA_A 1N1Y_A 1MZ6_A 1MZ5_A 1N1S_A 2A75_A 1WCS_A 1N1T_A 1N1V_A 2FHR_A Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>smart00159 PTX Pentraxin / C-reactive protein / pentaxin family Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>cd00152 PTX Pentraxins are plasma proteins characterized by their pentameric discoid assembly and their Ca2+ dependent ligand binding, such as Serum amyloid P component (SAP) and C-reactive Protein (CRP), which are cytokine-inducible acute-phase proteins implicated in innate immunity Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information
>smart00210 TSPN Thrombospondin N-terminal -like domains Back     alignment and domain information
>PF00354 Pentaxin: Pentaxin family; InterPro: IPR001759 Pentaxins (or pentraxins) [, ] are a family of proteins which show, under electron microscopy, a discoid arrangement of five noncovalently bound subunits Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 Back     alignment and domain information
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) Back     alignment and domain information
>PF13385 Laminin_G_3: Concanavalin A-like lectin/glucanases superfamily; PDB: 4DQA_A 1N1Y_A 1MZ6_A 1MZ5_A 1N1S_A 2A75_A 1WCS_A 1N1T_A 1N1V_A 2FHR_A Back     alignment and domain information
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 Back     alignment and domain information
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) Back     alignment and domain information
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) Back     alignment and domain information
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) Back     alignment and domain information
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>PF02973 Sialidase: Sialidase, N-terminal domain; InterPro: IPR004124 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin Back     alignment and domain information
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB Back     alignment and domain information
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin Back     alignment and domain information
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd04968 Ig3_Contactin_like Third Ig domain of contactin Back     alignment and domain information
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 Back     alignment and domain information
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D Back     alignment and domain information
>cd00152 PTX Pentraxins are plasma proteins characterized by their pentameric discoid assembly and their Ca2+ dependent ligand binding, such as Serum amyloid P component (SAP) and C-reactive Protein (CRP), which are cytokine-inducible acute-phase proteins implicated in innate immunity Back     alignment and domain information
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>smart00159 PTX Pentraxin / C-reactive protein / pentaxin family Back     alignment and domain information
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) Back     alignment and domain information
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins Back     alignment and domain information
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) Back     alignment and domain information
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) Back     alignment and domain information
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 Back     alignment and domain information
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins Back     alignment and domain information
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) Back     alignment and domain information
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin Back     alignment and domain information
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 Back     alignment and domain information
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>smart00560 LamGL LamG-like jellyroll fold domain Back     alignment and domain information
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>KOG3513|consensus Back     alignment and domain information
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 Back     alignment and domain information
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 Back     alignment and domain information
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins Back     alignment and domain information
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin Back     alignment and domain information
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) Back     alignment and domain information
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 Back     alignment and domain information
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 Back     alignment and domain information
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2) Back     alignment and domain information
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 Back     alignment and domain information
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>PF00047 ig: Immunoglobulin domain The Prosite family only concerns antibodies and MHCs Back     alignment and domain information
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) Back     alignment and domain information
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>smart00408 IGc2 Immunoglobulin C-2 Type Back     alignment and domain information
>cd04967 Ig1_Contactin First Ig domain of contactin Back     alignment and domain information
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin Back     alignment and domain information
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins Back     alignment and domain information
>PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) Back     alignment and domain information
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) Back     alignment and domain information
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins Back     alignment and domain information
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>PF00354 Pentaxin: Pentaxin family; InterPro: IPR001759 Pentaxins (or pentraxins) [, ] are a family of proteins which show, under electron microscopy, a discoid arrangement of five noncovalently bound subunits Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) Back     alignment and domain information
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>PHA02826 IL-1 receptor-like protein; Provisional Back     alignment and domain information
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin Back     alignment and domain information
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin Back     alignment and domain information
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1) Back     alignment and domain information
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional Back     alignment and domain information
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>KOG1834|consensus Back     alignment and domain information
>KOG3513|consensus Back     alignment and domain information
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins Back     alignment and domain information
>PHA02887 EGF-like protein; Provisional Back     alignment and domain information
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) Back     alignment and domain information
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>PF02973 Sialidase: Sialidase, N-terminal domain; InterPro: IPR004124 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins Back     alignment and domain information
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan Back     alignment and domain information
>PHA02826 IL-1 receptor-like protein; Provisional Back     alignment and domain information
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4, also known as cell adhesion molecule 4 (CADM4)) Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>smart00560 LamGL LamG-like jellyroll fold domain Back     alignment and domain information
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>PHA02887 EGF-like protein; Provisional Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican Back     alignment and domain information
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins Back     alignment and domain information
>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>smart00410 IG_like Immunoglobulin like Back     alignment and domain information
>smart00409 IG Immunoglobulin Back     alignment and domain information
>PF13927 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>PHA02633 hypothetical protein; Provisional Back     alignment and domain information
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0) Back     alignment and domain information
>PF06439 DUF1080: Domain of Unknown Function (DUF1080); InterPro: IPR010496 This is a family of proteins of unknown function Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>PF07354 Sp38: Zona-pellucida-binding protein (Sp38); InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals Back     alignment and domain information
>PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A Back     alignment and domain information
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins Back     alignment and domain information
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins Back     alignment and domain information
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins Back     alignment and domain information
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>cd00096 Ig Immunoglobulin domain Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA) Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) Back     alignment and domain information
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like Back     alignment and domain information
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins Back     alignment and domain information
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) Back     alignment and domain information
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins Back     alignment and domain information
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG) Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>cd00099 IgV Immunoglobulin variable domain (IgV) Back     alignment and domain information
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan Back     alignment and domain information
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI Back     alignment and domain information
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins Back     alignment and domain information
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins Back     alignment and domain information
>smart00406 IGv Immunoglobulin V-Type Back     alignment and domain information
>PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation Back     alignment and domain information
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain Back     alignment and domain information
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain Back     alignment and domain information
>KOG3546|consensus Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain Back     alignment and domain information
>cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain Back     alignment and domain information
>PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>PF06439 DUF1080: Domain of Unknown Function (DUF1080); InterPro: IPR010496 This is a family of proteins of unknown function Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates Back     alignment and domain information
>PF07686 V-set: Immunoglobulin V-set domain; InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins) Back     alignment and domain information
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) Back     alignment and domain information
>cd00098 IgC Immunoglobulin Constant domain Back     alignment and domain information
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain Back     alignment and domain information
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query834
3qcw_A1245 Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), 4e-21
3qcw_A 1245 Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), 6e-10
3r05_A1254 Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), 1e-19
3r05_A 1254 Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), 6e-10
3poy_A1019 Crystal Structure Of The Alpha-Neurexin-1 Ectodomai 2e-19
3poy_A 1019 Crystal Structure Of The Alpha-Neurexin-1 Ectodomai 2e-12
3poy_A 1019 Crystal Structure Of The Alpha-Neurexin-1 Ectodomai 7e-10
3sh4_A195 Laminin G Like Domain 3 From Human Perlecan Length 2e-19
3asi_A410 Alpha-Neurexin-1 Ectodomain Fragment; Lns5-Egf3-Lns 4e-19
1pz7_A204 Modulation Of Agrin Function By Alternative Splicin 1e-14
1pz7_A204 Modulation Of Agrin Function By Alternative Splicin 9e-08
1q56_A195 Nmr Structure Of The B0 Isoform Of The Agrin G3 Dom 1e-14
1q56_A195 Nmr Structure Of The B0 Isoform Of The Agrin G3 Dom 2e-08
1pz8_A201 Modulation Of Agrin Function By Alternative Splicin 1e-14
1pz8_A201 Modulation Of Agrin Function By Alternative Splicin 1e-07
3pve_A189 Crystal Structure Of The G2 Domain Of Agrin From Mu 8e-14
3pve_A189 Crystal Structure Of The G2 Domain Of Agrin From Mu 4e-12
3v64_A191 Crystal Structure Of Agrin And Lrp4 Length = 191 1e-11
3v64_A191 Crystal Structure Of Agrin And Lrp4 Length = 191 4e-07
1dyk_A 394 Laminin Alpha 2 Chain Lg4-5 Domain Pair Length = 39 4e-09
1okq_A 394 Laminin Alpha 2 Chain Lg4-5 Domain Pair, Ca1 Site M 1e-08
2wjs_A 608 Crystal Structure Of The Lg1-3 Region Of The Lamini 2e-07
2vj3_A135 Human Notch-1 Egfs 11-13 Length = 135 9e-06
2vj3_A135 Human Notch-1 Egfs 11-13 Length = 135 1e-05
1e07_A642 Model Of Human Carcinoembryonic Antigen By Homology 1e-05
2vj2_A169 Human Jagged-1, Domains Dsl And Egfs1-3 Length = 16 1e-04
3mw4_A178 Crystal Structure Of Beta-Neurexin 3 Without The Sp 2e-04
3h5c_B317 X-Ray Structure Of Protein Z-Protein Z Inhibitor Co 8e-04
4d90_A143 Crystal Structure Of Del-1 Egf Domains Length = 143 8e-04
>pdb|3QCW|A Chain A, Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), No Splice Inserts Length = 1245 Back     alignment and structure

Iteration: 1

Score = 100 bits (249), Expect = 4e-21, Method: Compositional matrix adjust. Identities = 178/771 (23%), Positives = 293/771 (38%), Gaps = 145/771 (18%) Query: 74 GAFQGLDLSELVYIGAVPD--FGEIHPS----AGFSNGFKGCVSRLKYNKTEFELFKMAV 127 G + LDL + +Y+G +P+ G + P+ A + G+ GC+ L + ++ +MA Sbjct: 544 GESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAE 603 Query: 128 ERVGVDSCNTCKSSKHNNCINNGLCQDAATRIGYTCICPPGFSGDRCSVLGEPCYPGACG 187 + +C C++N PC Sbjct: 604 VQSTAGVKPSCSRETAKPCLSN------------------------------PCK----N 629 Query: 188 DGSCQDVDGAMKCLCP-IGTAGKRCEQKIKILQPAFKHGSYLAYPTPKTMRKFKVSLRLN 246 +G C+D C C G G+ CE++ +L ++ ++ P M + L Sbjct: 630 NGMCRDGWNRYVCDCSGTGYLGRSCEREATVL--SYDGSMFMKIQLPVVMHTEAEDVSLR 687 Query: 247 PRDVRDGIILYSGQSDDGLGDFISLAIREKHMEFRFDTGSA-TPLYSNDAPAFNPVST-K 304 R R IL + S D D + L + ++ + G L++ N T + Sbjct: 688 FRSQRAYGILMATTSRDS-ADTLRLELDAGRVKLTVNLGKGPETLFAGYNLNDNEWHTVR 746 Query: 305 EAPYGSKITLTCNNDLEAPVEYTWSK-RSNGHVLPFGAFSRENTLT---------LQEIK 354 G + LT ++ + R H + G + L+ LQ + Sbjct: 747 VVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVPSNFIGHLQSLT 806 Query: 355 -NSDAGMYVCKVSNKD---MTVEIPSILLVTDSVPLFTQKPLSYLALPTL---TDAHLHF 407 N A + +CK + D + ++ D V T+ SY+AL TL T HL F Sbjct: 807 FNGMAYIDLCKNGDIDYCELNARFGFRNIIADPVTFKTKS--SYVALATLQAYTSMHLFF 864 Query: 408 SIELSFKPTDYNGLIMY-TGDSNMKSYKGKGDFVSFGLEDGYPVFRFDVG----LVVLRS 462 FK T +GLI+Y +GD N DF+ L GY + FD+G L+ S Sbjct: 865 Q----FKTTSLDGLILYNSGDGN--------DFIVVELVKGYLHYVFDLGNGANLIKGSS 912 Query: 463 KVTLVPHEWVVVTIIKDFKEGKLSVGGEPLIVGSTPGEKLQVLNLRTPLYLGGY--NIYH 520 L ++W V I +D + T G + L+L++ LY+GG Y Sbjct: 913 NKPLNDNQWHNVMISRDTSNLHTVKIDTKITTQITAGAR--NLDLKSDLYIGGVAKETYK 970 Query: 521 VTPSLSVEVTEGFHGCISTIDVLGSELDLINSAVDSANIMDCSDLESSPVCAPKPCQNYG 580 P L V EGF GC++++D+ G DLI+ A+ ++ S C C N G Sbjct: 971 SLPKL-VHAKEGFQGCLASVDLNGRLPDLISDALFCNGQIERGCEGPSTTCQEDSCSNQG 1029 Query: 581 ICYPTDTSERGYNCSC-LTGYSGDHCEKENNMCMKGDVCKNGGMC--KVTPDSYECLCSL 637 +C G++C C +T +SG C + K GG K P+ Sbjct: 1030 VCL---QQWDGFSCDCSMTSFSGPLCNDPGTTYI---FSKGGGQITYKWPPND------- 1076 Query: 638 GYAPPNCAKRVSIGSEVHFLGEGYVELKKELIEERRNEETIAFDFVTDDKNALLLWNGQP 697 P A R++IG F T K A+L+ + Sbjct: 1077 --RPSTRADRLAIG------------------------------FSTVQKEAVLV---RV 1101 Query: 698 SYKNGIGREFIAVAVVNGYLEYSYDLGDGVVTIKFSKKPVNDGIKHSVNVTRINKFGSLE 757 +G+G +++ + + G + +++G + I+ S +NDG H V TR +L+ Sbjct: 1102 DSSSGLG-DYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQ 1160 Query: 758 VDSVIVGKGESPGSQ-DVINTRGNIYLGGTPNMDLMTGGRYVHPMSGLMMN 807 VDS V + G Q + N++ I +GG G + +SGL N Sbjct: 1161 VDSWPVIERYPAGRQLTIFNSQATIIIGGKEQ-----GQPFQGQLSGLYYN 1206
>pdb|3QCW|A Chain A, Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), No Splice Inserts Length = 1245 Back     alignment and structure
>pdb|3R05|A Chain A, Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), With Splice Insert Ss3 Length = 1254 Back     alignment and structure
>pdb|3R05|A Chain A, Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), With Splice Insert Ss3 Length = 1254 Back     alignment and structure
>pdb|3POY|A Chain A, Crystal Structure Of The Alpha-Neurexin-1 Ectodomain, Lns 2-6 Length = 1019 Back     alignment and structure
>pdb|3POY|A Chain A, Crystal Structure Of The Alpha-Neurexin-1 Ectodomain, Lns 2-6 Length = 1019 Back     alignment and structure
>pdb|3POY|A Chain A, Crystal Structure Of The Alpha-Neurexin-1 Ectodomain, Lns 2-6 Length = 1019 Back     alignment and structure
>pdb|3SH4|A Chain A, Laminin G Like Domain 3 From Human Perlecan Length = 195 Back     alignment and structure
>pdb|3ASI|A Chain A, Alpha-Neurexin-1 Ectodomain Fragment; Lns5-Egf3-Lns6 Length = 410 Back     alignment and structure
>pdb|1PZ7|A Chain A, Modulation Of Agrin Function By Alternative Splicing And Ca2+ Binding Length = 204 Back     alignment and structure
>pdb|1PZ7|A Chain A, Modulation Of Agrin Function By Alternative Splicing And Ca2+ Binding Length = 204 Back     alignment and structure
>pdb|1Q56|A Chain A, Nmr Structure Of The B0 Isoform Of The Agrin G3 Domain In Its Ca2+ Bound State Length = 195 Back     alignment and structure
>pdb|1Q56|A Chain A, Nmr Structure Of The B0 Isoform Of The Agrin G3 Domain In Its Ca2+ Bound State Length = 195 Back     alignment and structure
>pdb|1PZ8|A Chain A, Modulation Of Agrin Function By Alternative Splicing And Ca2+ Binding Length = 201 Back     alignment and structure
>pdb|1PZ8|A Chain A, Modulation Of Agrin Function By Alternative Splicing And Ca2+ Binding Length = 201 Back     alignment and structure
>pdb|3PVE|A Chain A, Crystal Structure Of The G2 Domain Of Agrin From Mus Musculus Length = 189 Back     alignment and structure
>pdb|3PVE|A Chain A, Crystal Structure Of The G2 Domain Of Agrin From Mus Musculus Length = 189 Back     alignment and structure
>pdb|3V64|A Chain A, Crystal Structure Of Agrin And Lrp4 Length = 191 Back     alignment and structure
>pdb|3V64|A Chain A, Crystal Structure Of Agrin And Lrp4 Length = 191 Back     alignment and structure
>pdb|1DYK|A Chain A, Laminin Alpha 2 Chain Lg4-5 Domain Pair Length = 394 Back     alignment and structure
>pdb|1OKQ|A Chain A, Laminin Alpha 2 Chain Lg4-5 Domain Pair, Ca1 Site Mutant Length = 394 Back     alignment and structure
>pdb|2WJS|A Chain A, Crystal Structure Of The Lg1-3 Region Of The Laminin Alpha2 Chain Length = 608 Back     alignment and structure
>pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 Back     alignment and structure
>pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 Back     alignment and structure
>pdb|1E07|A Chain A, Model Of Human Carcinoembryonic Antigen By Homology Modelling And Curve-Fitting To Experimental Solution Scattering Data Length = 642 Back     alignment and structure
>pdb|2VJ2|A Chain A, Human Jagged-1, Domains Dsl And Egfs1-3 Length = 169 Back     alignment and structure
>pdb|3MW4|A Chain A, Crystal Structure Of Beta-Neurexin 3 Without The Splice Insert 4 Length = 178 Back     alignment and structure
>pdb|3H5C|B Chain B, X-Ray Structure Of Protein Z-Protein Z Inhibitor Complex Length = 317 Back     alignment and structure
>pdb|4D90|A Chain A, Crystal Structure Of Del-1 Egf Domains Length = 143 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query834
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 4e-72
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 6e-65
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 1e-59
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 5e-21
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 8e-21
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 4e-17
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 6e-06
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 2e-64
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 1e-21
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 4e-21
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 1e-19
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 4e-07
3sh4_A195 LG3 peptide; actin disassambly, integrin alpha12 B 4e-38
3sh4_A195 LG3 peptide; actin disassambly, integrin alpha12 B 6e-31
3sh4_A195 LG3 peptide; actin disassambly, integrin alpha12 B 2e-09
3sh4_A195 LG3 peptide; actin disassambly, integrin alpha12 B 6e-07
1pz7_A204 Agrin; structural protein; 1.42A {Gallus gallus} S 3e-37
1pz7_A204 Agrin; structural protein; 1.42A {Gallus gallus} S 6e-32
1pz7_A204 Agrin; structural protein; 1.42A {Gallus gallus} S 1e-11
1pz7_A204 Agrin; structural protein; 1.42A {Gallus gallus} S 9e-10
3pve_A189 Agrin, AGRN protein; mRNA splicing, structural gen 4e-36
3pve_A189 Agrin, AGRN protein; mRNA splicing, structural gen 1e-32
3pve_A189 Agrin, AGRN protein; mRNA splicing, structural gen 2e-14
3pve_A189 Agrin, AGRN protein; mRNA splicing, structural gen 3e-10
3v64_A191 Low-density lipoprotein receptor-related protein; 8e-35
3v64_A191 Low-density lipoprotein receptor-related protein; 2e-33
3v64_A191 Low-density lipoprotein receptor-related protein; 1e-11
3v64_A191 Low-density lipoprotein receptor-related protein; 1e-06
2h0b_A184 Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A 4e-33
2h0b_A184 Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A 1e-28
2h0b_A184 Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A 3e-10
2h0b_A184 Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A 2e-07
2wjs_A608 Laminin subunit alpha-2; integrin, secreted, coile 1e-30
2wjs_A608 Laminin subunit alpha-2; integrin, secreted, coile 5e-30
2wjs_A 608 Laminin subunit alpha-2; integrin, secreted, coile 3e-28
2wjs_A 608 Laminin subunit alpha-2; integrin, secreted, coile 2e-23
2wjs_A608 Laminin subunit alpha-2; integrin, secreted, coile 4e-23
2wjs_A 608 Laminin subunit alpha-2; integrin, secreted, coile 1e-20
2wjs_A608 Laminin subunit alpha-2; integrin, secreted, coile 1e-04
2jd4_A 383 Laminin subunit alpha-1; basement membrane protein 1e-29
2jd4_A383 Laminin subunit alpha-1; basement membrane protein 1e-28
2jd4_A383 Laminin subunit alpha-1; basement membrane protein 1e-27
2jd4_A383 Laminin subunit alpha-1; basement membrane protein 5e-21
2jd4_A383 Laminin subunit alpha-1; basement membrane protein 3e-10
2jd4_A383 Laminin subunit alpha-1; basement membrane protein 3e-05
2jd4_A383 Laminin subunit alpha-1; basement membrane protein 1e-04
1dyk_A394 Laminin alpha 2 chain; metal binding protein; 2.0A 1e-27
1dyk_A 394 Laminin alpha 2 chain; metal binding protein; 2.0A 2e-26
1dyk_A394 Laminin alpha 2 chain; metal binding protein; 2.0A 3e-25
1dyk_A394 Laminin alpha 2 chain; metal binding protein; 2.0A 3e-21
1dyk_A394 Laminin alpha 2 chain; metal binding protein; 2.0A 1e-07
1dyk_A394 Laminin alpha 2 chain; metal binding protein; 2.0A 6e-06
1f5f_A205 SHBG, sex hormone-binding globulin; jellyroll, sig 9e-27
1f5f_A205 SHBG, sex hormone-binding globulin; jellyroll, sig 1e-23
1f5f_A205 SHBG, sex hormone-binding globulin; jellyroll, sig 3e-06
3bod_A178 Neurexin-1-alpha; neurexin1D, LNS6, alternative sp 1e-26
3bod_A178 Neurexin-1-alpha; neurexin1D, LNS6, alternative sp 6e-21
3bod_A178 Neurexin-1-alpha; neurexin1D, LNS6, alternative sp 2e-06
2r16_A182 Neurexin-1-alpha; beta-sandwich, cell adhesion, sp 1e-26
2r16_A182 Neurexin-1-alpha; beta-sandwich, cell adhesion, sp 5e-24
2r16_A182 Neurexin-1-alpha; beta-sandwich, cell adhesion, sp 2e-07
2r16_A182 Neurexin-1-alpha; beta-sandwich, cell adhesion, sp 4e-06
1h30_A 422 GAS6, growth-arrest-specific protein; laminin G-do 2e-26
1h30_A422 GAS6, growth-arrest-specific protein; laminin G-do 3e-25
1h30_A422 GAS6, growth-arrest-specific protein; laminin G-do 6e-22
1h30_A422 GAS6, growth-arrest-specific protein; laminin G-do 1e-09
1h30_A422 GAS6, growth-arrest-specific protein; laminin G-do 5e-05
1d2s_A170 SHBG, sex hormone-binding globulin; steroid transp 4e-26
1d2s_A170 SHBG, sex hormone-binding globulin; steroid transp 9e-23
1d2s_A170 SHBG, sex hormone-binding globulin; steroid transp 3e-08
1d2s_A170 SHBG, sex hormone-binding globulin; steroid transp 6e-04
2r1d_A226 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 3e-24
2r1d_A226 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 1e-20
2r1d_A226 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 1e-04
2r1b_A220 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 2e-20
2r1b_A220 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 1e-15
2r1b_A220 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 8e-05
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 3e-18
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 1e-16
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 1e-15
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 1e-14
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 2e-08
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 4e-07
2vh0_B134 Activated factor XA light chain; serine protease, 4e-17
2vh0_B134 Activated factor XA light chain; serine protease, 4e-14
2vh0_B134 Activated factor XA light chain; serine protease, 2e-12
2vh0_B134 Activated factor XA light chain; serine protease, 4e-11
2vh0_B134 Activated factor XA light chain; serine protease, 3e-10
2vh0_B134 Activated factor XA light chain; serine protease, 6e-08
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 8e-17
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 3e-16
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 4e-14
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 1e-12
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 6e-07
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 3e-06
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 1e-16
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 8e-14
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 2e-13
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 3e-11
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 4e-11
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 5e-09
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 3e-06
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 4e-16
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 8e-12
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 2e-11
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 1e-10
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 2e-10
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 1e-09
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 1e-09
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 4e-06
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 8e-06
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 4e-15
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 1e-13
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 3e-07
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 1e-06
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 1e-06
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 3e-06
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 5e-15
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 7e-15
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 2e-07
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 6e-07
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 1e-06
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 1e-06
1aut_L114 Activated protein C; serine proteinase, plasma cal 3e-13
1aut_L114 Activated protein C; serine proteinase, plasma cal 3e-11
1aut_L114 Activated protein C; serine proteinase, plasma cal 6e-07
1aut_L114 Activated protein C; serine proteinase, plasma cal 2e-05
1aut_L114 Activated protein C; serine proteinase, plasma cal 3e-05
1aut_L114 Activated protein C; serine proteinase, plasma cal 6e-04
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 3e-12
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 2e-09
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 1e-11
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 4e-11
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 8e-11
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 1e-10
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 3e-10
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 3e-10
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 7e-10
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 8e-08
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 2e-07
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 9e-07
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 5e-06
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 8e-11
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 1e-10
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 3e-10
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 1e-09
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 2e-09
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 2e-09
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 8e-07
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 6e-06
1gl4_B98 Basement membrane-specific heparan sulfate proteog 4e-10
1gl4_B98 Basement membrane-specific heparan sulfate proteog 4e-06
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 9e-09
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 2e-08
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 3e-07
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 2e-06
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 3e-06
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 5e-05
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 8e-05
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 5e-04
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 1e-08
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 6e-06
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 2e-05
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 1e-08
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 5e-04
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 2e-08
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 4e-08
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 6e-08
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 1e-07
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 2e-08
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 2e-08
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 1e-07
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 4e-07
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 8e-06
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 8e-06
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 8e-05
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 5e-04
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 3e-08
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 2e-05
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 4e-08
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 3e-07
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 5e-07
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 8e-07
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 1e-06
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 4e-06
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 8e-05
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 4e-08
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 6e-08
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 1e-07
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 2e-06
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 2e-05
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 5e-05
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 5e-08
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 5e-07
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 2e-06
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 5e-06
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 8e-06
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 1e-05
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 6e-08
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 2e-05
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 6e-08
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 5e-07
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 3e-04
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 7e-08
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 3e-04
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 8e-08
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 3e-05
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 3e-04
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 9e-08
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 7e-06
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 7e-04
1nn8_R302 CD155 antigen, poliovirus receptor; icosahedral vi 1e-07
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 1e-07
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 2e-05
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 1e-07
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 2e-06
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 1e-07
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 1e-05
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 1e-07
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 2e-07
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 6e-07
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 2e-07
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 3e-05
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 9e-04
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 2e-07
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 7e-06
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 3e-07
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 5e-05
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 5e-05
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 1e-04
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 1e-04
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 3e-07
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 3e-04
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 4e-07
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 1e-06
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 4e-05
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 3e-04
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 4e-07
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 4e-04
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 4e-07
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 1e-05
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 1e-05
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 1e-04
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 1e-04
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 5e-07
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 1e-06
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 4e-06
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 6e-04
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 5e-07
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 5e-07
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 3e-04
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 6e-04
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 7e-07
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 2e-05
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 4e-05
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 6e-05
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 2e-04
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 8e-07
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 3e-04
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 9e-07
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 3e-05
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 4e-05
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 5e-04
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 1e-06
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 1e-04
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 6e-04
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 1e-06
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 1e-05
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 2e-04
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 1e-06
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 1e-05
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 2e-05
2ens_A96 Advanced glycosylation END product-specific recept 1e-06
2ens_A96 Advanced glycosylation END product-specific recept 7e-04
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 1e-06
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 2e-05
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 1e-06
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 1e-05
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 2e-04
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 3e-04
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 1e-06
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 2e-06
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 3e-06
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 1e-04
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 4e-04
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 5e-04
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 1e-06
3shs_A304 HOC head outer capsid protein; immunoglobulin-like 2e-06
3shs_A304 HOC head outer capsid protein; immunoglobulin-like 3e-04
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 2e-06
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 5e-06
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 1e-04
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 5e-04
1nql_B53 Epidermal growth factor; cell surface receptor, ty 2e-06
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 2e-06
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 4e-06
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 8e-06
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 6e-05
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 1e-04
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 4e-04
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 2e-06
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 4e-06
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 1e-05
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 2e-06
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 2e-04
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 2e-06
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 1e-05
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 3e-05
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 4e-05
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 4e-05
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 6e-05
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 6e-04
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 2e-06
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 3e-06
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 9e-06
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 3e-05
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 3e-06
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 2e-04
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 3e-06
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 2e-05
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 2e-04
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 9e-04
3s35_X122 Vascular endothelial growth factor receptor 2; ant 3e-06
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 4e-06
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 4e-06
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 2e-05
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 4e-06
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 4e-05
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 2e-04
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 5e-06
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 1e-05
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 3e-05
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 3e-04
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 5e-06
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 3e-05
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 2e-04
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 5e-06
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 5e-05
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 5e-06
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 2e-04
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 4e-04
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 5e-06
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 7e-06
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 1e-04
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 7e-06
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 8e-04
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 7e-06
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 3e-05
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 5e-05
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 1e-05
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 2e-05
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 2e-05
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 1e-05
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 9e-05
3v65_B386 Low-density lipoprotein receptor-related protein; 1e-05
3v65_B 386 Low-density lipoprotein receptor-related protein; 3e-04
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 1e-05
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 4e-05
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 1e-05
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 1e-05
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 1e-05
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 7e-05
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 6e-04
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 1e-05
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 7e-05
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 1e-05
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 3e-05
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 5e-04
2eo1_A102 OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 2e-05
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 2e-05
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 3e-05
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 2e-05
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 9e-04
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 2e-05
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 4e-04
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 2e-05
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 2e-05
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2e-05
2edo_A121 CD48 antigen; beta-sandwich, IG-fold, B-lymphocyte 2e-05
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 2e-05
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 2e-05
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 2e-05
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 9e-05
2bou_A143 EGF-like module containing mucin-like hormone rece 3e-05
2bou_A143 EGF-like module containing mucin-like hormone rece 4e-04
2bou_A143 EGF-like module containing mucin-like hormone rece 5e-04
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 3e-05
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 6e-04
3p5b_L400 Low density lipoprotein receptor variant; B-propel 3e-05
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 1e-04
3mjg_X289 Beta-type platelet-derived growth factor receptor; 3e-05
3mjg_X289 Beta-type platelet-derived growth factor receptor; 5e-05
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 4e-05
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 4e-05
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 4e-05
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 4e-05
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 5e-05
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 5e-05
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 6e-05
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 6e-05
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 6e-05
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 5e-04
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 7e-05
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 7e-05
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 7e-05
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 7e-05
1pko_A139 Myelin oligodendrocyte glycoprotein; IGV-domain, i 8e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-05
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 1e-04
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 1e-04
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 1e-04
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 6e-04
2fbo_J250 V1V2;, variable region-containing chitin-binding p 1e-04
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 1e-04
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 1e-04
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 2e-04
3so5_A112 LIG-3, leucine-rich repeats and immunoglobulin-lik 2e-04
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 2e-04
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 2e-04
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 2e-04
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 2e-04
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 2e-04
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 2e-04
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 3e-04
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 3e-04
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 3e-04
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 3e-04
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 3e-04
1waa_A93 Titin; metal binding protein, calmodulin-binding, 3e-04
2i9a_A145 Urokinase-type plasminogen activator; growth facto 3e-04
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 4e-04
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 7e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-04
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 4e-04
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 4e-04
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 4e-04
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 5e-04
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 5e-04
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 5e-04
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 5e-04
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 6e-04
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 6e-04
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 7e-04
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 7e-04
1eaj_A126 Coxsackie virus and adenovirus receptor; virus/vir 8e-04
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 8e-04
2pnd_A119 V-SET and immunoglobulin domain containing 4; comp 8e-04
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 9e-04
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
 Score =  257 bits (656), Expect = 4e-72
 Identities = 144/806 (17%), Positives = 271/806 (33%), Gaps = 140/806 (17%)

Query: 60   MFVDGIGPFSGESQGAFQGLDLSELVYIGAVPD------FGEIHPSAGFSNGFKGCVSRL 113
            + V+ +      + G  + LDL + +Y+G +P+      F     +A  + G+ GC+  L
Sbjct: 531  ISVNTL-RTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDL 589

Query: 114  KYNKTEFELFKMAVERVGVDSCNTCKSSKHNNCINNGLCQDAATRIGYTCICPPGFSGDR 173
              +    ++ +MA  +       +C       C++N                        
Sbjct: 590  FIDGQSKDIRQMAEVQSTAGVKPSCSRETAKPCLSN------------------------ 625

Query: 174  CSVLGEPCYPGACGDGSCQDVDGAMKCLCPIGTAGKRCEQKIKILQPAFKHGSYLAYPTP 233
                  PC       G C+D      C C       R  ++   +   +    ++    P
Sbjct: 626  ------PCKNN----GMCRDGWNRYVCDCSGTGYLGRSCEREATVLS-YDGSMFMKIQLP 674

Query: 234  KTM--RKFKVSLRLNPRDVRDGIILYSGQSDDGLGDFISLAIREKHMEFRFDTGSATPLY 291
              M      VSLR   +    GI++ +   D    D + L +    ++   + G      
Sbjct: 675  VVMHTEAEDVSLRFRSQR-AYGILMATTSRDSA--DTLRLELDAGRVKLTVNLGKGPETL 731

Query: 292  SNDAPA--FNPVSTKEAPYGSKITLTCNNDLEAPVEYTWSKRSNG------------HVL 337
                        + +    G  + LT ++  +  +    +                    
Sbjct: 732  FAGYNLNDNEWHTVRVVRRGKSLKLTVDD--QQAMTGQMAGDHTRLEFHNIETGIITERR 789

Query: 338  PFGAFSRENTLTLQEIKNSDAGMYVCKVSNKDMTVEIPSILLVTDSV--PLFTQKPLSYL 395
               +        LQ +  +         +      E+ +     + +  P+  +   SY+
Sbjct: 790  YLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIADPVTFKTKSSYV 849

Query: 396  ALPTLTDAHLHFSIELSFKPTDYNGLIMYTGDSNMKSYKGKGDFVSFGLEDGYPVFRFDV 455
            AL TL  A+    +   FK T  +GLI+Y             DF+   L  GY  + FD+
Sbjct: 850  ALATL-QAYTSMHLFFQFKTTSLDGLILYNSG-------DGNDFIVVELVKGYLHYVFDL 901

Query: 456  G----LVVLRSKVTLVPHEWVVVTIIKDFKEGKLSVGGEPLIVGSTPGEKLQVLNLRTPL 511
            G    L+   S   L  ++W  V I +D            +    T G +   L+L++ L
Sbjct: 902  GNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKIDTKITTQITAGARN--LDLKSDL 959

Query: 512  YLGG-YNIYHVTPSLSVEVTEGFHGCISTIDVLGSELDLINSAVDSANIMDCSDLESSPV 570
            Y+GG     + +    V   EGF GC++++D+ G   DLI+ A+     ++      S  
Sbjct: 960  YIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLPDLISDALFCNGQIERGCEGPSTT 1019

Query: 571  CAPKPCQNYGICYPTDTSERGYNCSC-LTGYSGDHCEKENNMCMKGDVCKNGGMCKVTPD 629
            C    C N G+C        G++C C +T +SG  C       +                
Sbjct: 1020 CQEDSCSNQGVCLQQWD---GFSCDCSMTSFSGPLCNDPGTTYI---------------- 1060

Query: 630  SYECLCSLGYAPPNCAKRVSIGSEVHFLGEGYVELKKELIEER-RNEETIAFDFVTDDKN 688
                                        G G +  K    +      + +A  F T  K 
Sbjct: 1061 -------------------------FSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKE 1095

Query: 689  ALLLWNGQPSYKNGIGREFIAVAVVNGYLEYSYDLGDGVVTIKFSKKPVNDGIKHSVNVT 748
            A+L+     S       +++ + +  G +   +++G   + I+ S   +NDG  H V  T
Sbjct: 1096 AVLVRVDSSSGLG----DYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFT 1151

Query: 749  RINKFGSLEVDSVIVGKGESPGSQ-DVINTRGNIYLGGTPNMDLMTGGRYVHPMSGLMMN 807
            R     +L+VDS  V +    G Q  + N++  I +GG              P  G +  
Sbjct: 1152 RSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQ---------PFQGQLSG 1202

Query: 808  IHIQNKHISNIGSSASSGLHVMPWIR 833
            ++     + N+ +   + + ++  +R
Sbjct: 1203 LYYNGLKVLNMAAENDANIAIVGNVR 1228


>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A Length = 195 Back     alignment and structure
>3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A Length = 195 Back     alignment and structure
>3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A Length = 195 Back     alignment and structure
>3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A Length = 195 Back     alignment and structure
>1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A Length = 204 Back     alignment and structure
>1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A Length = 204 Back     alignment and structure
>1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A Length = 204 Back     alignment and structure
>1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A Length = 204 Back     alignment and structure
>3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} Length = 189 Back     alignment and structure
>3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} Length = 189 Back     alignment and structure
>3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} Length = 189 Back     alignment and structure
>3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} Length = 189 Back     alignment and structure
>3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Length = 191 Back     alignment and structure
>3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Length = 191 Back     alignment and structure
>3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Length = 191 Back     alignment and structure
>3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Length = 191 Back     alignment and structure
>2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Length = 184 Back     alignment and structure
>2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Length = 184 Back     alignment and structure
>2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Length = 184 Back     alignment and structure
>2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Length = 184 Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 Back     alignment and structure
>2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 Back     alignment and structure
>2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 Back     alignment and structure
>2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 Back     alignment and structure
>2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 Back     alignment and structure
>2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 Back     alignment and structure
>2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 Back     alignment and structure
>2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 Back     alignment and structure
>1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 Back     alignment and structure
>1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 Back     alignment and structure
>1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 Back     alignment and structure
>1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 Back     alignment and structure
>1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 Back     alignment and structure
>1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 Back     alignment and structure
>1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* Length = 205 Back     alignment and structure
>1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* Length = 205 Back     alignment and structure
>1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* Length = 205 Back     alignment and structure
>3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* Length = 178 Back     alignment and structure
>3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* Length = 178 Back     alignment and structure
>3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* Length = 178 Back     alignment and structure
>2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} Length = 182 Back     alignment and structure
>2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} Length = 182 Back     alignment and structure
>2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} Length = 182 Back     alignment and structure
>2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} Length = 182 Back     alignment and structure
>1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Length = 422 Back     alignment and structure
>1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Length = 422 Back     alignment and structure
>1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Length = 422 Back     alignment and structure
>1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Length = 422 Back     alignment and structure
>1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Length = 422 Back     alignment and structure
>1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* Length = 170 Back     alignment and structure
>1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* Length = 170 Back     alignment and structure
>1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* Length = 170 Back     alignment and structure
>1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* Length = 170 Back     alignment and structure
>2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* Length = 226 Back     alignment and structure
>2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* Length = 226 Back     alignment and structure
>2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* Length = 226 Back     alignment and structure
>2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* Length = 220 Back     alignment and structure
>2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* Length = 220 Back     alignment and structure
>2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* Length = 220 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Length = 53 Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Length = 53 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 Back     alignment and structure
>3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Length = 53 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Length = 162 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 Back     alignment and structure
>2edo_A CD48 antigen; beta-sandwich, IG-fold, B-lymphocyte activation marker blast-1, BCM1 surface antigen, leukocyte antigen MEM-102, TCT.1; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Length = 157 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 Back     alignment and structure
>1pko_A Myelin oligodendrocyte glycoprotein; IGV-domain, immune system; 1.45A {Rattus norvegicus} SCOP: b.1.1.1 PDB: 1pkq_E 3csp_A 1py9_A Length = 139 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Length = 58 Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Length = 63 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Length = 50 Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Length = 112 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* 3krk_A* ... Length = 587 Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} Length = 164 Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Length = 50 Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Length = 145 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Length = 46 Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Length = 79 Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Length = 553 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Length = 202 Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 Back     alignment and structure
>1eaj_A Coxsackie virus and adenovirus receptor; virus/viral protein receptor, immunoglobulin V domain fold, symmetric dimer; 1.35A {Homo sapiens} SCOP: b.1.1.1 PDB: 1f5w_A 2j12_B 2j1k_A 2wbw_B* 2w9l_A* 1rsf_A 1jew_R 1kac_B 1p69_B 1p6a_B Length = 126 Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Length = 105 Back     alignment and structure
>2pnd_A V-SET and immunoglobulin domain containing 4; complement receptor, IG-like domain, immune system; 1.00A {Mus musculus} PDB: 2icc_A 2ice_S* 2icf_S* Length = 119 Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query834
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 100.0
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 100.0
2wjs_A608 Laminin subunit alpha-2; integrin, secreted, coile 100.0
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 100.0
2jd4_A383 Laminin subunit alpha-1; basement membrane protein 100.0
1dyk_A394 Laminin alpha 2 chain; metal binding protein; 2.0A 100.0
1h30_A422 GAS6, growth-arrest-specific protein; laminin G-do 100.0
2wjs_A 608 Laminin subunit alpha-2; integrin, secreted, coile 100.0
3sh4_A195 LG3 peptide; actin disassambly, integrin alpha12 B 99.97
1pz7_A204 Agrin; structural protein; 1.42A {Gallus gallus} S 99.96
2jd4_A383 Laminin subunit alpha-1; basement membrane protein 99.96
3v64_A191 Low-density lipoprotein receptor-related protein; 99.96
1dyk_A394 Laminin alpha 2 chain; metal binding protein; 2.0A 99.96
3pve_A189 Agrin, AGRN protein; mRNA splicing, structural gen 99.95
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 99.95
2r16_A182 Neurexin-1-alpha; beta-sandwich, cell adhesion, sp 99.94
1d2s_A170 SHBG, sex hormone-binding globulin; steroid transp 99.94
1h30_A 422 GAS6, growth-arrest-specific protein; laminin G-do 99.94
2h0b_A184 Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A 99.93
3bod_A178 Neurexin-1-alpha; neurexin1D, LNS6, alternative sp 99.93
1f5f_A205 SHBG, sex hormone-binding globulin; jellyroll, sig 99.93
2r1d_A226 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 99.92
2r1b_A220 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 99.92
3v64_A191 Low-density lipoprotein receptor-related protein; 99.9
1pz7_A204 Agrin; structural protein; 1.42A {Gallus gallus} S 99.9
3pve_A189 Agrin, AGRN protein; mRNA splicing, structural gen 99.88
3sh4_A195 LG3 peptide; actin disassambly, integrin alpha12 B 99.88
1d2s_A170 SHBG, sex hormone-binding globulin; steroid transp 99.88
1f5f_A205 SHBG, sex hormone-binding globulin; jellyroll, sig 99.84
2r16_A182 Neurexin-1-alpha; beta-sandwich, cell adhesion, sp 99.83
3bod_A178 Neurexin-1-alpha; neurexin1D, LNS6, alternative sp 99.82
2h0b_A184 Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A 99.82
2r1b_A220 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 99.78
2r1d_A226 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 99.78
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.77
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.75
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.75
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.74
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.74
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.68
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.64
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.62
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.53
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.51
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.5
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.5
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.47
1yo8_A634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.47
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.44
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.44
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.41
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.37
2bou_A143 EGF-like module containing mucin-like hormone rece 99.37
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.34
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 99.32
1yo8_A634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.3
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 99.29
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 99.28
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 99.28
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 99.28
2vh0_B134 Activated factor XA light chain; serine protease, 99.27
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.27
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.25
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 99.24
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 99.23
1aut_L114 Activated protein C; serine proteinase, plasma cal 99.2
2vh0_B134 Activated factor XA light chain; serine protease, 99.19
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 99.19
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.19
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 99.19
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 99.17
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 99.16
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 99.15
1aut_L114 Activated protein C; serine proteinase, plasma cal 99.12
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.11
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 99.11
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 99.08
3v65_B386 Low-density lipoprotein receptor-related protein; 99.06
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 99.01
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 99.0
2bou_A143 EGF-like module containing mucin-like hormone rece 98.97
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 98.96
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 98.88
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 98.82
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 98.82
1a3p_A45 Epidermal growth factor; disulfide connectivities, 98.78
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.76
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.75
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 98.71
1a3p_A45 Epidermal growth factor; disulfide connectivities, 98.7
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 98.69
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.66
3flp_A217 SAP-like pentraxin; physiological doubly-stacked h 98.65
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 98.65
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 98.64
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 98.64
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 98.62
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 98.62
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 98.61
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 98.61
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.6
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 98.58
3kqr_A204 Serum amyloid P-component; glycoprotein, disulfide 98.56
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 98.53
3v65_B 386 Low-density lipoprotein receptor-related protein; 98.53
1nql_B53 Epidermal growth factor; cell surface receptor, ty 98.52
3pvn_A206 C-reactive protein; pentraxin family, immune syste 98.52
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 98.45
2k2s_B61 Micronemal protein 6; microneme protein complex, c 98.45
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 98.44
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 98.44
2k2s_B61 Micronemal protein 6; microneme protein complex, c 98.43
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 98.4
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 98.39
2erf_A209 Thrombospondin-1; TSP-1, N-terminal TSPN, HBD, sug 98.35
1za4_A251 Thrombospondin 1; TSP-1, NTSP-1, HBD, arixtra, cel 98.34
2v73_A191 CBM40, putative EXO-alpha-sialidase; carbohydrate- 98.33
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 98.31
1nql_B53 Epidermal growth factor; cell surface receptor, ty 98.3
2uur_A245 Collagen alpha-1(IX) chain; glycoprotein, hydroxyl 98.15
4dqa_A355 Uncharacterized protein; two domains structure, DU 98.06
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 98.06
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 98.04
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 97.98
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 97.95
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 97.9
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 97.84
2i9a_A145 Urokinase-type plasminogen activator; growth facto 97.82
3flp_A217 SAP-like pentraxin; physiological doubly-stacked h 97.81
2i9a_A145 Urokinase-type plasminogen activator; growth facto 97.79
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 97.71
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 97.7
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 97.66
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 97.63
3kqr_A204 Serum amyloid P-component; glycoprotein, disulfide 97.63
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 97.62
3pvn_A206 C-reactive protein; pentraxin family, immune syste 97.61
1q4g_A553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 97.61
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 97.58
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 97.56
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 97.53
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 97.5
3r08_E82 T-cell surface glycoprotein CD3 epsilon chain; ant 97.5
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 97.47
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 97.46
3nt1_A587 Prostaglandin-endoperoxide synthase 2; prostagland 97.43
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 97.43
2v73_A191 CBM40, putative EXO-alpha-sialidase; carbohydrate- 97.43
2lu7_A84 Obscurin-like protein 1; structural genomics, nort 97.39
1xau_A122 B- and T-lymphocyte attenuator; IG domain, beta sa 97.37
2erf_A209 Thrombospondin-1; TSP-1, N-terminal TSPN, HBD, sug 97.35
2lvc_A91 Obscurin-like protein 1; structural genomics, nort 97.35
3knb_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, AT 97.34
1za4_A251 Thrombospondin 1; TSP-1, NTSP-1, HBD, arixtra, cel 97.32
4hwu_A95 Fibroblast growth factor receptor 2; FGFR2, KGFR, 97.31
1gl4_B98 Basement membrane-specific heparan sulfate proteog 97.31
2jkb_A 686 Sialidase B; intramolecular trans-sialidase, lyase 97.29
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 97.27
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 97.26
1waa_A93 Titin; metal binding protein, calmodulin-binding, 97.25
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 97.24
3knb_A100 Titin; IG-like, titin, OBSL1, ATP-binding, calmodu 97.21
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 97.21
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 97.2
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 97.2
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 97.19
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 97.18
2sli_A 679 Intramolecular trans-sialidase; hydrolase, neurami 97.14
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 97.14
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 97.11
2aw2_A120 B and T lymphocyte attenuator; IGI domain, IGG dom 97.1
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 97.08
1wwb_X103 Protein (brain derived neurotrophic factor recepto 97.07
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 97.06
1he7_A126 High affinity nerve growth factor receptor; transf 97.03
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 97.01
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 97.01
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 96.99
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 96.98
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 96.94
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 96.92
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 96.9
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 96.9
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 96.86
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 96.82
4fqp_A313 Poliovirus receptor; immunoglobulin-like domain, I 96.81
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 96.8
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 96.79
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 96.78
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 96.78
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 96.77
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 96.77
2ens_A96 Advanced glycosylation END product-specific recept 96.74
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 96.73
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 96.73
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 96.72
4dqa_A355 Uncharacterized protein; two domains structure, DU 96.72
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 96.72
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 96.7
2uur_A245 Collagen alpha-1(IX) chain; glycoprotein, hydroxyl 96.69
1a8d_A 452 Tetanus neurotoxin; clostridial, ganglioside bindi 96.67
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 96.64
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 96.64
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 96.64
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 96.61
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 96.61
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 96.59
2edn_A118 Myosin-binding protein C, fast-type; beta-sandwich 96.59
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 96.57
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 96.56
3s35_X122 Vascular endothelial growth factor receptor 2; ant 96.56
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 96.55
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 96.54
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 96.54
2qsq_A111 Carcinoembryonic antigen-related cell adhesion MO; 96.52
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 96.51
3so5_A112 LIG-3, leucine-rich repeats and immunoglobulin-lik 96.51
4b1m_A185 Levanase; hydrolase, CBM66; HET: FRU; 1.10A {Bacil 96.47
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 96.46
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 96.46
2eo1_A102 OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 96.45
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 96.43
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 96.43
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 96.34
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 96.32
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 96.3
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 96.28
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 96.28
2e6q_A112 Obscurin-like protein 1; IG-like domain, structura 96.26
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 96.23
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 96.23
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 96.17
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 96.11
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 96.08
1uct_A218 Immunoglobulin alpha FC receptor; beta stands, imm 96.04
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 96.02
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 96.01
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 96.0
2gi7_A184 GPVI protein; IG-like domains, blood clotting, cel 95.89
3p2t_A196 Leukocyte immunoglobulin-like receptor subfamily 4 95.87
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 95.84
1oll_A188 NK receptor; immune system/receptor, NK cell trigg 95.82
1gsm_A210 Madcam-1, mucosal addressin cell adhesion molecule 95.81
4fom_A308 Poliovirus receptor-related protein 3; immunoglobu 95.79
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 95.78
1ugn_A198 LIR1, leukocyte immunoglobulin-like receptor 1; im 95.78
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 95.77
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 95.76
4hwn_A108 FC receptor-like A; FCRLA, FCRL, IG-C2 domain, IG 95.73
3m45_A108 Cell adhesion molecule 2; IG fold, dimer, disulfid 95.72
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 95.72
2d3v_A196 Leukocyte immunoglobulin-like receptor subfamily A 95.71
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 95.71
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 95.69
1szb_A170 Mannose binding lectin-associated serine protease- 95.68
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 95.65
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 95.64
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 95.59
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 95.59
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 95.59
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 95.54
4gos_A125 V-SET domain-containing T-cell activation inhibit; 95.48
3p2t_A196 Leukocyte immunoglobulin-like receptor subfamily 4 95.45
1ugn_A198 LIR1, leukocyte immunoglobulin-like receptor 1; im 95.43
2vsd_A105 CHIR AB1; immune system receptor, FC receptor; HET 95.42
1jhl_L108 IGG1-kappa D11.15 FV (light chain); complex(antibo 95.42
2d3v_A196 Leukocyte immunoglobulin-like receptor subfamily A 95.41
2v9t_A117 Roundabout homolog 1; structural protein-receptor 95.35
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 95.33
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 95.32
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 95.29
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 95.24
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 95.24
3rbg_A124 Cytotoxic and regulatory T-cell molecule; IGV, crt 95.23
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 95.21
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 95.2
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 95.2
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 95.19
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 95.18
2gi7_A184 GPVI protein; IG-like domains, blood clotting, cel 95.17
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 95.16
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 95.16
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 95.14
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 95.13
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 95.12
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 95.1
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 95.08
1uct_A218 Immunoglobulin alpha FC receptor; beta stands, imm 95.05
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 95.03
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 95.01
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 94.95
1ob1_C99 Major merozoite surface protein; immune system, im 94.91
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 94.9
4frw_A218 Poliovirus receptor-related protein 4; immunoglobu 94.9
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 94.88
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 94.88
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 94.85
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 94.76
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 94.75
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 94.73
4fmk_A225 Poliovirus receptor-related protein 2; immunoglobu 94.69
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 94.68
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 94.68
1nkr_A201 P58-CL42 KIR; inhibitory receptor, natural killer 94.67
1z9m_A145 GAPA225; nectin-like, IG-like domain, V domain, ce 94.66
1ob1_C99 Major merozoite surface protein; immune system, im 94.61
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 94.61
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 94.58
1oll_A188 NK receptor; immune system/receptor, NK cell trigg 94.56
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 94.55
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 94.54
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 94.53
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 94.53
2oyp_A109 Hepatitis A virus cellular receptor 2; TIM-3, T-ce 94.53
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 94.52
4fa8_A203 Secreted protein BARF1; immunoglobulin-like domain 94.51
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 94.48
1szb_A170 Mannose binding lectin-associated serine protease- 94.45
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 94.44
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 94.43
1p6f_A242 NKP46, natural cytotoxicity triggering receptor 1; 94.39
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 94.38
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 94.38
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 94.37
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 94.35
4gjt_B123 Poliovirus receptor-related protein 4; six-bladed 94.32
3vh8_G316 Killer cell immunoglobulin-like receptor 3DL1; imm 94.28
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 94.23
2or8_A116 Hepatitis A virus cellular receptor 1 homolog; bet 94.22
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 94.21
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 94.2
3udw_C118 Poliovirus receptor; PVR tigit IGSF signal transdu 94.19
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 94.07
1qfw_M108 FV, antibody (anti beta subunit) (light chain); gl 94.07
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 94.07
1eaj_A126 Coxsackie virus and adenovirus receptor; virus/vir 94.06
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 94.06
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 94.01
1h5b_A113 Murine T cell receptor (TCR) valpha domain; immune 93.99
1mqk_L120 Antibody 7E2 FV fragment, light chain; membrane pr 93.96
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 93.94
3q0h_A117 T cell immunoreceptor with IG and ITIM domains; im 93.94
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 93.93
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 93.89
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 93.88
3khq_A133 B-cell antigen receptor complex-associated protei 93.86
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 93.85
1xt5_A135 Variable region-containing chitin-binding protein 93.8
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 93.79
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 93.74
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 93.71
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 93.71
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 93.7
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 93.69
1pko_A139 Myelin oligodendrocyte glycoprotein; IGV-domain, i 93.69
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 93.63
3v0a_B 1196 NTNH; botulinum neurotoxin, toxin, neurotoxin asso 93.59
2vol_A207 Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, 93.56
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 93.54
2yz1_A120 Tyrosine-protein phosphatase non-receptor type sub 93.52
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 93.51
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 93.51
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 93.51
2q20_A109 VK1 O18/O8 germline light chain variable domain; A 93.44
1b6u_A257 KIR2DL3, P58 killer cell inhibitory receptor; natu 93.44
2edo_A121 CD48 antigen; beta-sandwich, IG-fold, B-lymphocyte 93.44
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 93.43
3mj8_L213 Stimulatory hamster antibody HL4E10 FAB light CHA; 93.42
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 93.35
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 93.34
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 93.32
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 93.25
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 93.23
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 93.23
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 93.23
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 93.22
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 93.2
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 93.19
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 93.18
2rgs_A218 I, IG gamma-2B heavy chain; FC-fragment, immunoglo 93.02
2ywz_A111 NEW antigen receptor variable domain; IG VNAR, imm 93.01
2jju_A127 Signal regulatory protein beta-1; immunoglobulin d 93.0
2dru_A180 Chimera of CD48 antigen and T-cell surface antige; 93.0
4i0k_A222 CD276 antigen; immunoglobulin domain, glycoprotein 93.0
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 92.99
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 92.97
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 92.97
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 92.94
3tv3_L211 PGT128 light chain, IG lambda-2 chain C regions; F 92.91
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 92.9
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 92.84
2p1y_A238 Bispecific alpha/beta TCR; autoimmunity, immunoglo 92.84
2wng_A327 Tyrosine-protein phosphatase non-receptor type sub 92.8
3d9a_L213 Light chain of hyhel10 antibody fragment (FAB); ly 92.8
3vh8_G316 Killer cell immunoglobulin-like receptor 3DL1; imm 92.78
4fom_A308 Poliovirus receptor-related protein 3; immunoglobu 92.76
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 92.75
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 92.75
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 92.72
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 92.72
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 92.71
3nl4_L213 Antigen binding fragment, immunoglobulin IGG - LI; 92.71
2d9c_A136 Signal-regulatory protein beta-1; beta-sandwich, S 92.65
1p6f_A242 NKP46, natural cytotoxicity triggering receptor 1; 92.63
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 92.62
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 92.58
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 92.57
3r06_A213 Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; 92.56
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 92.55
1b6u_A257 KIR2DL3, P58 killer cell inhibitory receptor; natu 92.55
3mjg_X289 Beta-type platelet-derived growth factor receptor; 92.51
2fbo_J250 V1V2;, variable region-containing chitin-binding p 92.49
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 92.49
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 92.46
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 92.43
3eow_R221 Poliovirus receptor; immunoglobulin super family, 92.42
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 92.38
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 92.36
4i0k_A222 CD276 antigen; immunoglobulin domain, glycoprotein 92.36
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 92.36
2y38_A403 Laminin subunit alpha-5; structural protein, cell 92.33
4b1m_A185 Levanase; hydrolase, CBM66; HET: FRU; 1.10A {Bacil 92.31
1xiw_B79 T-cell surface glycoprotein CD3 delta chain; CD3-e 92.31
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 92.28
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 92.28
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 92.23
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 92.22
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 92.18
1olz_A663 Semaphorin 4D; developmental protein, CD100, beta- 92.13
1nqb_A256 Single-chain antibody fragment; multivalent antibo 92.09
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 92.01
1i1c_A239 IGG2A, IG gamma-2A chain C region; FC, immune syst 92.01
2znx_A242 SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s 91.99
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 91.98
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 91.97
4frw_A218 Poliovirus receptor-related protein 4; immunoglobu 91.93
1a8d_A452 Tetanus neurotoxin; clostridial, ganglioside bindi 91.93
3noi_A120 Natural cytotoxicity triggering receptor 3; immune 91.87
3bqu_C233 3H6 FAB light chain; beta sheet, immune system; 3. 91.85
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 91.85
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 91.83
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 91.82
3mjg_X289 Beta-type platelet-derived growth factor receptor; 91.82
3pv7_A248 B7-H6, IG-like domain-containing protein DKFZP686O 91.81
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 91.81
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 91.81
2p1y_A238 Bispecific alpha/beta TCR; autoimmunity, immunoglo 91.78
1c1e_H219 Catalytic antibody 1E9 (heavy chain); diels-alder, 91.78
2pet_A231 Lutheran blood group glycoprotein; immunoglobulin 91.78
2e26_A725 Reelin, reeler protein; signaling protein; HET: NA 91.78
3sob_L237 Antibody light chain; beta propeller, protein bind 91.77
2ghw_B247 Anti-SARS SCFV antibody, 80R; S protein, neutraliz 91.73
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 91.73
1lk3_L210 9D7 light chain; antigen-antibody complex, immune 91.65
3uzq_A253 Anti-dengue MAB 4E11; dengue antibody neutralizati 91.61
2zg1_A214 Sialic acid-binding IG-like lectin 5; siglec-5 inh 91.54
3ux9_B256 SCFV antibody; five helices, long loop connecting 91.53
2jjs_C127 Leukocyte surface antigen CD47; signal regulatory 91.45
2xzc_L216 FAB A.17 light chain; immune system; HET: XOP; 1.3 91.37
4fmk_A225 Poliovirus receptor-related protein 2; immunoglobu 91.34
3s96_B218 3B5H10 FAB light chain; huntingtin, immune system; 91.34
2ptt_A110 CD48 antigen; CD244, CD48, NK cell receptor, X-RAY 91.34
1nzi_A159 Complement C1S component; calcium, innate immunity 91.32
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 91.31
2jkb_A 686 Sialidase B; intramolecular trans-sialidase, lyase 91.27
2c1o_A254 IGK-C protein; FAB fragment, enantioselective, fin 91.26
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 91.25
1ncn_A110 T lymphocyte activation antigen CD86; IG V, beta s 91.23
1f3r_B257 FV antibody fragment; IG-fold, immuno complex, ant 91.15
3r0n_A128 Poliovirus receptor-related protein 2; IG-domain, 91.13
3tf7_C256 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; 91.12
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 91.12
3d9a_H210 Heavy chain of hyhel10 antibody fragment (FAB); ly 91.11
2or7_A115 T-cell immunoglobulin and mucin domain- containing 91.05
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 90.94
1moe_A240 Anti-CEA MAB T84.66; anti carcinoembryonic antigen 90.89
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 90.88
3bkj_L252 WO2 IGG2A FAB fragment light chain kappa; abeta, F 90.86
1nfd_E212 H57 FAB; complex (immunoreceptor-immunoglobulin), 90.84
2j6e_L234 IGM, FAB light chain; autoimmune complex human IGM 90.82
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 90.8
3pl6_D268 MBP peptide / T-cell receptor beta chain chimera; 90.65
3moq_A126 NEW antigen receptor variable domain, P3(40) PEPT 90.57
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 90.52
1q0x_L212 FAB 9B1, light chain; anti-morphine antibody, FAB 90.5
1i8k_A107 Epidermal growth factor receptor antibody MR1SCFV 90.48
2ghw_B247 Anti-SARS SCFV antibody, 80R; S protein, neutraliz 90.46
1neu_A124 Myelin P0 protein; structural protein, glycoprotei 90.45
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 90.41
2sli_A 679 Intramolecular trans-sialidase; hydrolase, neurami 90.4
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 90.37
1igt_B444 IGG2A intact antibody - MAB231; intact immunoglobu 90.31
1f3r_B257 FV antibody fragment; IG-fold, immuno complex, ant 90.25
3t5o_A 913 Complement component C6; macpf, MAC, membrane atta 90.2
2wqr_A323 IG epsilon chain C region; immune system, immunogl 90.15
1svz_A247 Immunoglobulin;, single-chain FV fragment 1696; an 90.14
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 90.13
2znx_A242 SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s 90.12
2w59_A231 IGY FCU3-4; immunoglobulin, avian, immune system; 90.1
3esu_F250 Antibody 14B7* light chain and antibody 14B7* heav 90.09
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
Probab=100.00  E-value=1.5e-65  Score=641.10  Aligned_cols=658  Identities=21%  Similarity=0.350  Sum_probs=380.5

Q ss_pred             CceeEEEcCCcceeeeeCCcccCCCcceeeeeCCCCCCCcCCC------CccCCCCccceEEEEEEcCEEEEeecccccc
Q psy9228          56 VERMMFVDGIGPFSGESQGAFQGLDLSELVYIGAVPDFGEIHP------SAGFSNGFKGCVSRLKYNKTEFELFKMAVER  129 (834)
Q Consensus        56 ~~g~~cvd~~~~~~~~~~~~~~g~~~~~~~~~gg~p~~~~~~~------~~~~~~gf~gCi~~~~~~~~~~~~~~~~~~~  129 (834)
                      +++.|.||+.....-+.+.....++....+||||+|.......      ......+|.|||+++.++++++.+++.....
T Consensus        94 ~~~~L~Vd~~~~~~~~~~~~~~~~~~~~~l~vGG~p~~~~~~~~~l~~~~v~~~~~F~Gci~~l~~~~~~~~l~~~~~~~  173 (1245)
T 3qcw_A           94 RNTTLFIDQVEAKWVEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVQSSLALPVDSGEVK  173 (1245)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             CeEEEEECCccceeeeecCCcccccccCceeeeeCChHHhcccccccCccccccCCcceEEEEEEECCcccccccccCcc
Confidence            5778899995443344444455567778999999997654221      1223479999999999999987776532211


Q ss_pred             ---cCCCCCCccCCCCCCCCCCCCEeccCCCCCceEeeCCCCCCCCCCCCCCCCccCCCCCC-CeeecCCCCeEEeCCC-
Q psy9228         130 ---VGVDSCNTCKSSKHNNCINNGLCQDAATRIGYTCICPPGFSGDRCSVLGEPCYPGACGD-GSCQDVDGAMKCLCPI-  204 (834)
Q Consensus       130 ---~~~~~c~~C~~~~~~pC~n~g~C~~~~~~~~~~C~C~~g~~G~~Ce~~~~~C~~~~C~~-g~C~~~~~~~~C~C~~-  204 (834)
                         .++.   .|.   .+||.                             ..++|..+||+| |+|+...++|.|.|+. 
T Consensus       174 ~~~~~~~---~~~---~~pC~-----------------------------~~~~~~~~~C~ngg~C~~~~~~~~C~C~~~  218 (1245)
T 3qcw_A          174 LDDEPPN---SGG---GSPCE-----------------------------AGEEGEGGVCLNGGVCSVVDDQAVCDCSRT  218 (1245)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             ccccccc---ccC---CCCcC-----------------------------CcccCCCCCCCCCCCCccCCCCceeECCCC
Confidence               1111   111   22222                             112455555554 3555555556666664 


Q ss_pred             CcccCcccccccccccCCCCcceEEcCCCCCc---ceEEEEEEEcccCCCceEEEeecccCCCCCCeEEEEEecCeEEEE
Q psy9228         205 GTAGKRCEQKIKILQPAFKHGSYLAYPTPKTM---RKFKVSLRLNPRDVRDGIILYSGQSDDGLGDFISLAIREKHMEFR  281 (834)
Q Consensus       205 g~~G~~Ce~~~~~~~~~F~g~~y~~~~~~~~~---~~~~i~l~f~t~~~~~glll~~~~~~~~~~d~~~l~l~~G~v~~~  281 (834)
                      ||.|+.||+......+.|+|.+|+.|+.+...   ....|+|.|||. .++|||||.+..    .||++|+|++|+++++
T Consensus       219 g~~G~~Ce~~~~~~~~~F~G~~~~~y~~~~~~~~~~~~~i~l~FrT~-~~~GlLl~~g~~----~d~l~L~L~~G~l~l~  293 (1245)
T 3qcw_A          219 GFRGKDCSQGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTL-QRNGLMLHTGKS----ADYVNLALKNGAVSLV  293 (1245)
T ss_dssp             ------------CCEEEECSSCEEEEECTTSCEEESEEEEEEEEECS-CSCEEEEEECSS----SEEEEEEEETTEEEEE
T ss_pred             CccCCccccCcccceeeeCCcEEEEEccccCcccccccEEEEEEEeC-CCCceEEEecCC----CCEEEEEEECCEEEEE
Confidence            66666666544446789999999999876433   457899999999 699999999743    6999999999999999


Q ss_pred             EecCCCcc--eecC--CCCCccccc-ceeccCCCeEEEEecCCCCC----CceeeeeecCCCceeccccccccccccccc
Q psy9228         282 FDTGSATP--LYSN--DAPAFNPVS-TKEAPYGSKITLTCNNDLEA----PVEYTWSKRSNGHVLPFGAFSRENTLTLQE  352 (834)
Q Consensus       282 ~~~g~~~~--~~~~--~~~~~~~~~-~~~~~~~~~v~l~vd~~~~~----~~~~~~~~~~~~~~~~~gg~~~~~~~~~~~  352 (834)
                      +++|++..  +...  .......|| +.+.|.+++++|+||.....    +..+..  ......+++||+|......   
T Consensus       294 ~~lG~g~~~~~~~~~~~~l~Dg~WH~V~v~r~~~~~~l~VD~~~~~~~~~~~~~~~--l~~~~~l~vGG~p~~~~~~---  368 (1245)
T 3qcw_A          294 INLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTM--LGSDDFFYVGGSPSTADLP---  368 (1245)
T ss_dssp             EEESSCCEEEEECCCSSCSSSSSCEEEEEEEETTEEEEEESSSCCEEEECSSSCCC--EEECSEEEESCCSSTTTST---
T ss_pred             EEcCCCeEEEEEccCCcccCCCCEEEEEEEEeCCEEEEEECCcceeeeecCCCccc--ccCCCCEEECCcCChhhcc---
Confidence            99998862  2222  233344455 55678899999999975421    111111  1123458899988543211   


Q ss_pred             cccCCCceEEEEeCCC----Ccee--------EeeEEe-------e---eeccccccCCCcccccccCCccccceeEEEE
Q psy9228         353 IKNSDAGMYVCKVSNK----DMTV--------EIPSIL-------L---VTDSVPLFTQKPLSYLALPTLTDAHLHFSIE  410 (834)
Q Consensus       353 ~~~~~~~~~~C~~~~~----~~~~--------~~~~~~-------~---~~~~~~~f~~~~~s~l~~~~~~~~~~~~~i~  410 (834)
                      ......++.+|+.+..    .+..        ..+...       .   .....|..|..+.||+.+|.+.. ...++|+
T Consensus       369 ~~~~~~~F~GCi~~l~~n~~~i~l~~~~~~~~~~~~~~~~g~~~~~C~~~~~~~~vsF~~~~syl~lp~~~~-~~~~~is  447 (1245)
T 3qcw_A          369 GSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNA-KKTGSIS  447 (1245)
T ss_dssp             TCCCCCCCCEEEEEEEEEESSCEECHHHHHHSCCTTEEEESSCCCCCSCCCCCCCEEECSTTCCEEECCCCC-SSEEEEE
T ss_pred             CCccCCCceeEeeeeEECCccccccchhhhhcCCCccccCCceeecccCCCccccceeCCCCeEEEecCCCc-cCceEEE
Confidence            1122346778876521    1000        000000       0   01123566677889999998864 4578999


Q ss_pred             EEEeeCCCCeeEEEeccCCc------cccCCCCCeEEEEEECcEEEEEEeccc--EEEE-eeeeecCCCeEEEEEEEECC
Q psy9228         411 LSFKPTDYNGLIMYTGDSNM------KSYKGKGDFVSFGLEDGYPVFRFDVGL--VVLR-SKVTLVPHEWVVVTIIKDFK  481 (834)
Q Consensus       411 ~~frt~~~~GlLl~~~~~~~------~~~~~~~d~~~l~L~~G~l~~~~~~G~--~~i~-s~~~~~dg~wH~V~v~~~~~  481 (834)
                      |+|||.+++|||||......      .......||++|+|.+|+++++++.|.  ..+. +..+++||+||+|.+.|..+
T Consensus       448 ~~FrT~~~~GlLly~~~~~~~~~~~~~~~~~~~df~~LeL~~G~l~l~~~~G~g~~~l~~s~~~vnDG~WH~V~l~r~~~  527 (1245)
T 3qcw_A          448 FDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGR  527 (1245)
T ss_dssp             EEEECCCSCEEEEEEECCCCSSCCSSCTTSCCCCEEEEEEETTEEEEEEESSSCEEEEESCSSCCCSSCCEEEEEEEETT
T ss_pred             EEEEeCCCCeEEEEecCccccccccccccccCCCEEEEEEeCCeEEEEEECCCCeEEEeecccEecCCCEEEEEEEEecC
Confidence            99999999999999864321      011245799999999999999999984  4444 56789999999999999999


Q ss_pred             eEEEEECCeeeeeeecCCCccccccCCCceeeccccCCCcccCcC-----cccccCceeEEeeeEEcCeeeeecccc--c
Q psy9228         482 EGKLSVGGEPLIVGSTPGEKLQVLNLRTPLYLGGYNIYHVTPSLS-----VEVTEGFHGCISTIDVLGSELDLINSA--V  554 (834)
Q Consensus       482 ~~~l~VD~~~~~~~~~~g~~~~~l~~~~~l~iGG~~~~~~~~~~~-----~~~~~gF~GCi~~v~ing~~~~~~~~~--~  554 (834)
                      .++|.||+..... ..++. ...|++..++||||+|........+     .....+|.|||++|.||++.+++....  .
T Consensus       528 ~~~L~VD~~~~~~-~~~~~-~~~l~~~~~lylGG~p~~~~~~~~p~~~~~~~~~~gF~GCir~l~ing~~~dl~~~~~~~  605 (1245)
T 3qcw_A          528 SGTISVNTLRTPY-TAPGE-SEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEVQ  605 (1245)
T ss_dssp             EEEEEETTEEEEE-ECSSS-CCCCCCCSCEEESSCCSSCTTCCCCTTCHHHHTTCBCCEEEEEEEETTEEECHHHHTTTT
T ss_pred             EEEEEEccccccc-ccCCC-cceeccCCceEEcccccccccccccccccccccccCceEEEEEEEECCEEcCchhhhhhh
Confidence            9999999976543 44555 6778899999999999853211111     123579999999999999999986532  1


Q ss_pred             ccCCc-ccCCCCCCCCCCCCCCCCCCCeecccCCCCCceeeecCCCCCCCCCccCccCCCCCCccCCCceeeecCCCcEE
Q psy9228         555 DSANI-MDCSDLESSPVCAPKPCQNYGICYPTDTSERGYNCSCLTGYSGDHCEKENNMCMKGDVCKNGGMCKVTPDSYEC  633 (834)
Q Consensus       555 ~~~~~-~~C~~~~~~~~C~~~pC~ngg~C~~~~~~~~~~~C~C~~G~~G~~Ce~~~~~C~~~~pC~ngg~C~~~~~~~~C  633 (834)
                      ...++ .+|...                                          ..+.|.++ ||+|+|+|.+.+.+|.|
T Consensus       606 ~~~gv~~gC~~~------------------------------------------~~~~C~~~-pC~ngg~C~~~~~~~~C  642 (1245)
T 3qcw_A          606 STAGVKPSCSRE------------------------------------------TAKPCLSN-PCKNNGMCRDGWNRYVC  642 (1245)
T ss_dssp             TCTTEESSCCCC------------------------------------------SSCGGGSC-CCCTTCEEEECSSSEEE
T ss_pred             cccccccccccc------------------------------------------CCCCCCcc-CCCCCCEEeCCCCCeEE
Confidence            12222 244310                                          11345555 77777777777777777


Q ss_pred             cCC-CCCCCCCcccccccceeeEEcCCceeeechhhhhhccCcceEEEEEEeCCCCeeEEecCCCCCCCCCCcceEEEEE
Q psy9228         634 LCS-LGYAPPNCAKRVSIGSEVHFLGEGYVELKKELIEERRNEETIAFDFVTDDKNALLLWNGQPSYKNGIGREFIAVAV  712 (834)
Q Consensus       634 ~C~-~g~~G~~Ce~~~~~~~~~~F~g~s~~~~~~~~~~~~~~~~~i~~~frT~~~~GlLl~~~~~~~~~~~~~~~~~l~l  712 (834)
                      .|+ +||+|+.|+.+.   ..+.|+|.+|+.+...... ......|+|+|||..++|+|||++...     ..||++|+|
T Consensus       643 ~C~~~g~~G~~C~~~~---~~~~fdGs~~l~~~~~~~~-~~~~~~isl~FrT~~~~GlLl~~~~~~-----~~d~l~L~L  713 (1245)
T 3qcw_A          643 DCSGTGYLGRSCEREA---TVLSYDGSMFMKIQLPVVM-HTEAEDVSLRFRSQRAYGILMATTSRD-----SADTLRLEL  713 (1245)
T ss_dssp             ECTTTTEESTTSCEEC---CEEEEESSCCEEEEEEEEE-EESEEEEEEEEECSSSCEEEEEEEBTT-----BSCEEEEEE
T ss_pred             ECCCCCcccccCcccc---cccccCCCCceEEeccccc-ccccceEEEEEEEcCCCEEEEEecCCC-----CccEEEEEE
Confidence            777 577777777653   2468999999876432221 135678999999999999999986532     368999999


Q ss_pred             ECCEEEEEEEcCCcEEEEEeCCceecCCCcEEEEEEEECCEEEEEEcCeeeecccCCCCccceecCCceEEcCcCCCCCC
Q psy9228         713 VNGYLEYSYDLGDGVVTIKFSKKPVNDGIKHSVNVTRINKFGSLEVDSVIVGKGESPGSQDVINTRGNIYLGGTPNMDLM  792 (834)
Q Consensus       713 ~~G~l~~~~~~g~~~~~l~~s~~~~nDg~wH~V~i~r~~~~~~l~VD~~~~~~~~~~~~~~~l~~~~~lyiGG~p~~~~~  792 (834)
                      .+|+|++++++|.++..+. +..+++||+||+|.+.|.++.++|+||+........++....++.. .+|+|+++.....
T Consensus       714 ~~G~l~l~~nlg~g~~~~~-~~~~~~DG~WH~V~v~r~~~~~~l~vD~~~~~~g~~~g~~~~l~~~-~~~~G~~~~~~~~  791 (1245)
T 3qcw_A          714 DAGRVKLTVNLGKGPETLF-AGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFH-NIETGIITERRYL  791 (1245)
T ss_dssp             ETTEEEEEEESSSSEEEEE-ECSCCCSSSCEEEEEEEETTEEEEEETTSCCEEEECSSSCCCEEEE-EEEESSCCCCTTC
T ss_pred             eCCEEEEEEECCCCceEEE-eCccccCCCcEEEEEEEeCCEEEEEECCccceeEecCCCcceeecc-ccccccccccccc
Confidence            9999999999999888776 6788999999999999999999999999877666666655555443 4788988754222


Q ss_pred             CCCccCCCceEEEEEEEECCceecc
Q psy9228         793 TGGRYVHPMSGLMMNIHIQNKHISN  817 (834)
Q Consensus       793 ~~~~~~~~F~GCi~~v~in~~~~~~  817 (834)
                        .....+|+|||++|++|+..+++
T Consensus       792 --~~~~~~F~GCl~~v~~ng~~~~~  814 (1245)
T 3qcw_A          792 --SSVPSNFIGHLQSLTFNGMAYID  814 (1245)
T ss_dssp             --SCCCCCCEEEEEEEEETTEEHHH
T ss_pred             --CCCCCCCEEEeeeEEECCEEchh
Confidence              12345899999999999976544



>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Back     alignment and structure
>1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Back     alignment and structure
>1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Back     alignment and structure
>3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A Back     alignment and structure
>1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A Back     alignment and structure
>2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Back     alignment and structure
>3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Back     alignment and structure
>1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Back     alignment and structure
>3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} Back     alignment and structure
>1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* Back     alignment and structure
>1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Back     alignment and structure
>2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Back     alignment and structure
>3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* Back     alignment and structure
>1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* Back     alignment and structure
>2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* Back     alignment and structure
>2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* Back     alignment and structure
>3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Back     alignment and structure
>1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A Back     alignment and structure
>3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} Back     alignment and structure
>3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A Back     alignment and structure
>1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* Back     alignment and structure
>1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* Back     alignment and structure
>2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} Back     alignment and structure
>3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* Back     alignment and structure
>2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Back     alignment and structure
>2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* Back     alignment and structure
>2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3flp_A SAP-like pentraxin; physiological doubly-stacked heptamer, pentraxin fold, cyclic heptamer, invertebrate lectin, sugar binding protein; 2.30A {Limulus polyphemus} PDB: 3flr_A 3flt_A Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>3kqr_A Serum amyloid P-component; glycoprotein, disulfide bond, lectin, metal-binding secreted; HET: NAG; 1.50A {Homo sapiens} SCOP: b.29.1.5 PDB: 1lgn_A* 1gyk_A 2a3w_A* 2a3x_A* 2a3y_A* 1sac_A* 3d5o_A* 2w08_A* Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>3pvn_A C-reactive protein; pentraxin family, immune system; 1.98A {Homo sapiens} SCOP: b.29.1.5 PDB: 1gnh_A 1lj7_A 3l2y_A 1b09_A 3pvo_A Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>2erf_A Thrombospondin-1; TSP-1, N-terminal TSPN, HBD, sugar binding protein; 1.45A {Homo sapiens} SCOP: b.29.1.4 PDB: 2es3_A 1z78_A Back     alignment and structure
>1za4_A Thrombospondin 1; TSP-1, NTSP-1, HBD, arixtra, cell adhesion; HET: SGN; 1.90A {Homo sapiens} SCOP: b.29.1.4 PDB: 2ouh_A 2ouj_A Back     alignment and structure
>2v73_A CBM40, putative EXO-alpha-sialidase; carbohydrate-binding module, bacterial pathogen, sialic acid, sugar-binding protein; HET: SIA; 2.2A {Clostridium perfringens} Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>2uur_A Collagen alpha-1(IX) chain; glycoprotein, hydroxylation, structural protein, NC4, collagen IX, polymorphism, extracellular matrix; 1.8A {Homo sapiens} Back     alignment and structure
>4dqa_A Uncharacterized protein; two domains structure, DUF 1735, laminin_G_3 concanavalin A- lectin/glucanases superfamily domain; HET: MSE; 1.50A {Bacteroides ovatus} Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>3flp_A SAP-like pentraxin; physiological doubly-stacked heptamer, pentraxin fold, cyclic heptamer, invertebrate lectin, sugar binding protein; 2.30A {Limulus polyphemus} PDB: 3flr_A 3flt_A Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3kqr_A Serum amyloid P-component; glycoprotein, disulfide bond, lectin, metal-binding secreted; HET: NAG; 1.50A {Homo sapiens} SCOP: b.29.1.5 PDB: 1lgn_A* 1gyk_A 2a3w_A* 2a3x_A* 2a3y_A* 1sac_A* 3d5o_A* 2w08_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3pvn_A C-reactive protein; pentraxin family, immune system; 1.98A {Homo sapiens} SCOP: b.29.1.5 PDB: 1gnh_A 1lj7_A 3l2y_A 1b09_A 3pvo_A Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>3r08_E T-cell surface glycoprotein CD3 epsilon chain; antibody, T-cell receptor, signalling, immune SY; 4.10A {Cricetulus migratorius} Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>2v73_A CBM40, putative EXO-alpha-sialidase; carbohydrate-binding module, bacterial pathogen, sialic acid, sugar-binding protein; HET: SIA; 2.2A {Clostridium perfringens} Back     alignment and structure
>2lu7_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>1xau_A B- and T-lymphocyte attenuator; IG domain, beta sandwich, structural genomics, PSI, protein structure initiative; 1.80A {Mus musculus} SCOP: b.1.1.4 Back     alignment and structure
>2erf_A Thrombospondin-1; TSP-1, N-terminal TSPN, HBD, sugar binding protein; 1.45A {Homo sapiens} SCOP: b.29.1.4 PDB: 2es3_A 1z78_A Back     alignment and structure
>2lvc_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>3knb_B Obscurin-like protein 1; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2wp3_O* 2wwm_C 2wwk_O Back     alignment and structure
>1za4_A Thrombospondin 1; TSP-1, NTSP-1, HBD, arixtra, cell adhesion; HET: SGN; 1.90A {Homo sapiens} SCOP: b.29.1.4 PDB: 2ouh_A 2ouj_A Back     alignment and structure
>4hwu_A Fibroblast growth factor receptor 2; FGFR2, KGFR, CD332, IG-C2 type 1 domain, IG superfamily, IMM system, structural genomics, PSI-biology; 2.90A {Mus musculus} Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Back     alignment and structure
>2jkb_A Sialidase B; intramolecular trans-sialidase, lyase, glycosidase, neuraminidase; HET: SKD; 1.54A {Streptococcus pneumoniae} PDB: 2vw2_A* 2vw1_A* 2vw0_A* Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3knb_A Titin; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 3q5o_A 2wp3_T* 2wwk_T 2wwm_D 2y9r_T* Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2sli_A Intramolecular trans-sialidase; hydrolase, neuraminidase; HET: SKD; 1.80A {Macrobdella decora} SCOP: b.29.1.9 b.68.1.1 PDB: 1sll_A 1sli_A* 3sli_A* 4sli_A* Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} SCOP: b.1.1.0 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Back     alignment and structure
>2aw2_A B and T lymphocyte attenuator; IGI domain, IGG domain, TNFRSF, protein-protein complex, IMM system; HET: NAG FUL; 2.80A {Homo sapiens} SCOP: b.1.1.1 Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Back     alignment and structure
>4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Back     alignment and structure
>4dqa_A Uncharacterized protein; two domains structure, DUF 1735, laminin_G_3 concanavalin A- lectin/glucanases superfamily domain; HET: MSE; 1.50A {Bacteroides ovatus} Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2uur_A Collagen alpha-1(IX) chain; glycoprotein, hydroxylation, structural protein, NC4, collagen IX, polymorphism, extracellular matrix; 1.8A {Homo sapiens} Back     alignment and structure
>1a8d_A Tetanus neurotoxin; clostridial, ganglioside binding region; 1.57A {Clostridium tetani} SCOP: b.29.1.6 b.42.4.2 PDB: 1af9_A 1fv3_A* 1fv2_A* 3hmy_A* 3hn1_A* 1d0h_A* 1dfq_A* 1dll_A* 1yxw_A* 1yyn_A* 1diw_A* Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>2qsq_A Carcinoembryonic antigen-related cell adhesion MO; glycoprotein, GPI-anchor, immunoglobulin DOMA lipoprotein, membrane; 1.95A {Homo sapiens} PDB: 2qst_A 2ver_N* 2gk2_A Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Back     alignment and structure
>4b1m_A Levanase; hydrolase, CBM66; HET: FRU; 1.10A {Bacillus subtilis} PDB: 4b1l_A* 4azz_A Back     alignment and structure
>2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2e6q_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Back     alignment and structure
>1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* Back     alignment and structure
>4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Back     alignment and structure
>1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>4hwn_A FC receptor-like A; FCRLA, FCRL, IG-C2 domain, IG superfamily, immune system, ST genomics, PSI-biology; 2.01A {Homo sapiens} Back     alignment and structure
>3m45_A Cell adhesion molecule 2; IG fold, dimer, disulfide bond, glycoprotein, immunoglobulin membrane, transmembrane; HET: NAG; 2.21A {Mus musculus} Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Back     alignment and structure
>4gos_A V-SET domain-containing T-cell activation inhibit; immunoglobulin domain, glycoprotein, disulfide bond, immunit adaptive immunity; HET: NAG BMA MAN; 1.59A {Homo sapiens} Back     alignment and structure
>3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Back     alignment and structure
>1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Back     alignment and structure
>2vsd_A CHIR AB1; immune system receptor, FC receptor; HET: NAG NDG MAN; 1.82A {Gallus gallus} Back     alignment and structure
>1jhl_L IGG1-kappa D11.15 FV (light chain); complex(antibody-antigen); 2.40A {Mus musculus} SCOP: b.1.1.1 Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Back     alignment and structure
>4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Back     alignment and structure
>1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A Back     alignment and structure
>1z9m_A GAPA225; nectin-like, IG-like domain, V domain, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Back     alignment and structure
>2oyp_A Hepatitis A virus cellular receptor 2; TIM-3, T-cell immunoglobulin mucin, signaling protein; 1.95A {Mus musculus} PDB: 3kaa_A* Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Back     alignment and structure
>1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Back     alignment and structure
>4gjt_B Poliovirus receptor-related protein 4; six-bladed -propeller, IGV-like fold, viral entry, MV-H, NEC BETA4/BETA5 groove; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>2or8_A Hepatitis A virus cellular receptor 1 homolog; beta barrel, immunoglobulin fold, IGV domain, TIM, immune system; 2.50A {Mus musculus} Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Back     alignment and structure
>3udw_C Poliovirus receptor; PVR tigit IGSF signal transduction immunology, IGSF, cell SU receptor signalling, glycosylation, membrane protein; HET: NAG; 2.90A {Homo sapiens} Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Back     alignment and structure
>1qfw_M FV, antibody (anti beta subunit) (light chain); glycoprotein hormone; HET: NAG; 3.50A {Mus musculus} SCOP: b.1.1.1 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>1eaj_A Coxsackie virus and adenovirus receptor; virus/viral protein receptor, immunoglobulin V domain fold, symmetric dimer; 1.35A {Homo sapiens} SCOP: b.1.1.1 PDB: 1f5w_A 2j12_B 2j1k_A 2wbw_B* 2w9l_A* 1rsf_A 1jew_R 1kac_B 1p69_B 1p6a_B Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Back     alignment and structure
>1h5b_A Murine T cell receptor (TCR) valpha domain; immune response, immunoglobulin fold; 1.85A {Mus musculus} SCOP: b.1.1.1 PDB: 1h5b_C 1h5b_B Back     alignment and structure
>1mqk_L Antibody 7E2 FV fragment, light chain; membrane protein, cytochrome C oxidase, high- resolution structure, immune system; 1.28A {Mus musculus} SCOP: b.1.1.1 PDB: 1ar1_D 3ehb_D* 3hb3_D* 1qle_L* 1f6l_L 3iy2_A 1vfa_A 1dvf_A 1kir_A 1g7i_A 1g7j_A 1a2y_A 1kip_A 1kiq_A 1vfb_A 1g7h_A 1a7o_L 1g7l_A 1g7m_A 1a7n_L ... Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>3q0h_A T cell immunoreceptor with IG and ITIM domains; immune receptor, adhesion, structural genomics, NEW YORK STR genomics research consortium, nysgrc; 1.70A {Homo sapiens} PDB: 3rq3_A 3udw_A* 3ucr_A Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>3khq_A B-cell antigen receptor complex-associated protei chain; CD79B, CD79A, IG-beta, BCR, IG domain, V-SET, immunoglobulin protein binding; HET: FLC GSH; 1.70A {Mus musculus} PDB: 3kho_A* Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Back     alignment and structure
>1xt5_A Variable region-containing chitin-binding protein 3; innate immunity, VCBP, primordial antigen receptor, florida lancelet, amphioxus; 1.15A {Branchiostoma floridae} Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Back     alignment and structure
>1pko_A Myelin oligodendrocyte glycoprotein; IGV-domain, immune system; 1.45A {Rattus norvegicus} SCOP: b.1.1.1 PDB: 1pkq_E 3csp_A 1py9_A Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>3v0a_B NTNH; botulinum neurotoxin, toxin, neurotoxin associated protein, progenitor toxin complex, VHH bound interlocked complex; HET: MES; 2.70A {Clostridium botulinum} PDB: 3v0b_B Back     alignment and structure
>2vol_A Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, cytoplasm, mouse IGG, zinc-finger, DNA-binding, RNA-binding, tripartite motif (TRIM) protein; HET: NAG MAN GAL FUC; 1.95A {Mus musculus} PDB: 3hkf_A 1i1a_C* 1cqk_A Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>2yz1_A Tyrosine-protein phosphatase non-receptor type substrate 1; beta-sandwich, structural genomics, NPPSFA; 1.40A {Mus musculus} Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Back     alignment and structure
>2q20_A VK1 O18/O8 germline light chain variable domain; Al, light chain amyloidosis, amyloid, immunoglobulin, protein fibril; 1.30A {Homo sapiens} PDB: 2kqm_A 3cdf_A 3cdc_A 2kqn_A 3cdy_A 2q1e_A 3dvi_A 1igm_L 1bww_A 1b0w_A 1bre_A 1qp1_A 3dvf_A 1rei_A 1wtl_A 1ar2_A 1fgv_L 2bx5_A 2uzi_L* 1bvk_A ... Back     alignment and structure
>1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2edo_A CD48 antigen; beta-sandwich, IG-fold, B-lymphocyte activation marker blast-1, BCM1 surface antigen, leukocyte antigen MEM-102, TCT.1; NMR {Homo sapiens} Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>2rgs_A I, IG gamma-2B heavy chain; FC-fragment, immunoglobulin, glycosylation, immune system; HET: NAG FUC MAN GAL; 2.13A {Mus musculus} Back     alignment and structure
>2ywz_A NEW antigen receptor variable domain; IG VNAR, immune system; 2.21A {Orectolobus maculatus} PDB: 2ywy_A Back     alignment and structure
>2jju_A Signal regulatory protein beta-1; immunoglobulin domain, immunoglobulin superfamily, immune system, transmembrane, paired receptor; 1.19A {Homo sapiens} PDB: 2jjv_A 2uv3_A* 2jjt_A* 2jjs_A* 2jjw_A Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Back     alignment and structure
>4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Back     alignment and structure
>3tv3_L PGT128 light chain, IG lambda-2 chain C regions; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_L* 3twc_L* 3tnm_L 2mcg_1 1mcw_M 1a8j_L 3mcg_1 1dcl_A 1mcb_A* 1mcc_A* 1mcd_A* 1mce_A* 1mcf_A* 1mch_A 1mci_A* 1mcj_A* 1mck_A 1mcl_A* 1mcn_A* 1mcq_A ... Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
>2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Back     alignment and structure
>3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Back     alignment and structure
>4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Back     alignment and structure
>2d9c_A Signal-regulatory protein beta-1; beta-sandwich, SIRP-beta-1, CD172B antigen, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>3r06_A Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; anti-CD3epsilon, T-cell receptor, signalling, IMMU; 2.50A {Cricetulus migratorius} PDB: 3r08_L 3ld8_B 3ldb_B* Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>4b1m_A Levanase; hydrolase, CBM66; HET: FRU; 1.10A {Bacillus subtilis} PDB: 4b1l_A* 4azz_A Back     alignment and structure
>1xiw_B T-cell surface glycoprotein CD3 delta chain; CD3-epsilon, CD3-delta, UCHT1-SCFV, immunoglobulin fold, antibody-antigen complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Back     alignment and structure
>1olz_A Semaphorin 4D; developmental protein, CD100, beta-propeller, PSI domain, IG-like domain, extracellular receptor, neurogenesis; 2.0A {Homo sapiens} SCOP: b.1.1.4 b.69.12.1 g.16.2.1 PDB: 3ol2_A* Back     alignment and structure
>1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Back     alignment and structure
>1i1c_A IGG2A, IG gamma-2A chain C region; FC, immune system; HET: NAG FUL BMA MAN FUC; 2.70A {Rattus norvegicus} SCOP: b.1.1.2 b.1.1.2 PDB: 1i1a_D* Back     alignment and structure
>2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* Back     alignment and structure
>4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} Back     alignment and structure
>1a8d_A Tetanus neurotoxin; clostridial, ganglioside binding region; 1.57A {Clostridium tetani} SCOP: b.29.1.6 b.42.4.2 PDB: 1af9_A 1fv3_A* 1fv2_A* 3hmy_A* 3hn1_A* 1d0h_A* 1dfq_A* 1dll_A* 1yxw_A* 1yyn_A* 1diw_A* Back     alignment and structure
>3noi_A Natural cytotoxicity triggering receptor 3; immune system, innate immunity, immunoglobulin-like I2 type natural killer cell activation; HET: 1PG; 1.84A {Homo sapiens} PDB: 3pv6_B* Back     alignment and structure
>3bqu_C 3H6 FAB light chain; beta sheet, immune system; 3.00A {Mus musculus} Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A Back     alignment and structure
>1c1e_H Catalytic antibody 1E9 (heavy chain); diels-alder, immunoglobulin, immune system; HET: ENH; 1.90A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1dbb_H* 1dba_H* 1dbj_H* 1dbk_H* 1dbm_H* 2dbl_H* 3ojd_B 1jgl_H* 1jhk_H 1ghf_H 1tet_H* 3e8u_H 1fj1_B 1cl7_H Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>3sob_L Antibody light chain; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_A 3u1s_L* Back     alignment and structure
>2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Back     alignment and structure
>1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* Back     alignment and structure
>3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A Back     alignment and structure
>2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A Back     alignment and structure
>3ux9_B SCFV antibody; five helices, long loop connecting helix, hydrophobic intera cytokine-immune system complex; 2.80A {Homo sapiens} Back     alignment and structure
>2jjs_C Leukocyte surface antigen CD47; signal regulatory protein alpha, immunoglobulin superfamily, transmembrane, phosphoprotein, paired receptor; HET: NAG; 1.85A {Homo sapiens} PDB: 2jjt_C* 2vsc_A* Back     alignment and structure
>2xzc_L FAB A.17 light chain; immune system; HET: XOP; 1.36A {Homo sapiens} PDB: 2xza_L* 3kdm_L* 3nps_C 1dn0_A 1qlr_A* 2v7n_A 3eo0_A 3eo1_A 2agj_L* 2fx7_L 1tzg_L 2fx8_L 2fx9_L* 1u6a_L 3hi1_L* 3kym_A 3kyk_L 3qwo_L* 3ixt_L* 3qeg_L ... Back     alignment and structure
>4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* Back     alignment and structure
>3s96_B 3B5H10 FAB light chain; huntingtin, immune system; 1.90A {Mus musculus} PDB: 2qhr_L 3ffd_B 4dcq_A Back     alignment and structure
>2ptt_A CD48 antigen; CD244, CD48, NK cell receptor, X-RAY, immune system; 1.63A {Mus musculus} PDB: 2ptv_A Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Back     alignment and structure
>2jkb_A Sialidase B; intramolecular trans-sialidase, lyase, glycosidase, neuraminidase; HET: SKD; 1.54A {Streptococcus pneumoniae} PDB: 2vw2_A* 2vw1_A* 2vw0_A* Back     alignment and structure
>2c1o_A IGK-C protein; FAB fragment, enantioselective, finrozole, immune system, antibody, ENA11His antibody, immunoglobulin domain; 2.75A {Mus musculus} Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure
>1ncn_A T lymphocyte activation antigen CD86; IG V, beta strands, immune system; 2.70A {Homo sapiens} SCOP: b.1.1.1 PDB: 1i85_A Back     alignment and structure
>1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>3r0n_A Poliovirus receptor-related protein 2; IG-domain, cell-adhesion molecule, virus entry receptor, STR genomics, PSI-biology; 1.30A {Homo sapiens} PDB: 4dfh_A 4dfi_A Back     alignment and structure
>3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Back     alignment and structure
>3d9a_H Heavy chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_H 1gpo_H 3ks0_H* 1dqd_H 1ndm_B 1nak_H 1dqq_B 1dqm_H 1dqj_B 1nby_B 1nbz_B 1xgu_B 1ndg_B 1xgt_B 1xgp_B 1xgq_B 1xgr_B 1s5i_H 1f8t_H 1f90_H ... Back     alignment and structure
>2or7_A T-cell immunoglobulin and mucin domain- containing protein 2; beta barrel, immunoglobulin fold, IGV domain, TIM, immune system; 1.50A {Mus musculus} Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Back     alignment and structure
>1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Back     alignment and structure
>3bkj_L WO2 IGG2A FAB fragment light chain kappa; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} PDB: 3bkc_L 3bkm_L 2zuq_B* 1h3p_L Back     alignment and structure
>1nfd_E H57 FAB; complex (immunoreceptor-immunoglobulin), complex (immunorece immunoglobulin) complex; HET: NAG NDG; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>2j6e_L IGM, FAB light chain; autoimmune complex human IGM rheumatoid factor IGG1-FC, immunoglobulin C region, membrane, glycoprotein, transmembrane; HET: NAG FUL BMA MAN NDG GAL; 3.0A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>3pl6_D MBP peptide / T-cell receptor beta chain chimera; TCR-MHC complex, immunoglobulin fold, immune receptor, membr immune system; HET: NAG; 2.55A {Homo sapiens} Back     alignment and structure
>3moq_A NEW antigen receptor variable domain, P3(40) PEPT amyloid beta A4 protein; AB-ignar, AB-12Y-2, glycoprotein, membran protease inhibitor; 2.05A {Orectolobus maculatus} PDB: 2z8w_C 2z8v_C 1ves_A 1ver_A Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Back     alignment and structure
>1q0x_L FAB 9B1, light chain; anti-morphine antibody, FAB fragment, immune system; HET: PG4; 1.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q0y_L* 1ngp_L* 1ngq_L 3ks0_L* 1gig_L 2vir_A 2vis_A* 2vit_A 1sm3_L 4a6y_L 1ind_L* 1ine_L* 1yuh_L* 2zpk_L 3rhw_K* 3ri5_K* 3ria_K* 3rif_K* 1mfe_L* 1mfb_L* ... Back     alignment and structure
>1i8k_A Epidermal growth factor receptor antibody MR1SCFV light chain; antibody-peptide complex, immunoglobulin fold, type II' beta turn., immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 PDB: 1i8i_A Back     alignment and structure
>2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>1neu_A Myelin P0 protein; structural protein, glycoprotein, transmembrane, phosphorylation, immunoglobulin fold, signal; 1.90A {Rattus norvegicus} SCOP: b.1.1.1 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>2sli_A Intramolecular trans-sialidase; hydrolase, neuraminidase; HET: SKD; 1.80A {Macrobdella decora} SCOP: b.29.1.9 b.68.1.1 PDB: 1sll_A 1sli_A* 3sli_A* 4sli_A* Back     alignment and structure
>3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Back     alignment and structure
>1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Back     alignment and structure
>2wqr_A IG epsilon chain C region; immune system, immunoglobulin domain, glycoprotein; HET: NAG BMA MAN PG4; 1.90A {Homo sapiens} PDB: 2y7q_B* 1o0v_A* 3h9y_A* 3h9z_A* 3ha0_A* 1fp5_A 1f6a_B 1g84_A Back     alignment and structure
>1svz_A Immunoglobulin;, single-chain FV fragment 1696; antibody-antigen complex, HIV inhibiting antibody; 1.89A {Mus musculus} PDB: 1jp5_A Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Back     alignment and structure
>2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* Back     alignment and structure
>2w59_A IGY FCU3-4; immunoglobulin, avian, immune system; HET: NAG MAN; 1.75A {Gallus gallus} Back     alignment and structure
>3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 834
d1pz7a_195 b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxI 1e-27
d1pz7a_195 b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxI 4e-20
d1pz7a_195 b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxI 3e-09
d1pz7a_195 b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxI 2e-05
d1dyka2185 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse 7e-23
d1dyka2185 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse 1e-21
d1dyka2185 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse 9e-06
d1dyka1189 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse 9e-22
d1dyka1189 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse 1e-18
d1dyka1189 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse 1e-05
d1dyka1189 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse 2e-05
d1h30a1191 b.29.1.4 (A:261-451) Growth-arrest-specific protei 9e-22
d1h30a1191 b.29.1.4 (A:261-451) Growth-arrest-specific protei 2e-21
d1h30a1191 b.29.1.4 (A:261-451) Growth-arrest-specific protei 2e-07
d1d2sa_170 b.29.1.4 (A:) Sex hormone-binding globulin {Human 3e-21
d1d2sa_170 b.29.1.4 (A:) Sex hormone-binding globulin {Human 8e-19
d1d2sa_170 b.29.1.4 (A:) Sex hormone-binding globulin {Human 5e-05
d1d2sa_170 b.29.1.4 (A:) Sex hormone-binding globulin {Human 1e-04
d2r1da1177 b.29.1.4 (A:36-212) Ligand-binding domain of neure 1e-16
d2r1da1177 b.29.1.4 (A:36-212) Ligand-binding domain of neure 1e-16
d1h30a2218 b.29.1.4 (A:461-678) Growth-arrest-specific protei 1e-12
d1h30a2218 b.29.1.4 (A:461-678) Growth-arrest-specific protei 3e-12
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 2e-09
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 2e-06
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 0.002
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 0.004
d3egfa_53 g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse 5e-09
d3egfa_53 g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse 2e-08
d3egfa_53 g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse 2e-04
d3egfa_53 g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse 4e-04
d1tpga141 g.3.11.1 (A:51-91) Plasminogen activator (tissue-t 8e-09
d1tpga141 g.3.11.1 (A:51-91) Plasminogen activator (tissue-t 2e-06
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 2e-08
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 3e-06
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 8e-05
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 0.001
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 3e-08
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 4e-05
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 1e-04
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 2e-04
d1cvua241 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG 3e-08
d1cvua241 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG 1e-04
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 3e-08
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 2e-05
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 1e-04
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 0.001
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 3e-08
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 3e-06
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 1e-04
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 0.003
d1nqlb_48 g.3.11.1 (B:) Epidermal growth factor, EGF {Human 4e-08
d1nqlb_48 g.3.11.1 (B:) Epidermal growth factor, EGF {Human 2e-07
d1nqlb_48 g.3.11.1 (B:) Epidermal growth factor, EGF {Human 0.001
d1nqlb_48 g.3.11.1 (B:) Epidermal growth factor, EGF {Human 0.001
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 4e-08
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 2e-06
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 9e-05
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 0.002
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 4e-08
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 2e-06
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 9e-05
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 0.003
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 4e-08
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 2e-06
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 6e-05
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 0.003
d1q4ga242 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG 7e-08
d1q4ga242 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG 9e-05
d1autl148 g.3.11.1 (L:49-96) Activated protein c (autoprothr 3e-07
d1autl148 g.3.11.1 (L:49-96) Activated protein c (autoprothr 8e-07
d1autl148 g.3.11.1 (L:49-96) Activated protein c (autoprothr 5e-04
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 4e-07
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 1e-06
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 2e-05
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 7e-05
d1ioxa_50 g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) 5e-06
d1ioxa_50 g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) 4e-05
d1biha489 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr 1e-05
d1k36a_46 g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo 2e-05
d1k36a_46 g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo 2e-04
d1moxc_49 g.3.11.1 (C:) Transforming growth factor alpha {Hu 2e-05
d1moxc_49 g.3.11.1 (C:) Transforming growth factor alpha {Hu 4e-04
d3dara197 b.1.1.4 (A:153-249) Fibroblast growth factor recep 7e-05
d1l6za1107 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, C 9e-05
d2cqva1101 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T 1e-04
d1kloa155 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mu 1e-04
d1cs6a391 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall 3e-04
d1koaa197 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha 5e-04
d1cs6a489 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall 7e-04
d1n26a193 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chai 8e-04
d1xdtr_41 g.3.11.1 (R:) Heparin-binding epidermal growth fac 0.001
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 0.001
d1biha194 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropi 0.002
d1gl4a240 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 0.004
>d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 195 Back     information, alignment and structure

class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Laminin G-like module
domain: Agrin
species: Chicken (Gallus gallus) [TaxId: 9031]
 Score =  108 bits (271), Expect = 1e-27
 Identities = 54/178 (30%), Positives = 82/178 (46%), Gaps = 9/178 (5%)

Query: 387 FTQKPLSYLALPTLTDAHLHFSIELSFKPTDYNGLIMYTGDSNMKSYKGKGDFVSFGLED 446
            +   L Y A P+   A      ELS K     GLI+++G         + D+++  + D
Sbjct: 25  KSPDALDYPAEPSE-KALQSNHFELSIKTEATQGLILWSGKGL-----ERSDYIALAIVD 78

Query: 447 GYPVFRFDVG--LVVLRSKVTLVPHEWVVVTIIKDFKEGKLSVGGEPLIVGSTPGEKLQV 504
           G+    +D+G   VVLRS V +  + W  +   +  +EG L VG E  I GS+P      
Sbjct: 79  GFVQMMYDLGSKPVVLRSTVPINTNHWTHIKAYRVQREGSLQVGNEAPITGSSPL-GATQ 137

Query: 505 LNLRTPLYLGGYNIYHVTPSLSVEVTEGFHGCISTIDVLGSELDLINSAVDSANIMDC 562
           L+    L+LGG     V   L    + GF GCI  + V   EL L+  A+++  I+ C
Sbjct: 138 LDTDGALWLGGMERLSVAHKLPKAYSTGFIGCIRDVIVDRQELHLVEDALNNPTILHC 195


>d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 195 Back     information, alignment and structure
>d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 195 Back     information, alignment and structure
>d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 195 Back     information, alignment and structure
>d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 185 Back     information, alignment and structure
>d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 185 Back     information, alignment and structure
>d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 185 Back     information, alignment and structure
>d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 189 Back     information, alignment and structure
>d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 189 Back     information, alignment and structure
>d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 189 Back     information, alignment and structure
>d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 189 Back     information, alignment and structure
>d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure
>d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure
>d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure
>d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2r1da1 b.29.1.4 (A:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 177 Back     information, alignment and structure
>d2r1da1 b.29.1.4 (A:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 177 Back     information, alignment and structure
>d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 46 Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 46 Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 49 Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 49 Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 55 Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 94 Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query834
d1dyka1189 Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 99.96
d1pz7a_195 Agrin {Chicken (Gallus gallus) [TaxId: 9031]} 99.95
d1h30a1191 Growth-arrest-specific protein Gas6 {Human (Homo s 99.93
d1dyka2185 Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 99.93
d2r1da1177 Ligand-binding domain of neurexin 1beta {Rat (Ratt 99.92
d1d2sa_170 Sex hormone-binding globulin {Human (Homo sapiens) 99.91
d1dyka1189 Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 99.89
d1pz7a_195 Agrin {Chicken (Gallus gallus) [TaxId: 9031]} 99.87
d1h30a2218 Growth-arrest-specific protein Gas6 {Human (Homo s 99.85
d1d2sa_170 Sex hormone-binding globulin {Human (Homo sapiens) 99.82
d1dyka2185 Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 99.81
d2r1da1177 Ligand-binding domain of neurexin 1beta {Rat (Ratt 99.8
d1h30a1191 Growth-arrest-specific protein Gas6 {Human (Homo s 99.77
d1h30a2218 Growth-arrest-specific protein Gas6 {Human (Homo s 99.69
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 99.19
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 99.19
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 99.16
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 99.16
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 99.14
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 99.13
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 99.13
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 99.12
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 99.11
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 99.1
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 99.09
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 99.09
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 99.08
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 99.06
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 99.04
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 99.02
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 99.0
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 99.0
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.99
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 98.96
d2erfa1206 Thrombospondin 1 N-terminal domain {Human (Homo sa 98.9
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 98.88
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 98.87
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 98.86
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 98.83
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 98.82
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 98.81
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 98.77
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 98.61
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 98.47
d1b09a_206 C-reactive protein (CRP) {Human (Homo sapiens) [Ta 98.41
d1saca_204 Serum amyloid P component (SAP) {Human (Homo sapie 98.38
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 98.37
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 98.35
d2slia1196 Leech intramolecular trans-sialidase, N-terminal d 98.14
d2erfa1206 Thrombospondin 1 N-terminal domain {Human (Homo sa 98.02
d1n26a193 Interleukin-6 receptor alpha chain, N-terminal dom 98.02
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.01
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.0
d1cs6a391 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 97.97
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.97
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 97.93
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.92
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 97.89
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 97.88
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.85
d1gsma190 Mucosal addressin cell adhesion molecule-1 (MADCAM 97.85
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 97.81
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.79
d1a8da1247 Tetanus neurotoxin {Clostridium tetani [TaxId: 151 97.77
d1biha489 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 97.73
d1gl4b_89 Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 97.73
d3btaa1207 Botulinum neurotoxin {Clostridium botulinum, serot 97.72
d1b09a_206 C-reactive protein (CRP) {Human (Homo sapiens) [Ta 97.71
d1cs6a489 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 97.64
d1epwa1218 Botulinum neurotoxin {Clostridium botulinum, serot 97.63
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.62
d1saca_204 Serum amyloid P component (SAP) {Human (Homo sapie 97.61
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 97.57
d1iray1101 Type-1 interleukin-1 receptor {Human (Homo sapiens 97.53
d1olza192 Semaphorin 4d Ig-like domain {Human (Homo sapiens) 97.52
d1biha194 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 97.52
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 97.47
d1epfa292 Neural cell adhesion molecule (NCAM) {Rat (Rattus 97.46
d1biha397 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 97.44
d1tnna_91 Titin {Human (Homo sapiens), different modules [Ta 97.42
d1iray2103 Type-1 interleukin-1 receptor {Human (Homo sapiens 97.42
d1l6za296 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t 97.41
d1vcaa290 Vascular cell adhesion molecule-1 (VCAM-1) {Human 97.39
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.35
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 97.35
d1i0ua241 Low density lipoprotein (LDL) receptor, different 97.32
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.31
d1cs6a2105 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 97.31
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 97.3
d3dara197 Fibroblast growth factor receptor, FGFR {Human (Ho 97.3
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 97.3
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.29
d1wiua_93 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 97.25
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 97.24
d1koaa197 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 97.22
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 97.17
d1qz1a3100 Neural cell adhesion molecule (NCAM) {Rat (Rattus 97.15
d1i0ua241 Low density lipoprotein (LDL) receptor, different 97.12
d1fhga_102 Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 97.12
d1g1ca_98 Titin {Human (Homo sapiens), different modules [Ta 97.12
d1epfa197 Neural cell adhesion molecule (NCAM) {Rat (Rattus 97.11
d1rhfa191 Tyrosine-protein kinase receptor tyro3, N-terminal 97.1
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 97.09
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.09
d2nxyb284 CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 97.05
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.04
d1nt0a345 Mannose-binding protein associated serine protease 97.0
d1nbqa2104 Junction adhesion molecule, JAM, C-terminal domain 96.99
d2fcba288 Fc gamma receptor ectodomain (CD32) {Human (Homo s 96.98
d1wwbx_103 Ligand binding domain of trkB receptor {Human (Hom 96.98
d2aw2a1104 B- and T-lymphocyte attenuator CD272 {Human (Homo 96.9
d1pd6a_94 Cardiac myosin binding protein C, different domain 96.87
d1fnla289 Fc gamma receptor ectodomain (CD32) {Human (Homo s 96.86
d1f97a2110 Junction adhesion molecule, JAM, C-terminal domain 96.86
d1szba245 Mannose-binding protein associated serine protease 96.86
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 96.82
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 96.78
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 96.78
d1cs6a197 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 96.75
d1nbqa1105 Junction adhesion molecule, JAM, N-terminal domain 96.75
d1wwca_105 NT3 binding domain of trkC receptor {Human (Homo s 96.74
d2ifga192 High affinity nerve growth factor receptor TrkA, d 96.72
d1he7a_107 High affinity nerve growth factor receptor TrkA, d 96.69
d1x44a190 Myosin-binding protein C, slow-type {Human (Homo s 96.68
d1tiua_89 Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI 96.63
d1f2qa289 IgE high affinity receptor alpha subunit {Human (H 96.63
d1f97a1102 Junction adhesion molecule, JAM, N-terminal domain 96.6
d1ccza193 CD2-binding domain of CD58, N-terminal domain {Hum 96.53
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 96.52
d2dava1113 Myosin-binding protein C, slow-type {Human (Homo s 96.52
d2slia1196 Leech intramolecular trans-sialidase, N-terminal d 96.48
d3bpse140 Low density lipoprotein (LDL) receptor, different 96.45
d2avga1110 Cardiac myosin binding protein C, different domain 96.39
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 96.38
d1gxea_130 Cardiac myosin binding protein C, different domain 96.35
d3btaa1207 Botulinum neurotoxin {Clostridium botulinum, serot 96.34
d1hnga198 CD2, first domain {Rat (Rattus norvegicus) [TaxId: 96.33
d1rhfa285 Tyrosine-protein kinase receptor tyro3, second dom 96.32
d1biha2111 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 96.16
d2fdbp2109 Fibroblast growth factor receptor, FGFR {Human (Ho 96.1
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 96.08
d2oz4a384 Intercellular adhesion molecule-1, ICAM-1 {Human ( 96.06
d1epwa1218 Botulinum neurotoxin {Clostridium botulinum, serot 96.0
d3b5ha1101 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 95.93
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 95.9
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 95.88
d1a8da1247 Tetanus neurotoxin {Clostridium tetani [TaxId: 151 95.84
d1szba245 Mannose-binding protein associated serine protease 95.76
d2fcba185 Fc gamma receptor ectodomain (CD32) {Human (Homo s 95.69
d3bpse140 Low density lipoprotein (LDL) receptor, different 95.59
d1fnla184 Fc gamma receptor ectodomain (CD32) {Human (Homo s 95.5
d2c9aa196 Receptor-type tyrosine-protein phosphatase mu {Hum 95.45
d1nt0a345 Mannose-binding protein associated serine protease 95.43
d1f2qa182 IgE high affinity receptor alpha subunit {Human (H 95.3
d1l6za1107 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-t 95.21
d1iray3107 Type-1 interleukin-1 receptor {Human (Homo sapiens 95.18
d1iama1103 Intercellular cell adhesion molecule-1 (ICAM-1) {H 95.11
d2ah2a1225 Trypanosoma sialidase, C-terminal domain {Parasiti 94.1
d2crya1115 Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s 93.89
d2nxyb197 CD4 V-set domains {Human (Homo sapiens) [TaxId: 96 91.76
d1dr9a1105 CD80, N-terminal domain {Human (Homo sapiens) [Tax 91.4
d1n1ta1222 Trypanosoma sialidase, C-terminal domain {Trypanos 91.2
d1ijqa250 Low density lipoprotein (LDL) receptor, different 90.99
d1zxqa1106 Intercellular cell adhesion molecule-2 (ICAM-2) {H 90.47
d1ncna_110 CD86 (b7-2), N-terminal domain {Human (Homo sapien 90.04
d1neua_119 Myelin membrane adhesion molecule P0 {Rat (Rattus 89.94
d1pkoa_126 Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra 89.74
d1ucta296 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 89.43
d1ucta199 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 89.41
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 89.37
d1olla195 Ligand binding domain of NK receptor NKp46 {Human 89.19
d1jbja2100 CD3 epsilon chain ectodomain fragment {Mouse (Mus 88.95
d1eaja_124 Coxsackie virus and adenovirus receptor (Car), dom 88.54
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 88.14
d1dx5i143 Thrombomodulin, different EGF-like domains {Human 86.63
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 86.57
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 86.24
d1hkfa_108 NK cell activating receptor NKP44 {Human (Homo sap 85.98
d1xeda_116 Polymeric-immunoglobulin receptor, PIGR {Human (Ho 85.83
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 85.82
d1qfoa_118 N-terminal domain of sialoadhesin {Mouse (Mus musc 85.75
d1hnfa1101 CD2, first domain {Human (Homo sapiens) [TaxId: 96 85.64
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 84.95
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 84.86
d1olla293 Ligand binding domain of NK receptor NKp46 {Human 84.12
d1ijqa250 Low density lipoprotein (LDL) receptor, different 83.85
d1nezg_122 CD8 {Mouse (Mus musculus) [TaxId: 10090]} 83.13
d1dx5i143 Thrombomodulin, different EGF-like domains {Human 82.89
d1xaua_104 B and T lymphocyte attenuator, Btla {Mouse (Mus mu 82.83
d2gj6d194 T-cell antigen receptor {Mouse (Mus musculus), bet 82.72
d2g5ra1121 N-terminal domain of sialic acid binding Ig-like l 81.52
d1akjd_114 CD8 {Human (Homo sapiens) [TaxId: 9606]} 81.26
d1i9ea_115 T-cell antigen receptor {Mouse (Mus musculus), alp 81.15
d3bp5a1114 Programmed cell death protein 1, PD1, extracellula 80.66
d2cdea1114 T-cell antigen receptor {Human (Homo sapiens), bet 80.29
d1smoa_113 TREM-1 (triggering receptor expressed on myeloid c 80.26
d1i8ka_106 Immunoglobulin light chain kappa variable domain, 80.13
d1j1pl_107 Immunoglobulin light chain kappa variable domain, 80.09
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 80.01
>d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Laminin G-like module
domain: Laminin alpha2 chain
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.96  E-value=5.7e-28  Score=234.71  Aligned_cols=171  Identities=24%  Similarity=0.405  Sum_probs=139.9

Q ss_pred             eeeEEc--CCceeeechhhhhhccCcceEEEEEEeCCCCeeEEecCCCCCCCCCCcceEEEEEECCEEEEEEEcCCcEEE
Q psy9228         652 SEVHFL--GEGYVELKKELIEERRNEETIAFDFVTDDKNALLLWNGQPSYKNGIGREFIAVAVVNGYLEYSYDLGDGVVT  729 (834)
Q Consensus       652 ~~~~F~--g~s~~~~~~~~~~~~~~~~~i~~~frT~~~~GlLl~~~~~~~~~~~~~~~~~l~l~~G~l~~~~~~g~~~~~  729 (834)
                      .++.|.  ++||+.++..... .+...+|+|+|||.+++|+|||++...     ..|||+|+|.||+|++.+++|++...
T Consensus        15 ~~~~fg~s~~s~~~~~~~~~~-~~~~~~i~~~frT~~~~GlL~~~~~~~-----~~dfi~l~l~~G~l~~~~~~g~~~~~   88 (189)
T d1dyka1          15 GSKQFGLSRNSHIAIAFDDTK-VKNRLTIELEVRTEAESGLLFYMARIN-----HADFATVQLRNGFPYFSYDLGSGDTS   88 (189)
T ss_dssp             TCEECCSSTTCEEEEECCGGG-GSSEEEEEEEEEECCSCEEEEEEECTT-----SSSEEEEEEETTEEEEEEESSSCEEE
T ss_pred             CceecCCCCCceEEEecCccc-ccccEEEEEEEEECCCCEEEEEEcCCC-----CCcEEEEEEECCEEEEEEECCCccEE
Confidence            356674  4789998754332 357789999999999999999987543     36899999999999999999999888


Q ss_pred             EEeCCceecCCCcEEEEEEEECCEEEEEEcCeeeecccCCCCccceecCCceEEcCcCCCCCCC-CCccCCCceEEEEEE
Q psy9228         730 IKFSKKPVNDGIKHSVNVTRINKFGSLEVDSVIVGKGESPGSQDVINTRGNIYLGGTPNMDLMT-GGRYVHPMSGLMMNI  808 (834)
Q Consensus       730 l~~s~~~~nDg~wH~V~i~r~~~~~~l~VD~~~~~~~~~~~~~~~l~~~~~lyiGG~p~~~~~~-~~~~~~~F~GCi~~v  808 (834)
                      +. +..+|+||+||+|.|.|.++.++|+||+...... .++....++..+.|||||+|...... ......+|+|||++|
T Consensus        89 ~~-~~~~v~Dg~WH~V~v~~~~~~~~l~VD~~~~~~~-~~~~~~~l~~~~~lyiGG~p~~~~~~~~~~~~~~F~GCi~~v  166 (189)
T d1dyka1          89 TM-IPTKINDGQWHKIKIVRVKQEGILYVDDASSQTI-SPKKADILDVVGILYVGGLPINYTTRRIGPVTYSLDGCVRNL  166 (189)
T ss_dssp             EE-CCSCCCSSSCEEEEEEEETTEEEEEETTEEEEEE-CSTTCCCCCCCSEEEESSCCTTCCCCSSCSCCSBCSEEEEEE
T ss_pred             ec-CCcEeeCCCEEEEEEEEcccEEEEEECCcceeeE-ccCcccccccccceEEecccccccccccCcCCCCcEEEEeEE
Confidence            87 7789999999999999999999999999876543 44555667888899999999754332 234567899999999


Q ss_pred             EECCceecccCCCCCCCccccccc
Q psy9228         809 HIQNKHISNIGSSASSGLHVMPWI  832 (834)
Q Consensus       809 ~in~~~~~~l~~~a~~~~nv~~c~  832 (834)
                      +||++ .++|.+ +....||.+||
T Consensus       167 ~in~~-~~~L~~-~~~~~~V~~Cf  188 (189)
T d1dyka1         167 HMEQA-PVDLDQ-PTSSFHVGTCF  188 (189)
T ss_dssp             EESSS-CCCTTS-CSEEESCBCCB
T ss_pred             EECCE-EecCCC-cccCCCccCcc
Confidence            99996 568876 46999999998



>d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2r1da1 b.29.1.4 (A:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2r1da1 b.29.1.4 (A:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erfa1 b.29.1.4 (A:10-215) Thrombospondin 1 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b09a_ b.29.1.5 (A:) C-reactive protein (CRP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1saca_ b.29.1.5 (A:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2slia1 b.29.1.9 (A:81-276) Leech intramolecular trans-sialidase, N-terminal domain {North american leech (Macrobdella decora) [TaxId: 6405]} Back     information, alignment and structure
>d2erfa1 b.29.1.4 (A:10-215) Thrombospondin 1 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8da1 b.29.1.6 (A:1-247) Tetanus neurotoxin {Clostridium tetani [TaxId: 1513]} Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3btaa1 b.29.1.6 (A:872-1078) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]} Back     information, alignment and structure
>d1b09a_ b.29.1.5 (A:) C-reactive protein (CRP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1epwa1 b.29.1.6 (A:862-1079) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1saca_ b.29.1.5 (A:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2slia1 b.29.1.9 (A:81-276) Leech intramolecular trans-sialidase, N-terminal domain {North american leech (Macrobdella decora) [TaxId: 6405]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3btaa1 b.29.1.6 (A:872-1078) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]} Back     information, alignment and structure
>d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1epwa1 b.29.1.6 (A:862-1079) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]} Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8da1 b.29.1.6 (A:1-247) Tetanus neurotoxin {Clostridium tetani [TaxId: 1513]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ah2a1 b.29.1.15 (A:409-633) Trypanosoma sialidase, C-terminal domain {Parasitic flagellate protozoan (Trypanosoma cruzi) [TaxId: 5693]} Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n1ta1 b.29.1.15 (A:413-634) Trypanosoma sialidase, C-terminal domain {Trypanosoma rangeli [TaxId: 5698]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncna_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ucta2 b.1.1.4 (A:101-196) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbja2 b.1.1.4 (A:1-100) CD3 epsilon chain ectodomain fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hkfa_ b.1.1.1 (A:) NK cell activating receptor NKP44 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xeda_ b.1.1.1 (A:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qfoa_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hnfa1 b.1.1.1 (A:4-104) CD2, first domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olla2 b.1.1.4 (A:96-188) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xaua_ b.1.1.4 (A:) B and T lymphocyte attenuator, Btla {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gj6d1 b.1.1.1 (D:15-114) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d2g5ra1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akjd_ b.1.1.1 (D:) CD8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i9ea_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d3bp5a1 b.1.1.1 (A:1-114) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cdea1 b.1.1.1 (A:2-115) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1smoa_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i8ka_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1j1pl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure