Psyllid ID: psy9228
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 834 | ||||||
| 189237255 | 4254 | PREDICTED: similar to AGAP003656-PA [Tri | 0.517 | 0.101 | 0.394 | 3e-86 | |
| 270008326 | 3943 | hypothetical protein TcasGA2_TC030735 [T | 0.515 | 0.109 | 0.391 | 2e-84 | |
| 321479130 | 819 | hypothetical protein DAPPUDRAFT_186952 [ | 0.509 | 0.518 | 0.370 | 1e-74 | |
| 307203130 | 3454 | Basement membrane-specific heparan sulfa | 0.504 | 0.121 | 0.361 | 3e-71 | |
| 307169661 | 3395 | Basement membrane-specific heparan sulfa | 0.515 | 0.126 | 0.347 | 1e-69 | |
| 380020744 | 489 | PREDICTED: pikachurin-like [Apis florea] | 0.474 | 0.809 | 0.370 | 2e-68 | |
| 332025352 | 3377 | Basement membrane-specific heparan sulfa | 0.503 | 0.124 | 0.340 | 4e-68 | |
| 328783871 | 492 | PREDICTED: pikachurin-like [Apis mellife | 0.474 | 0.804 | 0.363 | 3e-67 | |
| 350402224 | 519 | PREDICTED: pikachurin-like isoform 1 [Bo | 0.495 | 0.795 | 0.344 | 1e-65 | |
| 340729482 | 454 | PREDICTED: pikachurin-like [Bombus terre | 0.491 | 0.903 | 0.344 | 1e-65 |
| >gi|189237255|ref|XP_972068.2| PREDICTED: similar to AGAP003656-PA [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 326 bits (836), Expect = 3e-86, Method: Compositional matrix adjust.
Identities = 186/472 (39%), Positives = 275/472 (58%), Gaps = 40/472 (8%)
Query: 393 SYLALPTLTDAHLHFSIELSFKPTD-YNGLIMYTGDSNMKSYKGKGDFVSFGLEDGYPVF 451
+Y+A P + F L KPTD +G+++Y +++ +G GDFVS ++D + F
Sbjct: 3792 AYIAYP-VPKLQRRFKAALKIKPTDNRDGILLYCAETD----EGHGDFVSLAIKDRHIEF 3846
Query: 452 RFDVG--LVVLRSKVTLVPHEWVVVTIIKDFKEGKLSVGGEPLIVGSTPGEKLQVLNLRT 509
F+VG V +RS+ + P EW V+T + EG+L V GE G+TPG + LNL T
Sbjct: 3847 NFNVGGRPVTIRSEKEVRPGEWHVLTATRSLSEGRLIVDGE-TTFGTTPGNH-KTLNLLT 3904
Query: 510 PLYLGGYNIYHVTPSLSVEVTEGFHGCISTIDVLGSELDLINSAVDSANIMDCSDL---- 565
LY+GGY+ ++ + V V GF+GCIS I + G +LD+INSA DSAN+M+CS L
Sbjct: 3905 RLYVGGYDSENIKINDKVGVHSGFNGCISEIKMSGLDLDVINSAEDSANVMECSSLDNEV 3964
Query: 566 -----------ESSPV-----------CAPKPCQNYGICYPTDTSERGYNCSCLTGYSGD 603
E++P C+ PC+N G CYP S YNC+CL+G+SG
Sbjct: 3965 DNNVGGFEYVHENTPTTSQPYNSRRTGCSSNPCKNGGQCYPL--SPMDYNCNCLSGFSGK 4022
Query: 604 HCEKENNMCMKGDVCKNGGMCKVTPDSYECLCSLGYAPPNCAKRVSIGSEVHFLGEGYVE 663
CE E N+C + C+NGG C YEC C L ++ NC RV + ++ HF G+GY+E
Sbjct: 4023 DCEIEMNICEQKIPCQNGGTCSGNATGYECSCPLLFSGKNCELRVELRNDAHFNGKGYLE 4082
Query: 664 LKKELIEE-RRNE-ETIAFDFVTDDKNALLLWNGQPSYKNGIGREFIAVAVVNGYLEYSY 721
++L++ + NE E IA + T+ + L+ W+GQ ++G G+ +I++ VVNGYLE+SY
Sbjct: 4083 FDRDLLDHIKENEDELIAVELSTNSSDGLVFWHGQTPNEDGQGKNYISLGVVNGYLEFSY 4142
Query: 722 DLGDGVVTIKFSKKPVNDGIKHSVNVTRINKFGSLEVDSVIVGKGESPGSQDVINTRGNI 781
DLG G I+ ++K V+DG +HS + R + GS+E+D+ GESPG + ++ GNI
Sbjct: 4143 DLGSGPAIIRNTQKRVDDGQRHSAILKRRGRVGSIEIDNAYTQTGESPGFTNTLSCAGNI 4202
Query: 782 YLGGTPNMDLMTGGRYVHPMSGLMMNIHIQNKHISNIGSSASSGLHVMPWIR 833
YLGG PN+ LMTG R+ H G + +QN ++G A SG++V P R
Sbjct: 4203 YLGGAPNIGLMTGRRFSHGFDGCVHAFELQNLKTLDLGIRAISGVNVKPCSR 4254
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|270008326|gb|EFA04774.1| hypothetical protein TcasGA2_TC030735 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|321479130|gb|EFX90086.1| hypothetical protein DAPPUDRAFT_186952 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|307203130|gb|EFN82310.1| Basement membrane-specific heparan sulfate proteoglycan core protein [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|307169661|gb|EFN62243.1| Basement membrane-specific heparan sulfate proteoglycan core protein [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|380020744|ref|XP_003694239.1| PREDICTED: pikachurin-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|332025352|gb|EGI65519.1| Basement membrane-specific heparan sulfate proteoglycan core protein [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|328783871|ref|XP_003250356.1| PREDICTED: pikachurin-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|350402224|ref|XP_003486411.1| PREDICTED: pikachurin-like isoform 1 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340729482|ref|XP_003403030.1| PREDICTED: pikachurin-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 834 | ||||||
| FB|FBgn0261451 | 4629 | trol "terribly reduced optic l | 0.406 | 0.073 | 0.322 | 3.1e-49 | |
| ZFIN|ZDB-GENE-080807-4 | 3422 | hspg2 "heparan sulfate proteog | 0.5 | 0.121 | 0.351 | 3.8e-75 | |
| UNIPROTKB|F1MER7 | 4374 | HSPG2 "Uncharacterized protein | 0.483 | 0.092 | 0.348 | 1.5e-64 | |
| UNIPROTKB|P98160 | 4391 | HSPG2 "Basement membrane-speci | 0.586 | 0.111 | 0.301 | 2e-58 | |
| MGI|MGI:96257 | 3707 | Hspg2 "perlecan (heparan sulfa | 0.585 | 0.131 | 0.305 | 4.3e-56 | |
| UNIPROTKB|E1BQW4 | 1022 | EGFLAM "Uncharacterized protei | 0.252 | 0.206 | 0.302 | 7.6e-51 | |
| ZFIN|ZDB-GENE-030131-1033 | 2028 | agrn "agrin" [Danio rerio (tax | 0.459 | 0.188 | 0.278 | 2.5e-39 | |
| UNIPROTKB|F1LQ53 | 963 | Agrn "Agrin" [Rattus norvegicu | 0.494 | 0.427 | 0.315 | 4.7e-41 | |
| UNIPROTKB|F1NAT6 | 1213 | HSPG2 "Uncharacterized protein | 0.501 | 0.344 | 0.311 | 3.4e-48 | |
| UNIPROTKB|F1MSI2 | 2032 | AGRN "Uncharacterized protein" | 0.461 | 0.189 | 0.319 | 1.6e-39 |
| FB|FBgn0261451 trol "terribly reduced optic lobes" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 492 (178.3 bits), Expect = 3.1e-49, Sum P(4) = 3.1e-49
Identities = 116/360 (32%), Positives = 184/360 (51%)
Query: 306 APYGSKITLTCNNDLEAPVEYTWSKRSNGHVLPFGAFSRENTLTLQEIKNSDAGMYVCKV 365
A G+ L C D Y WS R G L G L+L ++ +DAG Y+C
Sbjct: 3848 AKVGANADLQCGADESRQPTYRWS-RQYGQ-LQAGRSLMNEKLSLDSVQANDAGTYICTA 3905
Query: 366 SNKD-MTVEIPSILLVTDSVPLFTQKPLSYLALPTLTDAHLHFSIELSFKPTDYNGLIMY 424
D T + P+IL+VT ++P F Q+P SY++ PTL ++ F+ EL+F+P + +GL+++
Sbjct: 3906 QYADGETADFPNILVVTGAIPQFRQEPRSYMSFPTLPNSSFKFNFELTFRPENGDGLLLF 3965
Query: 425 TGDSNMKSYKGKGDFVSFGLEDGYPVFRFDVG--LVVLRSKVTLVPHEWVVVTIIKDFKE 482
G + +G GD+++ L+D Y FRFD G +++R++ L +EW V + + ++
Sbjct: 3966 NGQT-----RGSGDYIALSLKDRYAEFRFDFGGKPMLVRAEEPLALNEWHTVRVSRFKRD 4020
Query: 483 GKLSVGGEPLIVGSTPGEKLQVLNLRTPLYLGGYNIYHVTPSLSVEVTEGFHGCISTIDV 542
G + V + + T +++ L+L LY+GG + + P+ +V GF GCIS + +
Sbjct: 4021 GYIQVDEQHPVAFPTL-QQIPQLDLIEDLYIGGVPNWELLPADAVSQQVGFVGCISRLTL 4079
Query: 543 LGSELDLINSAVDSANIMDCSDLESSPVCAPKPCQNYGICYPTDTSERGYNCSCLTGYSG 602
G ++LI A I DC P CA PCQN G+C + T E+ Y C C G++G
Sbjct: 4080 QGRTVELIREAKYKEGITDCR-----P-CAQGPCQNKGVCLESQT-EQAYTCICQPGWTG 4132
Query: 603 DHCEKENNMCMKGDVCKNGGMCKVTPDSYECLCSLGYAPPNCAKRVSIGSE-VHFLGEGY 661
C E C G VC G C+ T + ECLC L + C + ++F G +
Sbjct: 4133 RDCAIEGTQCTPG-VC-GAGRCENTENDMECLCPLNRSGDRCQYNEILNEHSLNFKGNSF 4190
|
|
| ZFIN|ZDB-GENE-080807-4 hspg2 "heparan sulfate proteoglycan 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MER7 HSPG2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P98160 HSPG2 "Basement membrane-specific heparan sulfate proteoglycan core protein" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:96257 Hspg2 "perlecan (heparan sulfate proteoglycan 2)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BQW4 EGFLAM "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-1033 agrn "agrin" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LQ53 Agrn "Agrin" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NAT6 HSPG2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MSI2 AGRN "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 834 | |||
| cd00110 | 151 | cd00110, LamG, Laminin G domain; Laminin G-like do | 6e-28 | |
| cd00110 | 151 | cd00110, LamG, Laminin G domain; Laminin G-like do | 4e-27 | |
| smart00282 | 132 | smart00282, LamG, Laminin G domain | 2e-26 | |
| smart00282 | 132 | smart00282, LamG, Laminin G domain | 2e-25 | |
| pfam02210 | 124 | pfam02210, Laminin_G_2, Laminin G domain | 1e-23 | |
| pfam02210 | 124 | pfam02210, Laminin_G_2, Laminin G domain | 3e-21 | |
| pfam00054 | 131 | pfam00054, Laminin_G_1, Laminin G domain | 7e-21 | |
| pfam00054 | 131 | pfam00054, Laminin_G_1, Laminin G domain | 2e-18 | |
| cd00110 | 151 | cd00110, LamG, Laminin G domain; Laminin G-like do | 3e-08 | |
| smart00282 | 132 | smart00282, LamG, Laminin G domain | 9e-08 | |
| smart00408 | 63 | smart00408, IGc2, Immunoglobulin C-2 Type | 6e-07 | |
| cd00110 | 151 | cd00110, LamG, Laminin G domain; Laminin G-like do | 2e-06 | |
| smart00410 | 85 | smart00410, IG_like, Immunoglobulin like | 2e-06 | |
| smart00409 | 85 | smart00409, IG, Immunoglobulin | 2e-06 | |
| cd00054 | 38 | cd00054, EGF_CA, Calcium-binding EGF-like domain, | 4e-06 | |
| cd00054 | 38 | cd00054, EGF_CA, Calcium-binding EGF-like domain, | 7e-06 | |
| pfam00008 | 32 | pfam00008, EGF, EGF-like domain | 7e-06 | |
| cd00054 | 38 | cd00054, EGF_CA, Calcium-binding EGF-like domain, | 3e-05 | |
| smart00282 | 132 | smart00282, LamG, Laminin G domain | 4e-05 | |
| cd05754 | 85 | cd05754, Ig3_Perlecan_like, Third immunoglobulin ( | 4e-05 | |
| pfam02210 | 124 | pfam02210, Laminin_G_2, Laminin G domain | 5e-05 | |
| cd00053 | 36 | cd00053, EGF, Epidermal growth factor domain, foun | 5e-05 | |
| cd00096 | 74 | cd00096, Ig, Immunoglobulin domain | 6e-05 | |
| cd05732 | 96 | cd05732, Ig5_NCAM-1_like, Fifth immunoglobulin (Ig | 7e-05 | |
| cd04968 | 88 | cd04968, Ig3_Contactin_like, Third Ig domain of co | 2e-04 | |
| cd00053 | 36 | cd00053, EGF, Epidermal growth factor domain, foun | 4e-04 | |
| smart00179 | 39 | smart00179, EGF_CA, Calcium-binding EGF-like domai | 4e-04 | |
| smart00179 | 39 | smart00179, EGF_CA, Calcium-binding EGF-like domai | 4e-04 | |
| pfam13385 | 156 | pfam13385, Laminin_G_3, Concanavalin A-like lectin | 4e-04 | |
| cd00053 | 36 | cd00053, EGF, Epidermal growth factor domain, foun | 6e-04 | |
| pfam13895 | 80 | pfam13895, Ig_2, Immunoglobulin domain | 8e-04 | |
| cd05856 | 82 | cd05856, Ig2_FGFRL1-like, Second immunoglobulin (I | 8e-04 | |
| cd05714 | 106 | cd05714, Ig_CSPGs_LP, Immunoglobulin (Ig)-like dom | 9e-04 | |
| pfam13927 | 74 | pfam13927, Ig_3, Immunoglobulin domain | 0.001 | |
| smart00408 | 63 | smart00408, IGc2, Immunoglobulin C-2 Type | 0.002 | |
| cd05713 | 100 | cd05713, Ig_MOG_like, Immunoglobulin (Ig)-like dom | 0.002 | |
| pfam00047 | 62 | pfam00047, ig, Immunoglobulin domain | 0.002 | |
| cd05869 | 97 | cd05869, Ig5_NCAM-1, Fifth immunoglobulin (Ig)-lik | 0.003 |
| >gnl|CDD|238058 cd00110, LamG, Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans | Back alignment and domain information |
|---|
Score = 109 bits (275), Expect = 6e-28
Identities = 53/157 (33%), Positives = 76/157 (48%), Gaps = 8/157 (5%)
Query: 654 VHFLGEGYVELKKELIEERRNEETIAFDFVTDDKNALLLWNGQPSYKNGIGREFIAVAVV 713
V F G YV L R +I+F F T N LLL+ G + G +F+A+ +
Sbjct: 2 VSFSGSSYVRLPTL--PAPRTRLSISFSFRTTSPNGLLLYAG-----SQNGGDFLALELE 54
Query: 714 NGYLEYSYDLGDGVVTIKFSKKPVNDGIKHSVNVTRINKFGSLEVDSVIVGKGESPGSQD 773
+G L YDLG G + + SK P+NDG HSV+V R + +L VD V + SPG
Sbjct: 55 DGRLVLRYDLGSGSLVLS-SKTPLNDGQWHSVSVERNGRSVTLSVDGERVVESGSPGGSA 113
Query: 774 VINTRGNIYLGGTPNMDLMTGGRYVHPMSGLMMNIHI 810
++N G +YLGG P G G + ++ +
Sbjct: 114 LLNLDGPLYLGGLPEDLKSPGLPVSPGFVGCIRDLKV 150
|
Proteins that contain LamG domains serve a variety of purposes including signal transduction via cell-surface steroid receptors, adhesion, migration and differentiation through mediation of cell adhesion molecules. Length = 151 |
| >gnl|CDD|238058 cd00110, LamG, Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans | Back alignment and domain information |
|---|
| >gnl|CDD|214598 smart00282, LamG, Laminin G domain | Back alignment and domain information |
|---|
| >gnl|CDD|214598 smart00282, LamG, Laminin G domain | Back alignment and domain information |
|---|
| >gnl|CDD|216930 pfam02210, Laminin_G_2, Laminin G domain | Back alignment and domain information |
|---|
| >gnl|CDD|216930 pfam02210, Laminin_G_2, Laminin G domain | Back alignment and domain information |
|---|
| >gnl|CDD|215681 pfam00054, Laminin_G_1, Laminin G domain | Back alignment and domain information |
|---|
| >gnl|CDD|215681 pfam00054, Laminin_G_1, Laminin G domain | Back alignment and domain information |
|---|
| >gnl|CDD|238058 cd00110, LamG, Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans | Back alignment and domain information |
|---|
| >gnl|CDD|214598 smart00282, LamG, Laminin G domain | Back alignment and domain information |
|---|
| >gnl|CDD|197706 smart00408, IGc2, Immunoglobulin C-2 Type | Back alignment and domain information |
|---|
| >gnl|CDD|238058 cd00110, LamG, Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans | Back alignment and domain information |
|---|
| >gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like | Back alignment and domain information |
|---|
| >gnl|CDD|214652 smart00409, IG, Immunoglobulin | Back alignment and domain information |
|---|
| >gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215652 pfam00008, EGF, EGF-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214598 smart00282, LamG, Laminin G domain | Back alignment and domain information |
|---|
| >gnl|CDD|143231 cd05754, Ig3_Perlecan_like, Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|216930 pfam02210, Laminin_G_2, Laminin G domain | Back alignment and domain information |
|---|
| >gnl|CDD|238010 cd00053, EGF, Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain | Back alignment and domain information |
|---|
| >gnl|CDD|143209 cd05732, Ig5_NCAM-1_like, Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143169 cd04968, Ig3_Contactin_like, Third Ig domain of contactin | Back alignment and domain information |
|---|
| >gnl|CDD|238010 cd00053, EGF, Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|222092 pfam13385, Laminin_G_3, Concanavalin A-like lectin/glucanases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238010 cd00053, EGF, Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >gnl|CDD|206066 pfam13895, Ig_2, Immunoglobulin domain | Back alignment and domain information |
|---|
| >gnl|CDD|143264 cd05856, Ig2_FGFRL1-like, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) | Back alignment and domain information |
|---|
| >gnl|CDD|143191 cd05714, Ig_CSPGs_LP, Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|222457 pfam13927, Ig_3, Immunoglobulin domain | Back alignment and domain information |
|---|
| >gnl|CDD|197706 smart00408, IGc2, Immunoglobulin C-2 Type | Back alignment and domain information |
|---|
| >gnl|CDD|143190 cd05713, Ig_MOG_like, Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) | Back alignment and domain information |
|---|
| >gnl|CDD|215677 pfam00047, ig, Immunoglobulin domain | Back alignment and domain information |
|---|
| >gnl|CDD|143277 cd05869, Ig5_NCAM-1, Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 834 | |||
| KOG3514|consensus | 1591 | 100.0 | ||
| KOG4289|consensus | 2531 | 100.0 | ||
| KOG3516|consensus | 1306 | 100.0 | ||
| KOG3516|consensus | 1306 | 100.0 | ||
| KOG3514|consensus | 1591 | 100.0 | ||
| KOG1219|consensus | 4289 | 100.0 | ||
| KOG4289|consensus | 2531 | 99.97 | ||
| PF00054 | 131 | Laminin_G_1: Laminin G domain; InterPro: IPR012679 | 99.92 | |
| smart00282 | 135 | LamG Laminin G domain. | 99.9 | |
| cd00110 | 151 | LamG Laminin G domain; Laminin G-like domains are | 99.9 | |
| PF00054 | 131 | Laminin_G_1: Laminin G domain; InterPro: IPR012679 | 99.86 | |
| PF02210 | 128 | Laminin_G_2: Laminin G domain; InterPro: IPR012680 | 99.85 | |
| KOG1219|consensus | 4289 | 99.84 | ||
| smart00282 | 135 | LamG Laminin G domain. | 99.78 | |
| cd00110 | 151 | LamG Laminin G domain; Laminin G-like domains are | 99.76 | |
| PF02210 | 128 | Laminin_G_2: Laminin G domain; InterPro: IPR012680 | 99.68 | |
| KOG3509|consensus | 964 | 99.33 | ||
| smart00210 | 184 | TSPN Thrombospondin N-terminal -like domains. Hepa | 99.03 | |
| PF13385 | 157 | Laminin_G_3: Concanavalin A-like lectin/glucanases | 98.7 | |
| KOG1214|consensus | 1289 | 98.6 | ||
| KOG1217|consensus | 487 | 98.56 | ||
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 98.52 | |
| smart00159 | 206 | PTX Pentraxin / C-reactive protein / pentaxin fami | 98.48 | |
| KOG1214|consensus | 1289 | 98.47 | ||
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 98.47 | |
| cd00152 | 201 | PTX Pentraxins are plasma proteins characterized b | 98.4 | |
| KOG3509|consensus | 964 | 98.32 | ||
| smart00210 | 184 | TSPN Thrombospondin N-terminal -like domains. Hepa | 98.32 | |
| PF00354 | 195 | Pentaxin: Pentaxin family; InterPro: IPR001759 Pen | 98.26 | |
| KOG1225|consensus | 525 | 98.04 | ||
| cd05725 | 69 | Ig3_Robo Third immunoglobulin (Ig)-like domain in | 98.04 | |
| KOG1225|consensus | 525 | 98.03 | ||
| cd05852 | 73 | Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig | 97.96 | |
| cd05876 | 71 | Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o | 97.94 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 97.91 | |
| KOG1217|consensus | 487 | 97.9 | ||
| KOG0994|consensus | 1758 | 97.89 | ||
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 97.88 | |
| cd05745 | 74 | Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom | 97.87 | |
| cd05863 | 67 | Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain | 97.85 | |
| PF13385 | 157 | Laminin_G_3: Concanavalin A-like lectin/glucanases | 97.82 | |
| cd05851 | 88 | Ig3_Contactin-1 Third Ig domain of contactin-1. Ig | 97.8 | |
| cd05864 | 70 | Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain | 97.79 | |
| cd07702 | 72 | Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain | 97.79 | |
| cd05746 | 69 | Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do | 97.78 | |
| cd04976 | 71 | Ig2_VEGFR Second immunoglobulin (Ig)-like domain o | 97.75 | |
| cd05731 | 71 | Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom | 97.75 | |
| cd05723 | 71 | Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai | 97.74 | |
| cd05763 | 75 | Ig_1 Subgroup of the immunoglobulin (Ig) superfami | 97.73 | |
| PF02973 | 190 | Sialidase: Sialidase, N-terminal domain; InterPro: | 97.7 | |
| cd05760 | 77 | Ig2_PTK7 Second immunoglobulin (Ig)-like domain of | 97.7 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 97.7 | |
| cd04969 | 73 | Ig5_Contactin_like Fifth Ig domain of contactin. I | 97.69 | |
| cd05855 | 79 | Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of T | 97.67 | |
| cd05893 | 75 | Ig_Palladin_C C-terminal immunoglobulin (Ig)-like | 97.65 | |
| cd05867 | 76 | Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do | 97.64 | |
| cd04971 | 81 | Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of | 97.63 | |
| cd05738 | 74 | Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l | 97.63 | |
| cd05748 | 74 | Ig_Titin_like Immunoglobulin (Ig)-like domain of t | 97.6 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 97.6 | |
| cd04973 | 79 | Ig1_FGFR First immunoglobulin (Ig)-like domain of | 97.6 | |
| cd04968 | 88 | Ig3_Contactin_like Third Ig domain of contactin. I | 97.6 | |
| cd05743 | 78 | Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai | 97.59 | |
| cd05892 | 75 | Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like | 97.59 | |
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 97.57 | |
| cd05873 | 87 | Ig_Sema4D_like Immunoglobulin (Ig)-like domain of | 97.56 | |
| cd00152 | 201 | PTX Pentraxins are plasma proteins characterized b | 97.55 | |
| cd05764 | 74 | Ig_2 Subgroup of the immunoglobulin (Ig) superfami | 97.53 | |
| cd05740 | 91 | Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai | 97.52 | |
| smart00159 | 206 | PTX Pentraxin / C-reactive protein / pentaxin fami | 97.51 | |
| cd05868 | 76 | Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o | 97.51 | |
| cd05754 | 85 | Ig3_Perlecan_like Third immunoglobulin (Ig)-like d | 97.51 | |
| cd05750 | 75 | Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain | 97.5 | |
| cd05757 | 92 | Ig2_IL1R_like Second immunoglobulin (Ig)-like doma | 97.48 | |
| cd05762 | 98 | Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of | 97.47 | |
| cd05853 | 85 | Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig | 97.47 | |
| cd05734 | 79 | Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain | 97.43 | |
| cd05756 | 94 | Ig1_IL1R_like First immunoglobulin (Ig)-like domai | 97.42 | |
| cd04975 | 101 | Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma | 97.41 | |
| cd04978 | 76 | Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like | 97.38 | |
| cd05744 | 75 | Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain | 97.36 | |
| cd05866 | 92 | Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o | 97.36 | |
| cd05728 | 85 | Ig4_Contactin-2-like Fourth Ig domain of the neura | 97.36 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 97.35 | |
| smart00560 | 133 | LamGL LamG-like jellyroll fold domain. | 97.34 | |
| cd05726 | 90 | Ig4_Robo Fhird immunoglobulin (Ig)-like domain in | 97.34 | |
| KOG3513|consensus | 1051 | 97.34 | ||
| cd05733 | 77 | Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom | 97.33 | |
| cd05739 | 69 | Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li | 97.32 | |
| cd05859 | 101 | Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do | 97.29 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 97.27 | |
| cd05724 | 86 | Ig2_Robo Second immunoglobulin (Ig)-like domain in | 97.26 | |
| cd05895 | 76 | Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai | 97.26 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 97.24 | |
| cd05856 | 82 | Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do | 97.24 | |
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 97.23 | |
| cd05849 | 93 | Ig1_Contactin-1 First Ig domain of contactin-1. Ig | 97.22 | |
| cd05865 | 96 | Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o | 97.22 | |
| cd04977 | 92 | Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom | 97.2 | |
| cd05737 | 92 | Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- | 97.2 | |
| cd04970 | 85 | Ig6_Contactin_like Sixth Ig domain of contactin. I | 97.19 | |
| cd05894 | 86 | Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card | 97.19 | |
| cd05730 | 95 | Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom | 97.19 | |
| cd05854 | 85 | Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig | 97.18 | |
| cd05848 | 94 | Ig1_Contactin-5 First Ig domain of contactin-5. Ig | 97.15 | |
| cd05857 | 85 | Ig2_FGFR Second immunoglobulin (Ig)-like domain of | 97.14 | |
| KOG4260|consensus | 350 | 97.14 | ||
| cd05897 | 95 | Ig2_IL1R2_like Second immunoglobulin (Ig)-like dom | 97.14 | |
| cd05850 | 94 | Ig1_Contactin-2 First Ig domain of contactin-2. Ig | 97.13 | |
| cd05736 | 76 | Ig2_Follistatin_like Second immunoglobulin (Ig)-li | 97.11 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 97.1 | |
| PF00047 | 64 | ig: Immunoglobulin domain The Prosite family only | 97.08 | |
| cd05747 | 92 | Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like | 97.08 | |
| cd05875 | 77 | Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-li | 97.07 | |
| cd04974 | 90 | Ig3_FGFR Third immunoglobulin (Ig)-like domain of | 97.03 | |
| cd05735 | 88 | Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down | 97.02 | |
| smart00408 | 63 | IGc2 Immunoglobulin C-2 Type. | 97.0 | |
| cd04967 | 91 | Ig1_Contactin First Ig domain of contactin. Ig1_Co | 96.96 | |
| cd04972 | 90 | Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o | 96.95 | |
| KOG1226|consensus | 783 | 96.93 | ||
| cd05869 | 97 | Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o | 96.91 | |
| cd05727 | 96 | Ig2_Contactin-2-like Second Ig domain of the neura | 96.9 | |
| cd04979 | 89 | Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of | 96.86 | |
| cd05874 | 77 | Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of | 96.84 | |
| PF12661 | 13 | hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E | 96.83 | |
| cd05732 | 96 | Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom | 96.82 | |
| PF07679 | 90 | I-set: Immunoglobulin I-set domain; InterPro: IPR0 | 96.81 | |
| cd05749 | 81 | Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom | 96.81 | |
| cd05870 | 98 | Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o | 96.75 | |
| cd05742 | 84 | Ig1_VEGFR_like First immunoglobulin (Ig)-like doma | 96.73 | |
| cd05845 | 95 | Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do | 96.67 | |
| PF00354 | 195 | Pentaxin: Pentaxin family; InterPro: IPR001759 Pen | 96.66 | |
| KOG4260|consensus | 350 | 96.65 | ||
| cd05858 | 90 | Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o | 96.64 | |
| KOG4194|consensus | 873 | 96.63 | ||
| cd05891 | 92 | Ig_M-protein_C C-terminal immunoglobulin (Ig)-like | 96.62 | |
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 96.62 | |
| cd05861 | 84 | Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like | 96.6 | |
| cd05722 | 95 | Ig1_Neogenin First immunoglobulin (Ig)-like domain | 96.59 | |
| PHA02826 | 227 | IL-1 receptor-like protein; Provisional | 96.58 | |
| cd05765 | 81 | Ig_3 Subgroup of the immunoglobulin (Ig) superfami | 96.57 | |
| PF12661 | 13 | hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E | 96.55 | |
| cd05871 | 91 | Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do | 96.51 | |
| cd05773 | 109 | Ig8_hNephrin_like Eighth immunoglobulin-like domai | 96.5 | |
| cd05896 | 104 | Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like | 96.49 | |
| cd05882 | 95 | Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- | 96.47 | |
| PHA03099 | 139 | epidermal growth factor-like protein (EGF-like pro | 96.39 | |
| cd05753 | 83 | Ig2_FcgammaR_like Second immunoglobulin (Ig)-like | 96.38 | |
| cd05872 | 85 | Ig_Sema4B_like Immunoglobulin (Ig)-like domain of | 96.34 | |
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 96.34 | |
| cd05752 | 78 | Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do | 96.33 | |
| PF12662 | 24 | cEGF: Complement Clr-like EGF-like | 96.32 | |
| KOG1834|consensus | 952 | 96.2 | ||
| KOG3513|consensus | 1051 | 96.15 | ||
| cd05758 | 98 | Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do | 95.93 | |
| PHA02887 | 126 | EGF-like protein; Provisional | 95.87 | |
| cd05862 | 86 | Ig1_VEGFR First immunoglobulin (Ig)-like domain of | 95.75 | |
| cd07701 | 95 | Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- | 95.66 | |
| cd05729 | 85 | Ig2_FGFR_like Second immunoglobulin (Ig)-like doma | 95.63 | |
| cd07690 | 94 | Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I | 95.51 | |
| PF02973 | 190 | Sialidase: Sialidase, N-terminal domain; InterPro: | 95.43 | |
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 95.41 | |
| cd07693 | 100 | Ig1_Robo First immunoglobulin (Ig)-like domain in | 95.39 | |
| cd05900 | 112 | Ig_Aggrecan Immunoglobulin (Ig)-like domain of the | 95.3 | |
| PHA02826 | 227 | IL-1 receptor-like protein; Provisional | 95.3 | |
| cd05885 | 80 | Ig2_Necl-4 Second immunoglobulin (Ig)-like domain | 95.24 | |
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 95.23 | |
| smart00560 | 133 | LamGL LamG-like jellyroll fold domain. | 95.0 | |
| cd05774 | 105 | Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain | 94.87 | |
| PHA02887 | 126 | EGF-like protein; Provisional | 94.62 | |
| PHA02785 | 326 | IL-beta-binding protein; Provisional | 94.46 | |
| cd05901 | 117 | Ig_Versican Immunoglobulin (Ig)-like domain of the | 94.43 | |
| cd05751 | 91 | Ig1_LILRB1_like First immunoglobulin (Ig)-like dom | 94.35 | |
| PHA03099 | 139 | epidermal growth factor-like protein (EGF-like pro | 94.21 | |
| PHA02785 | 326 | IL-beta-binding protein; Provisional | 94.19 | |
| smart00410 | 86 | IG_like Immunoglobulin like. IG domains that canno | 93.61 | |
| smart00409 | 86 | IG Immunoglobulin. | 93.61 | |
| PF13927 | 75 | Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1V | 93.6 | |
| KOG4222|consensus | 1281 | 93.56 | ||
| smart00051 | 63 | DSL delta serrate ligand. | 93.49 | |
| PHA02633 | 63 | hypothetical protein; Provisional | 93.48 | |
| cd05879 | 116 | Ig_P0 Immunoglobulin (Ig)-like domain of Protein z | 93.33 | |
| PF06439 | 185 | DUF1080: Domain of Unknown Function (DUF1080); Int | 93.06 | |
| KOG1836|consensus | 1705 | 93.0 | ||
| PF07354 | 271 | Sp38: Zona-pellucida-binding protein (Sp38); Inter | 92.7 | |
| PF13895 | 80 | Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V | 92.62 | |
| cd05898 | 98 | Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain | 92.6 | |
| KOG1836|consensus | 1705 | 92.49 | ||
| cd05886 | 99 | Ig1_Nectin-1_like First immunoglobulin (Ig) domain | 92.45 | |
| cd05888 | 100 | Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain | 92.19 | |
| cd05714 | 106 | Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of cho | 92.05 | |
| cd05741 | 92 | Ig_CEACAM_D1_like First immunoglobulin (Ig)-like d | 92.02 | |
| PF12662 | 24 | cEGF: Complement Clr-like EGF-like | 91.78 | |
| cd05759 | 82 | Ig2_KIRREL3-like Second immunoglobulin (Ig)-like d | 91.78 | |
| KOG0994|consensus | 1758 | 91.78 | ||
| cd05713 | 100 | Ig_MOG_like Immunoglobulin (Ig)-like domain of mye | 91.6 | |
| PF06247 | 197 | Plasmod_Pvs28: Plasmodium ookinete surface protein | 91.36 | |
| cd00096 | 74 | Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) | 91.36 | |
| smart00051 | 63 | DSL delta serrate ligand. | 91.28 | |
| KOG4221|consensus | 1381 | 91.2 | ||
| cd05887 | 96 | Ig1_Nectin-3_like First immunoglobulin (Ig) domain | 91.15 | |
| KOG4194|consensus | 873 | 91.1 | ||
| KOG1226|consensus | 783 | 91.09 | ||
| cd05880 | 115 | Ig_EVA1 Immunoglobulin (Ig)-like domain of epithel | 91.08 | |
| PF14670 | 36 | FXa_inhibition: Coagulation Factor Xa inhibitory s | 90.9 | |
| cd05717 | 95 | Ig1_Necl-1-3_like First (N-terminal) immunoglobuli | 90.81 | |
| cd05881 | 95 | Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- | 90.75 | |
| cd05775 | 97 | Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig) | 90.34 | |
| cd05889 | 96 | Ig1_DNAM-1_like First immunoglobulin (Ig) domain o | 90.22 | |
| cd05877 | 106 | Ig_LP_like Immunoglobulin (Ig)-like domain of huma | 89.94 | |
| cd05718 | 98 | Ig1_PVR_like First immunoglobulin (Ig) domain of p | 89.89 | |
| cd05715 | 116 | Ig_P0-like Immunoglobulin (Ig)-like domain of Prot | 89.78 | |
| cd05878 | 110 | Ig_Aggrecan_like Immunoglobulin (Ig)-like domain o | 89.78 | |
| KOG4222|consensus | 1281 | 89.58 | ||
| cd00099 | 105 | IgV Immunoglobulin variable domain (IgV). IgV: Imm | 89.2 | |
| cd05902 | 110 | Ig_Neurocan Immunoglobulin (Ig)-like domain of the | 88.74 | |
| cd00055 | 50 | EGF_Lam Laminin-type epidermal growth factor-like | 88.41 | |
| cd05711 | 94 | Ig_FcalphaRI Immunoglobulin (IG)-like domain of of | 88.32 | |
| cd05846 | 97 | Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain | 87.77 | |
| cd04983 | 109 | IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V | 87.64 | |
| smart00406 | 81 | IGv Immunoglobulin V-Type. | 87.48 | |
| PF00053 | 49 | Laminin_EGF: Laminin EGF-like (Domains III and V); | 87.32 | |
| cd05771 | 139 | IgC_Tapasin_R Tapasin-R immunoglobulin-like domain | 87.21 | |
| cd04984 | 98 | IgV_L_lambda Immunoglobulin (Ig) lambda light chai | 86.19 | |
| KOG3546|consensus | 1167 | 85.81 | ||
| KOG4221|consensus | 1381 | 85.63 | ||
| cd05899 | 110 | IgV_TCR_beta Immunoglobulin (Ig) variable (V) doma | 85.57 | |
| cd07692 | 65 | Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of | 85.44 | |
| PF01414 | 63 | DSL: Delta serrate ligand; InterPro: IPR001774 Lig | 85.13 | |
| cd01475 | 224 | vWA_Matrilin VWA_Matrilin: In cartilaginous plate, | 85.02 | |
| smart00180 | 46 | EGF_Lam Laminin-type epidermal growth factor-like | 84.78 | |
| cd04980 | 106 | IgV_L_kappa Immunoglobulin (Ig) light chain, kappa | 84.74 | |
| PF06247 | 197 | Plasmod_Pvs28: Plasmodium ookinete surface protein | 84.41 | |
| PF06439 | 185 | DUF1080: Domain of Unknown Function (DUF1080); Int | 84.0 | |
| PF14670 | 36 | FXa_inhibition: Coagulation Factor Xa inhibitory s | 83.85 | |
| PF01414 | 63 | DSL: Delta serrate ligand; InterPro: IPR001774 Lig | 83.57 | |
| PF07686 | 114 | V-set: Immunoglobulin V-set domain; InterPro: IPR0 | 83.48 | |
| cd05712 | 119 | Ig_Siglec_N Immunoglobulin (Ig) domain at the N te | 83.27 | |
| cd05716 | 98 | Ig_pIgR Immunoglobulin (Ig)-like domain in the pol | 82.38 | |
| cd00098 | 95 | IgC Immunoglobulin Constant domain. IgC: Immunoglo | 81.73 | |
| cd05720 | 104 | Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD | 81.68 | |
| cd04982 | 116 | IgV_TCR_gamma Immunoglobulin (Ig) variable (V) dom | 80.16 |
| >KOG3514|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.2e-63 Score=542.82 Aligned_cols=689 Identities=23% Similarity=0.408 Sum_probs=517.6
Q ss_pred CceeEEEcCCcceeeeeCCcccCCCcceeeeeCCCCCCCcCC----CCccCCCCccceEEEEEEcCEEEEeecccccccC
Q psy9228 56 VERMMFVDGIGPFSGESQGAFQGLDLSELVYIGAVPDFGEIH----PSAGFSNGFKGCVSRLKYNKTEFELFKMAVERVG 131 (834)
Q Consensus 56 ~~g~~cvd~~~~~~~~~~~~~~g~~~~~~~~~gg~p~~~~~~----~~~~~~~gf~gCi~~~~~~~~~~~~~~~~~~~~~ 131 (834)
+|-.|-||++..+.-.-...|.-.+.-.++||||+|....++ +.....+.|.|-+..|.+...+-.+...+....+
T Consensus 117 e~t~L~vDgv~~~~~~~~~~f~fg~iasdvfVGGlP~~~~la~l~lp~v~yep~frg~~rnl~y~~~p~g~t~~q~l~~~ 196 (1591)
T KOG3514|consen 117 ENTKLEVDGVLVFKILNQRSFVFGNIASDVFVGGLPNMHMLAVLSLPLVRYEPRFRGNVRNLMYRQYPQGVTSPQLLEVG 196 (1591)
T ss_pred ccceEEechhhhhhhhhcceeeeeeeehheeecCCChHHhhhhhcCcccccccccCccceeeeeecCCCCcCChhhhhcc
Confidence 577899999877766666667666666799999999655433 2356677888999988887766554443222222
Q ss_pred CCCCCccCCCCCCCCCCCCEeccCCCCCceEeeCCCCCCCCCCCCCCCCccC-CCCCC-CeeecCCCCeEEeCCCCcccC
Q psy9228 132 VDSCNTCKSSKHNNCINNGLCQDAATRIGYTCICPPGFSGDRCSVLGEPCYP-GACGD-GSCQDVDGAMKCLCPIGTAGK 209 (834)
Q Consensus 132 ~~~c~~C~~~~~~pC~n~g~C~~~~~~~~~~C~C~~g~~G~~Ce~~~~~C~~-~~C~~-g~C~~~~~~~~C~C~~g~~G~ 209 (834)
.. ..|. +.+|... ..|.. .+|++ |.|.....+.+|.|..-+.|.
T Consensus 197 ~d--~~c~---d~~~~~~-----------------------------~~~~~~~~c~~~g~c~s~d~gp~c~c~~~~dgq 242 (1591)
T KOG3514|consen 197 TD--TNCD---DHCKSKS-----------------------------MSSREQFVCLNDGECYSSDDGPHCDCQFDHDGQ 242 (1591)
T ss_pred cC--CCCc---CCCCCcc-----------------------------ccccccceeccCCeEecCCCCCccccccccCcc
Confidence 11 1233 2222221 11221 34554 677777777888888888889
Q ss_pred cccccccccccCCCCcceEEcCCCCCc---ceEEEEEEEcccCCCceEEEeecccCCCCCCeEEEEEecCeEEEEEecCC
Q psy9228 210 RCEQKIKILQPAFKHGSYLAYPTPKTM---RKFKVSLRLNPRDVRDGIILYSGQSDDGLGDFISLAIREKHMEFRFDTGS 286 (834)
Q Consensus 210 ~Ce~~~~~~~~~F~g~~y~~~~~~~~~---~~~~i~l~f~t~~~~~glll~~~~~~~~~~d~~~l~l~~G~v~~~~~~g~ 286 (834)
+||++.....+.|.|.-|+.|....+. ...+|+|.|||. +.+|||||.+.. .||+.|.|++|.|.+.+++++
T Consensus 243 ~cekeK~~~eaTF~G~ef~~YDls~npI~s~~d~itl~FrT~-q~ngllfytG~~----~dYlnlaL~dGaV~l~~~l~~ 317 (1591)
T KOG3514|consen 243 NCEKEKNDGEATFGGDEFVGYDLSQNPIRSKKDNITLTFRTV-QGNGLLFYTGDE----KDYLNLALQDGAVSLSSKLDG 317 (1591)
T ss_pred ccccccCcceEEecCceEEEeeccCCcccccccceEEEEEEe-cCceeEEEccCC----cceeeEeecCCcEEEEEecCC
Confidence 999888788999999999999986543 678899999999 699999999976 599999999999999999998
Q ss_pred Cc--ceecCCCC--Ccccccce-eccCCCeEEEEecCCCC----CCceeeeeecCCCceeccccccccccccccccccCC
Q psy9228 287 AT--PLYSNDAP--AFNPVSTK-EAPYGSKITLTCNNDLE----APVEYTWSKRSNGHVLPFGAFSRENTLTLQEIKNSD 357 (834)
Q Consensus 287 ~~--~~~~~~~~--~~~~~~~~-~~~~~~~v~l~vd~~~~----~~~~~~~~~~~~~~~~~~gg~~~~~~~~~~~~~~~~ 357 (834)
+. .+..+... +.+.||.+ ..|+-..+++.||.... ...+++|... ...+|.|+.+.... ...+.
T Consensus 318 g~~e~~~~p~~~rfdD~~WH~V~v~R~~~m~t~~VDg~~t~~~~~a~~~tmlss--s~~fyvgg~~~~~~-----l~gsr 390 (1591)
T KOG3514|consen 318 GDAEIIRMPNSFRFDDDSWHTVIVERSLQMMTLIVDGRRTEIRQYAPELTMLSS--SDFFYVGGSPNTAD-----LPGSR 390 (1591)
T ss_pred ccceeEEccccccccCCcceEEEEEeeeEEEEEEEccEEecccccccceeEeec--cceEEecCCCCccc-----cCCCc
Confidence 86 23334333 44557755 55666778889987543 3345555332 22345555442211 11112
Q ss_pred CceEEEEeCCC-------------------------CceeEeeEEeeeeccccccCCCcccccccCCccccceeEEEEEE
Q psy9228 358 AGMYVCKVSNK-------------------------DMTVEIPSILLVTDSVPLFTQKPLSYLALPTLTDAHLHFSIELS 412 (834)
Q Consensus 358 ~~~~~C~~~~~-------------------------~~~~~~~~~~~~~~~~~~f~~~~~s~l~~~~~~~~~~~~~i~~~ 412 (834)
..+.+|++... ++...|+.. ..-.|..|..+.||+.+|.|... ..-+|+|.
T Consensus 391 VsF~GClkkV~y~~d~~rl~L~~LAk~g~~~~k~~G~l~y~C~n~---~~~DpvtFtt~es~l~LP~Wnt~-~~gSiSf~ 466 (1591)
T KOG3514|consen 391 VSFMGCLKKVVYKNDDTRLELSRLAKQGDSKMKTEGDLSYSCENV---AQLDPVTFTTPESYLTLPRWNTK-KSGSISFD 466 (1591)
T ss_pred eeeeeeeeeeEeccCceeehhhHHhhcCCceeEeeceEEEecCCC---CccCceeeecccceeeccccccC-CcceeEEE
Confidence 23556665421 111122211 12267788999999999999754 45789999
Q ss_pred EeeCCCCeeEEEeccCCccccCCCCCeEEEEEECcEEEEEEeccc--EEEE-eeeeecCCCeEEEEEEEECCeEEEEECC
Q psy9228 413 FKPTDYNGLIMYTGDSNMKSYKGKGDFVSFGLEDGYPVFRFDVGL--VVLR-SKVTLVPHEWVVVTIIKDFKEGKLSVGG 489 (834)
Q Consensus 413 frt~~~~GlLl~~~~~~~~~~~~~~d~~~l~L~~G~l~~~~~~G~--~~i~-s~~~~~dg~wH~V~v~~~~~~~~l~VD~ 489 (834)
|||+++||||+|..... ....||++++|.||++.+.+++|+ +.++ +..+++||+||+|.+.|+++.+++.||.
T Consensus 467 FRTtepnGlil~~~g~~----~~~~d~~A~ELldghlyl~ldlGSG~iklras~rkv~DGeWhhv~l~R~gR~gsvsVd~ 542 (1591)
T KOG3514|consen 467 FRTTEPNGLILFHGGPQ----ANATDYFAIELLDGHLYLLLDLGSGVIKLRASSRKVNDGEWHHVDLQRDGRTGSVSVDA 542 (1591)
T ss_pred EeecCCCceEEEccCcc----cccccEEEEEEeCCeEEEEEecCCceEEeeeecccccCCceEEEEeeccCccceEEEee
Confidence 99999999999998754 568999999999999999999985 4444 5678999999999999999999999998
Q ss_pred eeeeeeecCCCccccccCCCceeeccccCCCcccC---cCcccccCceeEEeeeEEcCeeeeeccc--ccccCCcc-cCC
Q psy9228 490 EPLIVGSTPGEKLQVLNLRTPLYLGGYNIYHVTPS---LSVEVTEGFHGCISTIDVLGSELDLINS--AVDSANIM-DCS 563 (834)
Q Consensus 490 ~~~~~~~~~g~~~~~l~~~~~l~iGG~~~~~~~~~---~~~~~~~gF~GCi~~v~ing~~~~~~~~--~~~~~~~~-~C~ 563 (834)
..... ..||. ...|+++.++|+|-.+.. ...+ +......||.|||+++.|+|+..++... +..++++. .|.
T Consensus 543 ~~~df-~tpG~-s~iL~ld~~mylG~~~n~-l~~P~~vWta~L~~GyvGCirdl~i~G~s~di~q~ae~q~sagvkpsCs 619 (1591)
T KOG3514|consen 543 IKTDF-STPGD-SEILDLDDPMYLGEVPNN-LVYPSEVWTAALRKGYVGCIRDLFIDGVSTDIRQEAEAQNSAGVKPSCS 619 (1591)
T ss_pred eecCc-cCCCc-ceeEeecCceeeccCCCC-ccCcHHHHHHHHhccchheehhheecceehhhHHHhhhccccccCcccc
Confidence 76654 46777 889999999999966664 2222 2234578999999999999999998764 44556664 677
Q ss_pred CCCCCCCCCCCCCCCCCeecccCCCCCceeeecC-CCCCCCCCccCccCCC-----------------------------
Q psy9228 564 DLESSPVCAPKPCQNYGICYPTDTSERGYNCSCL-TGYSGDHCEKENNMCM----------------------------- 613 (834)
Q Consensus 564 ~~~~~~~C~~~pC~ngg~C~~~~~~~~~~~C~C~-~G~~G~~Ce~~~~~C~----------------------------- 613 (834)
... ...|.+|||+|+|+|.+.|+ .|.|+|. .+|.|+.||.+...=.
T Consensus 620 ~~~-~~~C~~nPC~N~g~C~egwN---rfiCDCs~T~~~G~~CerE~t~ls~nGs~~m~i~L~~~~~tq~E~v~iRF~t~ 695 (1591)
T KOG3514|consen 620 LSN-EKICESNPCQNGGKCSEGWN---RFICDCSGTGFEGRTCEREATALSYNGSMSMKIVLPHTMHTQAEDVSIRFRTQ 695 (1591)
T ss_pred hhh-ccccCCCcccCCCCcccccc---ccccccccCcccCccccceeeeEEEcCeeeEEEEecccceeecceEEEEEEec
Confidence 533 23899999999999999999 9999998 8999999997311000
Q ss_pred --------------------------------------------------------------------------------
Q psy9228 614 -------------------------------------------------------------------------------- 613 (834)
Q Consensus 614 -------------------------------------------------------------------------------- 613 (834)
T Consensus 696 r~~Gll~~Tta~~s~D~l~l~L~~g~vkl~v~ls~~~nlfag~~LnDN~WHtvrv~Rrg~~L~L~vD~~~~~~~~~~g~h 775 (1591)
T KOG3514|consen 696 RAYGLLFATTARGSADTLRLELDAGQVKLFVNLSGPENLFAGQSLNDNEWHTVRVVRRGKSLLLYVDFWSVSIYTMNGIH 775 (1591)
T ss_pred ccceeEEEeccCCCCceEEEEEecceEEEEEecCCCcceeccccccCCcceEEEEEEcccceEEEeccccceeeeecCce
Confidence
Q ss_pred ---------------------------------------------------CC---------------------------
Q psy9228 614 ---------------------------------------------------KG--------------------------- 615 (834)
Q Consensus 614 ---------------------------------------------------~~--------------------------- 615 (834)
..
T Consensus 776 ~~le~~~i~~g~e~~~~s~~~~nFiG~l~~LvFNG~~Yld~~K~~~~~ls~l~a~fkl~~iv~~paTf~sk~Sy~~la~L 855 (1591)
T KOG3514|consen 776 VRLEFHNIETGTESRAPSSVPSNFIGHLSGLVFNGQDYLDKCKMGDIQLSELSARFKLRAIVADPATFKSKSSYVKLATL 855 (1591)
T ss_pred EEEEEeeeccccccccCCCCChhhhhhhhheEECcHHHHHHHhcCCcchhhcchhhCceEEeeccceeeechhhhhhhhh
Confidence 00
Q ss_pred --------------------------------------------------------------------------------
Q psy9228 616 -------------------------------------------------------------------------------- 615 (834)
Q Consensus 616 -------------------------------------------------------------------------------- 615 (834)
T Consensus 856 ~ay~s~~l~Fqfkt~sp~gll~fn~gd~ndfi~velvnG~ihYtfdlg~gp~~~k~~sr~hlnDnrWHnV~I~rd~~~~H 935 (1591)
T KOG3514|consen 856 QAYFSMHLFFQFKTTSPDGLLLFNSGDGNDFIAVELVNGYIHYTFDLGNGPTSMKGPSRQHLNDNRWHNVLIYRDKTNTH 935 (1591)
T ss_pred heeeEEEEEEEEeecCCCeEEEecCCCCCceEEEEEeCcEEEEEEEcCCCcccccCcccCcCccccceeEEEEcCCCCce
Confidence
Q ss_pred --------------------------------------------------------------------------------
Q psy9228 616 -------------------------------------------------------------------------------- 615 (834)
Q Consensus 616 -------------------------------------------------------------------------------- 615 (834)
T Consensus 936 tL~vD~s~~t~~~~g~~~l~l~g~LyiGGv~k~m~~~~p~~~asR~g~~g~~~s~dl~~r~p~L~~~a~~~s~lv~~~~s 1015 (1591)
T KOG3514|consen 936 TLKVDNSSTTQIIDGAVNLDLKGKLYIGGVSKPMYSFLPKLVASRSGFQGCLASLDLGGRLPDLISDALFESGLVEVGCS 1015 (1591)
T ss_pred EEEecCceEEEEecCccccccccceecccccccccccccceeeccCCCCCCcCccCccccchhHHHHhhhhccceeeecc
Confidence
Q ss_pred --------CccCCCceeeecCCCcEEcCCC-CCCCCCcccccccceeeEEcC-Cceeeec--hhhhhhccCcceEEEEEE
Q psy9228 616 --------DVCKNGGMCKVTPDSYECLCSL-GYAPPNCAKRVSIGSEVHFLG-EGYVELK--KELIEERRNEETIAFDFV 683 (834)
Q Consensus 616 --------~pC~ngg~C~~~~~~~~C~C~~-g~~G~~Ce~~~~~~~~~~F~g-~s~~~~~--~~~~~~~~~~~~i~~~fr 683 (834)
+-|.|.|.|+..|++|.|.|.+ .|+|+.|..+- ..+.|++ .|-|.|. ++.. .......|.+.|+
T Consensus 1016 gpst~c~~~acanhG~c~q~w~~~~c~csmtS~~Gp~C~d~g---tTYiFgk~gglI~YtwPpNdR-psTr~DrlAvGFs 1091 (1591)
T KOG3514|consen 1016 GPSTTCSEDACANHGVCIQQWNGIACDCSMTSYSGPRCNDPG---TTYIFGKSGGLITYTWPPNDR-PSTRKDRLAVGFS 1091 (1591)
T ss_pred CCCcccchhhhhccceeeeeecceeeeccccccCCCccCCCc---eEEEECCCCceEEEecCCCCC-CCcccceEEEEEE
Confidence 1389999999999999999998 89999998663 3678987 4566664 2221 2347789999999
Q ss_pred eCCCCeeEEecCCCCCCCCCCcceEEEEEECCEEEEEEEcCCcEEEEEeCCceecCCCcEEEEEEEECCEEEEEEcCeee
Q psy9228 684 TDDKNALLLWNGQPSYKNGIGREFIAVAVVNGYLEYSYDLGDGVVTIKFSKKPVNDGIKHSVNVTRINKFGSLEVDSVIV 763 (834)
Q Consensus 684 T~~~~GlLl~~~~~~~~~~~~~~~~~l~l~~G~l~~~~~~g~~~~~l~~s~~~~nDg~wH~V~i~r~~~~~~l~VD~~~~ 763 (834)
|..++|+|+.+..... -+||+.|.|..|+|-+.||+|+..+.|...+..||||++|.|+|+|.+..++|+||..++
T Consensus 1092 Ttq~daVLvRVdSAsg----lgDYlqLhI~qG~igvvfNiGt~Diti~E~~~ivNDgkYHVVRFtR~GGNATLQVD~wpV 1167 (1591)
T KOG3514|consen 1092 TTQPDAVLVRVDSASG----LGDYLQLHINQGKIGVVFNIGTDDITISEHNAIVNDGKYHVVRFTRSGGNATLQVDSWPV 1167 (1591)
T ss_pred eccCceEEEEEeccCC----CCceEEEEEeccEEEEEEeccCcccccccccccccCCceEEEEEEecCCceEEEecccch
Confidence 9999999999876541 379999999999999999999998888877889999999999999999999999999998
Q ss_pred ecccCCCC-ccceecCCceEEcCcCCCCCCCCCccCCCceEEEEEEEECCceecccCCCC
Q psy9228 764 GKGESPGS-QDVINTRGNIYLGGTPNMDLMTGGRYVHPMSGLMMNIHIQNKHISNIGSSA 822 (834)
Q Consensus 764 ~~~~~~~~-~~~l~~~~~lyiGG~p~~~~~~~~~~~~~F~GCi~~v~in~~~~~~l~~~a 822 (834)
......+. ...+|....|-|||.-.. ..|.|-|..|.+||-.+++|....
T Consensus 1168 ~e~yP~grqlTiFNtqa~I~IGGk~qG---------RpFqGqiSGLyyNgLkVLdlAaE~ 1218 (1591)
T KOG3514|consen 1168 NERYPAGRQLTIFNSQARISIGGKFQG---------RPFQGQISGLYYNGLKVLDLAAEN 1218 (1591)
T ss_pred hhccCCCceeEEeeccceEEecccccC---------CcccceecceEEcceeeeehhhcc
Confidence 77655544 356888899999996522 479999999999999999997654
|
|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >KOG3516|consensus | Back alignment and domain information |
|---|
| >KOG3516|consensus | Back alignment and domain information |
|---|
| >KOG3514|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >PF00054 Laminin_G_1: Laminin G domain; InterPro: IPR012679 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] | Back alignment and domain information |
|---|
| >smart00282 LamG Laminin G domain | Back alignment and domain information |
|---|
| >cd00110 LamG Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans | Back alignment and domain information |
|---|
| >PF00054 Laminin_G_1: Laminin G domain; InterPro: IPR012679 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] | Back alignment and domain information |
|---|
| >PF02210 Laminin_G_2: Laminin G domain; InterPro: IPR012680 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >smart00282 LamG Laminin G domain | Back alignment and domain information |
|---|
| >cd00110 LamG Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans | Back alignment and domain information |
|---|
| >PF02210 Laminin_G_2: Laminin G domain; InterPro: IPR012680 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] | Back alignment and domain information |
|---|
| >KOG3509|consensus | Back alignment and domain information |
|---|
| >smart00210 TSPN Thrombospondin N-terminal -like domains | Back alignment and domain information |
|---|
| >PF13385 Laminin_G_3: Concanavalin A-like lectin/glucanases superfamily; PDB: 4DQA_A 1N1Y_A 1MZ6_A 1MZ5_A 1N1S_A 2A75_A 1WCS_A 1N1T_A 1N1V_A 2FHR_A | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >smart00159 PTX Pentraxin / C-reactive protein / pentaxin family | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >cd00152 PTX Pentraxins are plasma proteins characterized by their pentameric discoid assembly and their Ca2+ dependent ligand binding, such as Serum amyloid P component (SAP) and C-reactive Protein (CRP), which are cytokine-inducible acute-phase proteins implicated in innate immunity | Back alignment and domain information |
|---|
| >KOG3509|consensus | Back alignment and domain information |
|---|
| >smart00210 TSPN Thrombospondin N-terminal -like domains | Back alignment and domain information |
|---|
| >PF00354 Pentaxin: Pentaxin family; InterPro: IPR001759 Pentaxins (or pentraxins) [, ] are a family of proteins which show, under electron microscopy, a discoid arrangement of five noncovalently bound subunits | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 | Back alignment and domain information |
|---|
| >cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin | Back alignment and domain information |
|---|
| >cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) | Back alignment and domain information |
|---|
| >PF13385 Laminin_G_3: Concanavalin A-like lectin/glucanases superfamily; PDB: 4DQA_A 1N1Y_A 1MZ6_A 1MZ5_A 1N1S_A 2A75_A 1WCS_A 1N1T_A 1N1V_A 2FHR_A | Back alignment and domain information |
|---|
| >cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 | Back alignment and domain information |
|---|
| >cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) | Back alignment and domain information |
|---|
| >cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) | Back alignment and domain information |
|---|
| >cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin | Back alignment and domain information |
|---|
| >cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) | Back alignment and domain information |
|---|
| >cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) | Back alignment and domain information |
|---|
| >cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins | Back alignment and domain information |
|---|
| >cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily | Back alignment and domain information |
|---|
| >PF02973 Sialidase: Sialidase, N-terminal domain; InterPro: IPR004124 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >cd04969 Ig5_Contactin_like Fifth Ig domain of contactin | Back alignment and domain information |
|---|
| >cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB | Back alignment and domain information |
|---|
| >cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin | Back alignment and domain information |
|---|
| >cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) | Back alignment and domain information |
|---|
| >cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC | Back alignment and domain information |
|---|
| >cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR | Back alignment and domain information |
|---|
| >cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) | Back alignment and domain information |
|---|
| >cd04968 Ig3_Contactin_like Third Ig domain of contactin | Back alignment and domain information |
|---|
| >cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 | Back alignment and domain information |
|---|
| >cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D | Back alignment and domain information |
|---|
| >cd00152 PTX Pentraxins are plasma proteins characterized by their pentameric discoid assembly and their Ca2+ dependent ligand binding, such as Serum amyloid P component (SAP) and C-reactive Protein (CRP), which are cytokine-inducible acute-phase proteins implicated in innate immunity | Back alignment and domain information |
|---|
| >cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily | Back alignment and domain information |
|---|
| >cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) | Back alignment and domain information |
|---|
| >smart00159 PTX Pentraxin / C-reactive protein / pentaxin family | Back alignment and domain information |
|---|
| >cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) | Back alignment and domain information |
|---|
| >cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins | Back alignment and domain information |
|---|
| >cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) | Back alignment and domain information |
|---|
| >cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins | Back alignment and domain information |
|---|
| >cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) | Back alignment and domain information |
|---|
| >cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 | Back alignment and domain information |
|---|
| >cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) | Back alignment and domain information |
|---|
| >cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins | Back alignment and domain information |
|---|
| >cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins | Back alignment and domain information |
|---|
| >cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) | Back alignment and domain information |
|---|
| >cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin | Back alignment and domain information |
|---|
| >cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 | Back alignment and domain information |
|---|
| >cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >smart00560 LamGL LamG-like jellyroll fold domain | Back alignment and domain information |
|---|
| >cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >KOG3513|consensus | Back alignment and domain information |
|---|
| >cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins | Back alignment and domain information |
|---|
| >cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR | Back alignment and domain information |
|---|
| >cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 | Back alignment and domain information |
|---|
| >cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 | Back alignment and domain information |
|---|
| >cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins | Back alignment and domain information |
|---|
| >cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein | Back alignment and domain information |
|---|
| >cd04970 Ig6_Contactin_like Sixth Ig domain of contactin | Back alignment and domain information |
|---|
| >cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) | Back alignment and domain information |
|---|
| >cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) | Back alignment and domain information |
|---|
| >cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 | Back alignment and domain information |
|---|
| >cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 | Back alignment and domain information |
|---|
| >cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor | Back alignment and domain information |
|---|
| >KOG4260|consensus | Back alignment and domain information |
|---|
| >cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2) | Back alignment and domain information |
|---|
| >cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 | Back alignment and domain information |
|---|
| >cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >PF00047 ig: Immunoglobulin domain The Prosite family only concerns antibodies and MHCs | Back alignment and domain information |
|---|
| >cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins | Back alignment and domain information |
|---|
| >cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) | Back alignment and domain information |
|---|
| >cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) | Back alignment and domain information |
|---|
| >cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) | Back alignment and domain information |
|---|
| >smart00408 IGc2 Immunoglobulin C-2 Type | Back alignment and domain information |
|---|
| >cd04967 Ig1_Contactin First Ig domain of contactin | Back alignment and domain information |
|---|
| >cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC | Back alignment and domain information |
|---|
| >KOG1226|consensus | Back alignment and domain information |
|---|
| >cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) | Back alignment and domain information |
|---|
| >cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins | Back alignment and domain information |
|---|
| >cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin | Back alignment and domain information |
|---|
| >cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) | Back alignment and domain information |
|---|
| >PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A | Back alignment and domain information |
|---|
| >cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins | Back alignment and domain information |
|---|
| >PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds | Back alignment and domain information |
|---|
| >cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) | Back alignment and domain information |
|---|
| >cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) | Back alignment and domain information |
|---|
| >cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins | Back alignment and domain information |
|---|
| >cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins | Back alignment and domain information |
|---|
| >PF00354 Pentaxin: Pentaxin family; InterPro: IPR001759 Pentaxins (or pentraxins) [, ] are a family of proteins which show, under electron microscopy, a discoid arrangement of five noncovalently bound subunits | Back alignment and domain information |
|---|
| >KOG4260|consensus | Back alignment and domain information |
|---|
| >cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) | Back alignment and domain information |
|---|
| >KOG4194|consensus | Back alignment and domain information |
|---|
| >cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) | Back alignment and domain information |
|---|
| >cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins | Back alignment and domain information |
|---|
| >PHA02826 IL-1 receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily | Back alignment and domain information |
|---|
| >PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A | Back alignment and domain information |
|---|
| >cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin | Back alignment and domain information |
|---|
| >cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin | Back alignment and domain information |
|---|
| >cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1) | Back alignment and domain information |
|---|
| >cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) | Back alignment and domain information |
|---|
| >PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional | Back alignment and domain information |
|---|
| >cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins | Back alignment and domain information |
|---|
| >cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins | Back alignment and domain information |
|---|
| >PF12662 cEGF: Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >KOG1834|consensus | Back alignment and domain information |
|---|
| >KOG3513|consensus | Back alignment and domain information |
|---|
| >cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins | Back alignment and domain information |
|---|
| >PHA02887 EGF-like protein; Provisional | Back alignment and domain information |
|---|
| >cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) | Back alignment and domain information |
|---|
| >cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) | Back alignment and domain information |
|---|
| >cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins | Back alignment and domain information |
|---|
| >cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 | Back alignment and domain information |
|---|
| >PF02973 Sialidase: Sialidase, N-terminal domain; InterPro: IPR004124 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins | Back alignment and domain information |
|---|
| >cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan | Back alignment and domain information |
|---|
| >PHA02826 IL-1 receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4, also known as cell adhesion molecule 4 (CADM4)) | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >smart00560 LamGL LamG-like jellyroll fold domain | Back alignment and domain information |
|---|
| >cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) | Back alignment and domain information |
|---|
| >PHA02887 EGF-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02785 IL-beta-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican | Back alignment and domain information |
|---|
| >cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins | Back alignment and domain information |
|---|
| >PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional | Back alignment and domain information |
|---|
| >PHA02785 IL-beta-binding protein; Provisional | Back alignment and domain information |
|---|
| >smart00410 IG_like Immunoglobulin like | Back alignment and domain information |
|---|
| >smart00409 IG Immunoglobulin | Back alignment and domain information |
|---|
| >PF13927 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C | Back alignment and domain information |
|---|
| >KOG4222|consensus | Back alignment and domain information |
|---|
| >smart00051 DSL delta serrate ligand | Back alignment and domain information |
|---|
| >PHA02633 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0) | Back alignment and domain information |
|---|
| >PF06439 DUF1080: Domain of Unknown Function (DUF1080); InterPro: IPR010496 This is a family of proteins of unknown function | Back alignment and domain information |
|---|
| >KOG1836|consensus | Back alignment and domain information |
|---|
| >PF07354 Sp38: Zona-pellucida-binding protein (Sp38); InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals | Back alignment and domain information |
|---|
| >PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A | Back alignment and domain information |
|---|
| >cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) | Back alignment and domain information |
|---|
| >KOG1836|consensus | Back alignment and domain information |
|---|
| >cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins | Back alignment and domain information |
|---|
| >cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins | Back alignment and domain information |
|---|
| >cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins | Back alignment and domain information |
|---|
| >cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins | Back alignment and domain information |
|---|
| >PF12662 cEGF: Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) | Back alignment and domain information |
|---|
| >PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium | Back alignment and domain information |
|---|
| >cd00096 Ig Immunoglobulin domain | Back alignment and domain information |
|---|
| >smart00051 DSL delta serrate ligand | Back alignment and domain information |
|---|
| >KOG4221|consensus | Back alignment and domain information |
|---|
| >cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins | Back alignment and domain information |
|---|
| >KOG4194|consensus | Back alignment and domain information |
|---|
| >KOG1226|consensus | Back alignment and domain information |
|---|
| >cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA) | Back alignment and domain information |
|---|
| >PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A | Back alignment and domain information |
|---|
| >cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) | Back alignment and domain information |
|---|
| >cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) | Back alignment and domain information |
|---|
| >cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like | Back alignment and domain information |
|---|
| >cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins | Back alignment and domain information |
|---|
| >cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) | Back alignment and domain information |
|---|
| >cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins | Back alignment and domain information |
|---|
| >cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins | Back alignment and domain information |
|---|
| >cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG) | Back alignment and domain information |
|---|
| >KOG4222|consensus | Back alignment and domain information |
|---|
| >cd00099 IgV Immunoglobulin variable domain (IgV) | Back alignment and domain information |
|---|
| >cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan | Back alignment and domain information |
|---|
| >cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies | Back alignment and domain information |
|---|
| >cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI | Back alignment and domain information |
|---|
| >cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins | Back alignment and domain information |
|---|
| >cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins | Back alignment and domain information |
|---|
| >smart00406 IGv Immunoglobulin V-Type | Back alignment and domain information |
|---|
| >PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation | Back alignment and domain information |
|---|
| >cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain | Back alignment and domain information |
|---|
| >cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain | Back alignment and domain information |
|---|
| >KOG3546|consensus | Back alignment and domain information |
|---|
| >KOG4221|consensus | Back alignment and domain information |
|---|
| >cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain | Back alignment and domain information |
|---|
| >cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain | Back alignment and domain information |
|---|
| >PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates | Back alignment and domain information |
|---|
| >cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity | Back alignment and domain information |
|---|
| >smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai | Back alignment and domain information |
|---|
| >cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain | Back alignment and domain information |
|---|
| >PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium | Back alignment and domain information |
|---|
| >PF06439 DUF1080: Domain of Unknown Function (DUF1080); InterPro: IPR010496 This is a family of proteins of unknown function | Back alignment and domain information |
|---|
| >PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A | Back alignment and domain information |
|---|
| >PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates | Back alignment and domain information |
|---|
| >PF07686 V-set: Immunoglobulin V-set domain; InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds | Back alignment and domain information |
|---|
| >cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins) | Back alignment and domain information |
|---|
| >cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) | Back alignment and domain information |
|---|
| >cd00098 IgC Immunoglobulin Constant domain | Back alignment and domain information |
|---|
| >cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain | Back alignment and domain information |
|---|
| >cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 834 | ||||
| 3qcw_A | 1245 | Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), | 4e-21 | ||
| 3qcw_A | 1245 | Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), | 6e-10 | ||
| 3r05_A | 1254 | Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), | 1e-19 | ||
| 3r05_A | 1254 | Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), | 6e-10 | ||
| 3poy_A | 1019 | Crystal Structure Of The Alpha-Neurexin-1 Ectodomai | 2e-19 | ||
| 3poy_A | 1019 | Crystal Structure Of The Alpha-Neurexin-1 Ectodomai | 2e-12 | ||
| 3poy_A | 1019 | Crystal Structure Of The Alpha-Neurexin-1 Ectodomai | 7e-10 | ||
| 3sh4_A | 195 | Laminin G Like Domain 3 From Human Perlecan Length | 2e-19 | ||
| 3asi_A | 410 | Alpha-Neurexin-1 Ectodomain Fragment; Lns5-Egf3-Lns | 4e-19 | ||
| 1pz7_A | 204 | Modulation Of Agrin Function By Alternative Splicin | 1e-14 | ||
| 1pz7_A | 204 | Modulation Of Agrin Function By Alternative Splicin | 9e-08 | ||
| 1q56_A | 195 | Nmr Structure Of The B0 Isoform Of The Agrin G3 Dom | 1e-14 | ||
| 1q56_A | 195 | Nmr Structure Of The B0 Isoform Of The Agrin G3 Dom | 2e-08 | ||
| 1pz8_A | 201 | Modulation Of Agrin Function By Alternative Splicin | 1e-14 | ||
| 1pz8_A | 201 | Modulation Of Agrin Function By Alternative Splicin | 1e-07 | ||
| 3pve_A | 189 | Crystal Structure Of The G2 Domain Of Agrin From Mu | 8e-14 | ||
| 3pve_A | 189 | Crystal Structure Of The G2 Domain Of Agrin From Mu | 4e-12 | ||
| 3v64_A | 191 | Crystal Structure Of Agrin And Lrp4 Length = 191 | 1e-11 | ||
| 3v64_A | 191 | Crystal Structure Of Agrin And Lrp4 Length = 191 | 4e-07 | ||
| 1dyk_A | 394 | Laminin Alpha 2 Chain Lg4-5 Domain Pair Length = 39 | 4e-09 | ||
| 1okq_A | 394 | Laminin Alpha 2 Chain Lg4-5 Domain Pair, Ca1 Site M | 1e-08 | ||
| 2wjs_A | 608 | Crystal Structure Of The Lg1-3 Region Of The Lamini | 2e-07 | ||
| 2vj3_A | 135 | Human Notch-1 Egfs 11-13 Length = 135 | 9e-06 | ||
| 2vj3_A | 135 | Human Notch-1 Egfs 11-13 Length = 135 | 1e-05 | ||
| 1e07_A | 642 | Model Of Human Carcinoembryonic Antigen By Homology | 1e-05 | ||
| 2vj2_A | 169 | Human Jagged-1, Domains Dsl And Egfs1-3 Length = 16 | 1e-04 | ||
| 3mw4_A | 178 | Crystal Structure Of Beta-Neurexin 3 Without The Sp | 2e-04 | ||
| 3h5c_B | 317 | X-Ray Structure Of Protein Z-Protein Z Inhibitor Co | 8e-04 | ||
| 4d90_A | 143 | Crystal Structure Of Del-1 Egf Domains Length = 143 | 8e-04 |
| >pdb|3QCW|A Chain A, Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), No Splice Inserts Length = 1245 | Back alignment and structure |
|
| >pdb|3QCW|A Chain A, Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), No Splice Inserts Length = 1245 | Back alignment and structure |
| >pdb|3R05|A Chain A, Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), With Splice Insert Ss3 Length = 1254 | Back alignment and structure |
| >pdb|3R05|A Chain A, Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), With Splice Insert Ss3 Length = 1254 | Back alignment and structure |
| >pdb|3POY|A Chain A, Crystal Structure Of The Alpha-Neurexin-1 Ectodomain, Lns 2-6 Length = 1019 | Back alignment and structure |
| >pdb|3POY|A Chain A, Crystal Structure Of The Alpha-Neurexin-1 Ectodomain, Lns 2-6 Length = 1019 | Back alignment and structure |
| >pdb|3POY|A Chain A, Crystal Structure Of The Alpha-Neurexin-1 Ectodomain, Lns 2-6 Length = 1019 | Back alignment and structure |
| >pdb|3SH4|A Chain A, Laminin G Like Domain 3 From Human Perlecan Length = 195 | Back alignment and structure |
| >pdb|3ASI|A Chain A, Alpha-Neurexin-1 Ectodomain Fragment; Lns5-Egf3-Lns6 Length = 410 | Back alignment and structure |
| >pdb|1PZ7|A Chain A, Modulation Of Agrin Function By Alternative Splicing And Ca2+ Binding Length = 204 | Back alignment and structure |
| >pdb|1PZ7|A Chain A, Modulation Of Agrin Function By Alternative Splicing And Ca2+ Binding Length = 204 | Back alignment and structure |
| >pdb|1Q56|A Chain A, Nmr Structure Of The B0 Isoform Of The Agrin G3 Domain In Its Ca2+ Bound State Length = 195 | Back alignment and structure |
| >pdb|1Q56|A Chain A, Nmr Structure Of The B0 Isoform Of The Agrin G3 Domain In Its Ca2+ Bound State Length = 195 | Back alignment and structure |
| >pdb|1PZ8|A Chain A, Modulation Of Agrin Function By Alternative Splicing And Ca2+ Binding Length = 201 | Back alignment and structure |
| >pdb|1PZ8|A Chain A, Modulation Of Agrin Function By Alternative Splicing And Ca2+ Binding Length = 201 | Back alignment and structure |
| >pdb|3PVE|A Chain A, Crystal Structure Of The G2 Domain Of Agrin From Mus Musculus Length = 189 | Back alignment and structure |
| >pdb|3PVE|A Chain A, Crystal Structure Of The G2 Domain Of Agrin From Mus Musculus Length = 189 | Back alignment and structure |
| >pdb|3V64|A Chain A, Crystal Structure Of Agrin And Lrp4 Length = 191 | Back alignment and structure |
| >pdb|3V64|A Chain A, Crystal Structure Of Agrin And Lrp4 Length = 191 | Back alignment and structure |
| >pdb|1DYK|A Chain A, Laminin Alpha 2 Chain Lg4-5 Domain Pair Length = 394 | Back alignment and structure |
| >pdb|1OKQ|A Chain A, Laminin Alpha 2 Chain Lg4-5 Domain Pair, Ca1 Site Mutant Length = 394 | Back alignment and structure |
| >pdb|2WJS|A Chain A, Crystal Structure Of The Lg1-3 Region Of The Laminin Alpha2 Chain Length = 608 | Back alignment and structure |
| >pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 | Back alignment and structure |
| >pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 | Back alignment and structure |
| >pdb|1E07|A Chain A, Model Of Human Carcinoembryonic Antigen By Homology Modelling And Curve-Fitting To Experimental Solution Scattering Data Length = 642 | Back alignment and structure |
| >pdb|2VJ2|A Chain A, Human Jagged-1, Domains Dsl And Egfs1-3 Length = 169 | Back alignment and structure |
| >pdb|3MW4|A Chain A, Crystal Structure Of Beta-Neurexin 3 Without The Splice Insert 4 Length = 178 | Back alignment and structure |
| >pdb|3H5C|B Chain B, X-Ray Structure Of Protein Z-Protein Z Inhibitor Complex Length = 317 | Back alignment and structure |
| >pdb|4D90|A Chain A, Crystal Structure Of Del-1 Egf Domains Length = 143 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 834 | |||
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 4e-72 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 6e-65 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 1e-59 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 5e-21 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 8e-21 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 4e-17 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 6e-06 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 2e-64 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 1e-21 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 4e-21 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 1e-19 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 4e-07 | |
| 3sh4_A | 195 | LG3 peptide; actin disassambly, integrin alpha12 B | 4e-38 | |
| 3sh4_A | 195 | LG3 peptide; actin disassambly, integrin alpha12 B | 6e-31 | |
| 3sh4_A | 195 | LG3 peptide; actin disassambly, integrin alpha12 B | 2e-09 | |
| 3sh4_A | 195 | LG3 peptide; actin disassambly, integrin alpha12 B | 6e-07 | |
| 1pz7_A | 204 | Agrin; structural protein; 1.42A {Gallus gallus} S | 3e-37 | |
| 1pz7_A | 204 | Agrin; structural protein; 1.42A {Gallus gallus} S | 6e-32 | |
| 1pz7_A | 204 | Agrin; structural protein; 1.42A {Gallus gallus} S | 1e-11 | |
| 1pz7_A | 204 | Agrin; structural protein; 1.42A {Gallus gallus} S | 9e-10 | |
| 3pve_A | 189 | Agrin, AGRN protein; mRNA splicing, structural gen | 4e-36 | |
| 3pve_A | 189 | Agrin, AGRN protein; mRNA splicing, structural gen | 1e-32 | |
| 3pve_A | 189 | Agrin, AGRN protein; mRNA splicing, structural gen | 2e-14 | |
| 3pve_A | 189 | Agrin, AGRN protein; mRNA splicing, structural gen | 3e-10 | |
| 3v64_A | 191 | Low-density lipoprotein receptor-related protein; | 8e-35 | |
| 3v64_A | 191 | Low-density lipoprotein receptor-related protein; | 2e-33 | |
| 3v64_A | 191 | Low-density lipoprotein receptor-related protein; | 1e-11 | |
| 3v64_A | 191 | Low-density lipoprotein receptor-related protein; | 1e-06 | |
| 2h0b_A | 184 | Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A | 4e-33 | |
| 2h0b_A | 184 | Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A | 1e-28 | |
| 2h0b_A | 184 | Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A | 3e-10 | |
| 2h0b_A | 184 | Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A | 2e-07 | |
| 2wjs_A | 608 | Laminin subunit alpha-2; integrin, secreted, coile | 1e-30 | |
| 2wjs_A | 608 | Laminin subunit alpha-2; integrin, secreted, coile | 5e-30 | |
| 2wjs_A | 608 | Laminin subunit alpha-2; integrin, secreted, coile | 3e-28 | |
| 2wjs_A | 608 | Laminin subunit alpha-2; integrin, secreted, coile | 2e-23 | |
| 2wjs_A | 608 | Laminin subunit alpha-2; integrin, secreted, coile | 4e-23 | |
| 2wjs_A | 608 | Laminin subunit alpha-2; integrin, secreted, coile | 1e-20 | |
| 2wjs_A | 608 | Laminin subunit alpha-2; integrin, secreted, coile | 1e-04 | |
| 2jd4_A | 383 | Laminin subunit alpha-1; basement membrane protein | 1e-29 | |
| 2jd4_A | 383 | Laminin subunit alpha-1; basement membrane protein | 1e-28 | |
| 2jd4_A | 383 | Laminin subunit alpha-1; basement membrane protein | 1e-27 | |
| 2jd4_A | 383 | Laminin subunit alpha-1; basement membrane protein | 5e-21 | |
| 2jd4_A | 383 | Laminin subunit alpha-1; basement membrane protein | 3e-10 | |
| 2jd4_A | 383 | Laminin subunit alpha-1; basement membrane protein | 3e-05 | |
| 2jd4_A | 383 | Laminin subunit alpha-1; basement membrane protein | 1e-04 | |
| 1dyk_A | 394 | Laminin alpha 2 chain; metal binding protein; 2.0A | 1e-27 | |
| 1dyk_A | 394 | Laminin alpha 2 chain; metal binding protein; 2.0A | 2e-26 | |
| 1dyk_A | 394 | Laminin alpha 2 chain; metal binding protein; 2.0A | 3e-25 | |
| 1dyk_A | 394 | Laminin alpha 2 chain; metal binding protein; 2.0A | 3e-21 | |
| 1dyk_A | 394 | Laminin alpha 2 chain; metal binding protein; 2.0A | 1e-07 | |
| 1dyk_A | 394 | Laminin alpha 2 chain; metal binding protein; 2.0A | 6e-06 | |
| 1f5f_A | 205 | SHBG, sex hormone-binding globulin; jellyroll, sig | 9e-27 | |
| 1f5f_A | 205 | SHBG, sex hormone-binding globulin; jellyroll, sig | 1e-23 | |
| 1f5f_A | 205 | SHBG, sex hormone-binding globulin; jellyroll, sig | 3e-06 | |
| 3bod_A | 178 | Neurexin-1-alpha; neurexin1D, LNS6, alternative sp | 1e-26 | |
| 3bod_A | 178 | Neurexin-1-alpha; neurexin1D, LNS6, alternative sp | 6e-21 | |
| 3bod_A | 178 | Neurexin-1-alpha; neurexin1D, LNS6, alternative sp | 2e-06 | |
| 2r16_A | 182 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sp | 1e-26 | |
| 2r16_A | 182 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sp | 5e-24 | |
| 2r16_A | 182 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sp | 2e-07 | |
| 2r16_A | 182 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sp | 4e-06 | |
| 1h30_A | 422 | GAS6, growth-arrest-specific protein; laminin G-do | 2e-26 | |
| 1h30_A | 422 | GAS6, growth-arrest-specific protein; laminin G-do | 3e-25 | |
| 1h30_A | 422 | GAS6, growth-arrest-specific protein; laminin G-do | 6e-22 | |
| 1h30_A | 422 | GAS6, growth-arrest-specific protein; laminin G-do | 1e-09 | |
| 1h30_A | 422 | GAS6, growth-arrest-specific protein; laminin G-do | 5e-05 | |
| 1d2s_A | 170 | SHBG, sex hormone-binding globulin; steroid transp | 4e-26 | |
| 1d2s_A | 170 | SHBG, sex hormone-binding globulin; steroid transp | 9e-23 | |
| 1d2s_A | 170 | SHBG, sex hormone-binding globulin; steroid transp | 3e-08 | |
| 1d2s_A | 170 | SHBG, sex hormone-binding globulin; steroid transp | 6e-04 | |
| 2r1d_A | 226 | Neurexin-1-beta, neurexin I-beta; beta-sandwich, c | 3e-24 | |
| 2r1d_A | 226 | Neurexin-1-beta, neurexin I-beta; beta-sandwich, c | 1e-20 | |
| 2r1d_A | 226 | Neurexin-1-beta, neurexin I-beta; beta-sandwich, c | 1e-04 | |
| 2r1b_A | 220 | Neurexin-1-beta, neurexin I-beta; beta-sandwich, c | 2e-20 | |
| 2r1b_A | 220 | Neurexin-1-beta, neurexin I-beta; beta-sandwich, c | 1e-15 | |
| 2r1b_A | 220 | Neurexin-1-beta, neurexin I-beta; beta-sandwich, c | 8e-05 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 3e-18 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 1e-16 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 1e-15 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 1e-14 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 2e-08 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 4e-07 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 4e-17 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 4e-14 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 2e-12 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 4e-11 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 3e-10 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 6e-08 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 8e-17 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 3e-16 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 4e-14 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 1e-12 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 6e-07 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 3e-06 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 1e-16 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 8e-14 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 2e-13 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 3e-11 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 4e-11 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 5e-09 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 3e-06 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 4e-16 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 8e-12 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 2e-11 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 1e-10 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 2e-10 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 1e-09 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 1e-09 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 4e-06 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 8e-06 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 4e-15 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 1e-13 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 3e-07 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 1e-06 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 1e-06 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 3e-06 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 5e-15 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 7e-15 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 2e-07 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 6e-07 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 1e-06 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 1e-06 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 3e-13 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 3e-11 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 6e-07 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 2e-05 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 3e-05 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 6e-04 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 3e-12 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 2e-09 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 1e-11 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 4e-11 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 8e-11 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 1e-10 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 3e-10 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 3e-10 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 7e-10 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 8e-08 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 2e-07 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 9e-07 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 5e-06 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 8e-11 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 1e-10 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 3e-10 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 1e-09 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 2e-09 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 2e-09 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 8e-07 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 6e-06 | |
| 1gl4_B | 98 | Basement membrane-specific heparan sulfate proteog | 4e-10 | |
| 1gl4_B | 98 | Basement membrane-specific heparan sulfate proteog | 4e-06 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 9e-09 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 2e-08 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 3e-07 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 2e-06 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 3e-06 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 5e-05 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 8e-05 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 5e-04 | |
| 3qs9_E | 527 | FL cytokine receptor; immunoglobulin-like domain, | 1e-08 | |
| 3qs9_E | 527 | FL cytokine receptor; immunoglobulin-like domain, | 6e-06 | |
| 3qs9_E | 527 | FL cytokine receptor; immunoglobulin-like domain, | 2e-05 | |
| 3bfo_A | 91 | Mucosa-associated lymphoid tissue lymphoma translo | 1e-08 | |
| 3bfo_A | 91 | Mucosa-associated lymphoid tissue lymphoma translo | 5e-04 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 2e-08 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 4e-08 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 6e-08 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 1e-07 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 2e-08 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 2e-08 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 1e-07 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 4e-07 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 8e-06 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 8e-06 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 8e-05 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 5e-04 | |
| 2yd9_A | 304 | Receptor-type tyrosine-protein phosphatase S; hydr | 3e-08 | |
| 2yd9_A | 304 | Receptor-type tyrosine-protein phosphatase S; hydr | 2e-05 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 4e-08 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 3e-07 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 5e-07 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 8e-07 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 1e-06 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 4e-06 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 8e-05 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 4e-08 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 6e-08 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 1e-07 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 2e-06 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 2e-05 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 5e-05 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 5e-08 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 5e-07 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 2e-06 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 5e-06 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 8e-06 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 1e-05 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 6e-08 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 2e-05 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 6e-08 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 5e-07 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 3e-04 | |
| 3b5h_A | 184 | Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce | 7e-08 | |
| 3b5h_A | 184 | Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce | 3e-04 | |
| 1qz1_A | 291 | Neural cell adhesion molecule 1, 140 kDa isoform; | 8e-08 | |
| 1qz1_A | 291 | Neural cell adhesion molecule 1, 140 kDa isoform; | 3e-05 | |
| 1qz1_A | 291 | Neural cell adhesion molecule 1, 140 kDa isoform; | 3e-04 | |
| 1epf_A | 191 | NCAM, protein (neural cell adhesion molecule); imm | 9e-08 | |
| 1epf_A | 191 | NCAM, protein (neural cell adhesion molecule); imm | 7e-06 | |
| 1epf_A | 191 | NCAM, protein (neural cell adhesion molecule); imm | 7e-04 | |
| 1nn8_R | 302 | CD155 antigen, poliovirus receptor; icosahedral vi | 1e-07 | |
| 2c5d_C | 195 | AXL oncogene, tyrosine-protein kinase receptor UFO | 1e-07 | |
| 2c5d_C | 195 | AXL oncogene, tyrosine-protein kinase receptor UFO | 2e-05 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 1e-07 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 2e-06 | |
| 3qs7_E | 423 | FL cytokine receptor; immunoglobulin-like domain, | 1e-07 | |
| 3qs7_E | 423 | FL cytokine receptor; immunoglobulin-like domain, | 1e-05 | |
| 1bih_A | 395 | Hemolin; insect immunity, LPS-binding, homophilic | 1e-07 | |
| 1bih_A | 395 | Hemolin; insect immunity, LPS-binding, homophilic | 2e-07 | |
| 1bih_A | 395 | Hemolin; insect immunity, LPS-binding, homophilic | 6e-07 | |
| 2iep_A | 192 | Muscle-specific kinase receptor; beta-sandwich, si | 2e-07 | |
| 2iep_A | 192 | Muscle-specific kinase receptor; beta-sandwich, si | 3e-05 | |
| 2iep_A | 192 | Muscle-specific kinase receptor; beta-sandwich, si | 9e-04 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 2e-07 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 7e-06 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 3e-07 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 5e-05 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 5e-05 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 1e-04 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 1e-04 | |
| 3u83_A | 331 | Poliovirus receptor-related protein 1; nectin-1, h | 3e-07 | |
| 3u83_A | 331 | Poliovirus receptor-related protein 1; nectin-1, h | 3e-04 | |
| 3k0w_A | 218 | Mucosa-associated lymphoid tissue lymphoma translo | 4e-07 | |
| 3k0w_A | 218 | Mucosa-associated lymphoid tissue lymphoma translo | 1e-06 | |
| 3k0w_A | 218 | Mucosa-associated lymphoid tissue lymphoma translo | 4e-05 | |
| 3k0w_A | 218 | Mucosa-associated lymphoid tissue lymphoma translo | 3e-04 | |
| 2wv3_A | 190 | Neuroplastin; igcam, membrane, glycoprotein, cell | 4e-07 | |
| 2wv3_A | 190 | Neuroplastin; igcam, membrane, glycoprotein, cell | 4e-04 | |
| 1cs6_A | 382 | Axonin-1; neural cell adhesion, cell adhesion; 1.8 | 4e-07 | |
| 1cs6_A | 382 | Axonin-1; neural cell adhesion, cell adhesion; 1.8 | 1e-05 | |
| 1cs6_A | 382 | Axonin-1; neural cell adhesion, cell adhesion; 1.8 | 1e-05 | |
| 1cs6_A | 382 | Axonin-1; neural cell adhesion, cell adhesion; 1.8 | 1e-04 | |
| 1cs6_A | 382 | Axonin-1; neural cell adhesion, cell adhesion; 1.8 | 1e-04 | |
| 4dkd_C | 292 | Macrophage colony-stimulating factor 1 receptor; d | 5e-07 | |
| 4dkd_C | 292 | Macrophage colony-stimulating factor 1 receptor; d | 1e-06 | |
| 4dkd_C | 292 | Macrophage colony-stimulating factor 1 receptor; d | 4e-06 | |
| 4dkd_C | 292 | Macrophage colony-stimulating factor 1 receptor; d | 6e-04 | |
| 2x1w_L | 213 | Vascular endothelial growth factor receptor 2; hor | 5e-07 | |
| 1wio_A | 363 | CD4, T-cell surface glycoprotein CD4; immunoglobul | 5e-07 | |
| 1wio_A | 363 | CD4, T-cell surface glycoprotein CD4; immunoglobul | 3e-04 | |
| 1wio_A | 363 | CD4, T-cell surface glycoprotein CD4; immunoglobul | 6e-04 | |
| 3kld_A | 384 | Contactin 4, axcam, BIG-2; cell adhesion, protein | 7e-07 | |
| 3kld_A | 384 | Contactin 4, axcam, BIG-2; cell adhesion, protein | 2e-05 | |
| 3kld_A | 384 | Contactin 4, axcam, BIG-2; cell adhesion, protein | 4e-05 | |
| 3kld_A | 384 | Contactin 4, axcam, BIG-2; cell adhesion, protein | 6e-05 | |
| 3kld_A | 384 | Contactin 4, axcam, BIG-2; cell adhesion, protein | 2e-04 | |
| 2cr3_A | 99 | Basic fibroblast growth factor receptor 1; IG fold | 8e-07 | |
| 2cr3_A | 99 | Basic fibroblast growth factor receptor 1; IG fold | 3e-04 | |
| 3ejj_X | 289 | Macrophage colony-stimulating factor 1 receptor; g | 9e-07 | |
| 3ejj_X | 289 | Macrophage colony-stimulating factor 1 receptor; g | 3e-05 | |
| 3ejj_X | 289 | Macrophage colony-stimulating factor 1 receptor; g | 4e-05 | |
| 3ejj_X | 289 | Macrophage colony-stimulating factor 1 receptor; g | 5e-04 | |
| 2o26_X | 290 | MAST/stem cell growth factor receptor; stem cell f | 1e-06 | |
| 2o26_X | 290 | MAST/stem cell growth factor receptor; stem cell f | 1e-04 | |
| 2o26_X | 290 | MAST/stem cell growth factor receptor; stem cell f | 6e-04 | |
| 3s97_C | 201 | Contactin-1; carbonic anhdyrase like immunoglobuli | 1e-06 | |
| 3s97_C | 201 | Contactin-1; carbonic anhdyrase like immunoglobuli | 1e-05 | |
| 3s97_C | 201 | Contactin-1; carbonic anhdyrase like immunoglobuli | 2e-04 | |
| 3p3y_A | 404 | Neurofascin; IG domains, cell adhesion; HET: NAG; | 1e-06 | |
| 3p3y_A | 404 | Neurofascin; IG domains, cell adhesion; HET: NAG; | 1e-05 | |
| 3p3y_A | 404 | Neurofascin; IG domains, cell adhesion; HET: NAG; | 2e-05 | |
| 2ens_A | 96 | Advanced glycosylation END product-specific recept | 1e-06 | |
| 2ens_A | 96 | Advanced glycosylation END product-specific recept | 7e-04 | |
| 2v44_A | 189 | NCAM2, neural cell adhesion molecule 2; phosphoryl | 1e-06 | |
| 2v44_A | 189 | NCAM2, neural cell adhesion molecule 2; phosphoryl | 2e-05 | |
| 2ec8_A | 524 | MAST/stem cell growth factor receptor; glycoprotei | 1e-06 | |
| 2ec8_A | 524 | MAST/stem cell growth factor receptor; glycoprotei | 1e-05 | |
| 2ec8_A | 524 | MAST/stem cell growth factor receptor; glycoprotei | 2e-04 | |
| 2ec8_A | 524 | MAST/stem cell growth factor receptor; glycoprotei | 3e-04 | |
| 3rjd_A | 262 | High affinity immunoglobulin gamma FC receptor I; | 1e-06 | |
| 3rjd_A | 262 | High affinity immunoglobulin gamma FC receptor I; | 2e-06 | |
| 3rjd_A | 262 | High affinity immunoglobulin gamma FC receptor I; | 3e-06 | |
| 3rjd_A | 262 | High affinity immunoglobulin gamma FC receptor I; | 1e-04 | |
| 3rjd_A | 262 | High affinity immunoglobulin gamma FC receptor I; | 4e-04 | |
| 3rjd_A | 262 | High affinity immunoglobulin gamma FC receptor I; | 5e-04 | |
| 2yr3_A | 99 | Myosin light chain kinase, smooth muscle; IG domai | 1e-06 | |
| 3shs_A | 304 | HOC head outer capsid protein; immunoglobulin-like | 2e-06 | |
| 3shs_A | 304 | HOC head outer capsid protein; immunoglobulin-like | 3e-04 | |
| 1fnl_A | 175 | Low affinity immunoglobulin gamma FC region recept | 2e-06 | |
| 1fnl_A | 175 | Low affinity immunoglobulin gamma FC region recept | 5e-06 | |
| 1fnl_A | 175 | Low affinity immunoglobulin gamma FC region recept | 1e-04 | |
| 1fnl_A | 175 | Low affinity immunoglobulin gamma FC region recept | 5e-04 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 2e-06 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 2e-06 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 4e-06 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 8e-06 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 6e-05 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 1e-04 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 4e-04 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 2e-06 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 4e-06 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 1e-05 | |
| 2ckn_A | 95 | Basic fibroblast growth factor receptor 1; kinase, | 2e-06 | |
| 2ckn_A | 95 | Basic fibroblast growth factor receptor 1; kinase, | 2e-04 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 2e-06 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 1e-05 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 3e-05 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 4e-05 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 4e-05 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 6e-05 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 6e-04 | |
| 2v9r_A | 212 | Roundabout homolog 1; proto-oncogene, differentiat | 2e-06 | |
| 1f2q_A | 176 | High affinity immunoglobulin epsilon receptor ALP | 3e-06 | |
| 1f2q_A | 176 | High affinity immunoglobulin epsilon receptor ALP | 9e-06 | |
| 1f2q_A | 176 | High affinity immunoglobulin epsilon receptor ALP | 3e-05 | |
| 1rhf_A | 182 | Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 | 3e-06 | |
| 1rhf_A | 182 | Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 | 2e-04 | |
| 3sgj_C | 204 | Human FCG3A receptor; receptor complex, FC recepto | 3e-06 | |
| 3sgj_C | 204 | Human FCG3A receptor; receptor complex, FC recepto | 2e-05 | |
| 3sgj_C | 204 | Human FCG3A receptor; receptor complex, FC recepto | 2e-04 | |
| 3sgj_C | 204 | Human FCG3A receptor; receptor complex, FC recepto | 9e-04 | |
| 3s35_X | 122 | Vascular endothelial growth factor receptor 2; ant | 3e-06 | |
| 2oz4_A | 265 | Intercellular adhesion molecule 1; IGSF domain, st | 4e-06 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 4e-06 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 2e-05 | |
| 3laf_A | 403 | Deleted in colorectal cancer; netrin-1 receptor, i | 4e-06 | |
| 3laf_A | 403 | Deleted in colorectal cancer; netrin-1 receptor, i | 4e-05 | |
| 3laf_A | 403 | Deleted in colorectal cancer; netrin-1 receptor, i | 2e-04 | |
| 3ry4_A | 170 | Low affinity immunoglobulin gamma FC region recep; | 5e-06 | |
| 3ry4_A | 170 | Low affinity immunoglobulin gamma FC region recep; | 1e-05 | |
| 3ry4_A | 170 | Low affinity immunoglobulin gamma FC region recep; | 3e-05 | |
| 3ry4_A | 170 | Low affinity immunoglobulin gamma FC region recep; | 3e-04 | |
| 3r4d_A | 208 | CEA-related cell adhesion molecule 1, isoform 1/2; | 5e-06 | |
| 3r4d_A | 208 | CEA-related cell adhesion molecule 1, isoform 1/2; | 3e-05 | |
| 3r4d_A | 208 | CEA-related cell adhesion molecule 1, isoform 1/2; | 2e-04 | |
| 2ny1_B | 184 | T-cell surface glycoprotein CD4; HIV, GP120, CD4, | 5e-06 | |
| 2ny1_B | 184 | T-cell surface glycoprotein CD4; HIV, GP120, CD4, | 5e-05 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 5e-06 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 2e-04 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 4e-04 | |
| 2dm7_A | 108 | KIAA1556 protein; beta-sandwich, IG-fold, obscurin | 5e-06 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 7e-06 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 1e-04 | |
| 2y23_A | 312 | Myomesin; structural protein, sarcomere, M-BAND, i | 7e-06 | |
| 2y23_A | 312 | Myomesin; structural protein, sarcomere, M-BAND, i | 8e-04 | |
| 2rik_A | 284 | Titin; I-SET IG fold, poly-IG linear array, struct | 7e-06 | |
| 2rik_A | 284 | Titin; I-SET IG fold, poly-IG linear array, struct | 3e-05 | |
| 2rik_A | 284 | Titin; I-SET IG fold, poly-IG linear array, struct | 5e-05 | |
| 2v5m_A | 388 | Dscam; neurobiology SPL immunoglobulin domain, cel | 1e-05 | |
| 2v5m_A | 388 | Dscam; neurobiology SPL immunoglobulin domain, cel | 2e-05 | |
| 2v5m_A | 388 | Dscam; neurobiology SPL immunoglobulin domain, cel | 2e-05 | |
| 2va4_A | 192 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; t | 1e-05 | |
| 2va4_A | 192 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; t | 9e-05 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 1e-05 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 3e-04 | |
| 2v5t_A | 189 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; p | 1e-05 | |
| 2v5t_A | 189 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; p | 4e-05 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 1e-05 | |
| 2a38_A | 194 | Titin; Z1Z2, structural protein; 2.00A {Homo sapie | 1e-05 | |
| 3oq3_B | 329 | IFN-alpha/beta binding protein C12R; mousepox viru | 1e-05 | |
| 3oq3_B | 329 | IFN-alpha/beta binding protein C12R; mousepox viru | 7e-05 | |
| 3oq3_B | 329 | IFN-alpha/beta binding protein C12R; mousepox viru | 6e-04 | |
| 3o4o_C | 339 | Interleukin-1 receptor type 2; cytokine-receptor c | 1e-05 | |
| 3o4o_C | 339 | Interleukin-1 receptor type 2; cytokine-receptor c | 7e-05 | |
| 2wim_A | 291 | N-CAM 2, NCAM2, neural cell adhesion molecule 2; c | 1e-05 | |
| 2wim_A | 291 | N-CAM 2, NCAM2, neural cell adhesion molecule 2; c | 3e-05 | |
| 2wim_A | 291 | N-CAM 2, NCAM2, neural cell adhesion molecule 2; c | 5e-04 | |
| 2eo1_A | 102 | OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 | 2e-05 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 2e-05 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 3e-05 | |
| 3jz7_A | 214 | MCAR, CAR, coxsackievirus and adenovirus receptor | 2e-05 | |
| 3jz7_A | 214 | MCAR, CAR, coxsackievirus and adenovirus receptor | 9e-04 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 2e-05 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 4e-04 | |
| 1nbq_A | 209 | JAM, junctional adhesion molecule 1, PAM-1; reovir | 2e-05 | |
| 2e7c_A | 118 | Myosin-binding protein C, fast-type; IG-like domai | 2e-05 | |
| 1hnf_A | 182 | CD2; T lymphocyte adhesion glycoprotein; HET: NAG; | 2e-05 | |
| 2edo_A | 121 | CD48 antigen; beta-sandwich, IG-fold, B-lymphocyte | 2e-05 | |
| 3kvq_A | 108 | Vascular endothelial growth factor receptor 2; veg | 2e-05 | |
| 2yd1_A | 212 | Tyrosine-protein phosphatase LAR; hydrolase; 1.80A | 2e-05 | |
| 1ry7_B | 334 | FGFR-3, fibroblast growth factor receptor 3; FGF-F | 2e-05 | |
| 1ry7_B | 334 | FGFR-3, fibroblast growth factor receptor 3; FGF-F | 9e-05 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 3e-05 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 4e-04 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 5e-04 | |
| 2edj_A | 100 | Roundabout homolog 2; KIAA1568 protein, beta sandw | 3e-05 | |
| 2edj_A | 100 | Roundabout homolog 2; KIAA1568 protein, beta sandw | 6e-04 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 3e-05 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 1e-04 | |
| 3mjg_X | 289 | Beta-type platelet-derived growth factor receptor; | 3e-05 | |
| 3mjg_X | 289 | Beta-type platelet-derived growth factor receptor; | 5e-05 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 4e-05 | |
| 1sy6_A | 204 | T-cell surface glycoprotein CD3 gamma/epsilon chai | 4e-05 | |
| 2e6p_A | 104 | Obscurin-like protein 1; IG-like domain, structura | 4e-05 | |
| 3irg_A | 100 | Titin; IG-like, titin, OBSL1, complex, alternative | 4e-05 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 5e-05 | |
| 1f97_A | 212 | Junction adhesion molecule; immunoglobulin superfa | 5e-05 | |
| 3caf_A | 100 | Fibroblast growth factor receptor 2; FGFR2, D2, AT | 6e-05 | |
| 3grw_A | 241 | Fibroblast growth factor receptor 3; FGFR3, protei | 6e-05 | |
| 1itb_B | 315 | Type 1 interleukin-1 receptor; immunoglobulin fold | 6e-05 | |
| 1itb_B | 315 | Type 1 interleukin-1 receptor; immunoglobulin fold | 5e-04 | |
| 2bk8_A | 97 | Connectin, M1, titin heart isoform N2-B; IG domain | 7e-05 | |
| 2cqv_A | 114 | MLCK, myosin light chain kinase, smooth muscle and | 7e-05 | |
| 2j8h_A | 197 | Titin, connectin; cardiomyopathy, nuclear protein, | 7e-05 | |
| 1wit_A | 93 | Twitchin 18TH IGSF module; immunoglobulin superfam | 7e-05 | |
| 1pko_A | 139 | Myelin oligodendrocyte glycoprotein; IGV-domain, i | 8e-05 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 9e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-05 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 1e-04 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 1e-04 | |
| 2eo9_A | 118 | Roundabout homolog 1; beta-sandwich, IG-fold, H-RO | 1e-04 | |
| 2eo9_A | 118 | Roundabout homolog 1; beta-sandwich, IG-fold, H-RO | 6e-04 | |
| 2fbo_J | 250 | V1V2;, variable region-containing chitin-binding p | 1e-04 | |
| 3rbs_A | 207 | Myomesin-1; immunoglobulin C-SET domain, contractI | 1e-04 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 1e-04 | |
| 2cr6_A | 115 | KIAA1556 protein, obscurin; IG-fold, immunoglobuli | 2e-04 | |
| 3so5_A | 112 | LIG-3, leucine-rich repeats and immunoglobulin-lik | 2e-04 | |
| 1n26_A | 325 | IL-6 receptor alpha chain; transmembrane, glycopro | 2e-04 | |
| 3ojm_B | 231 | Fibroblast growth factor receptor 2; beta trefoil | 2e-04 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 2e-04 | |
| 1hng_A | 176 | CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra | 2e-04 | |
| 1z7z_I | 450 | Intercellular adhesion molecule-1; ICAM-1,kilifi,C | 2e-04 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 2e-04 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 3e-04 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 3e-04 | |
| 2edf_A | 103 | Obscurin; beta-sandwich, IG-fold, structural genom | 3e-04 | |
| 1x44_A | 103 | Myosin-binding protein C, SLOW-type; IG-like domai | 3e-04 | |
| 3mj6_A | 268 | Junctional adhesion molecule-like; immunoglobulin | 3e-04 | |
| 1waa_A | 93 | Titin; metal binding protein, calmodulin-binding, | 3e-04 | |
| 2i9a_A | 145 | Urokinase-type plasminogen activator; growth facto | 3e-04 | |
| 2y25_A | 317 | Myomesin; structural protein, sarcomere, M-BAND, i | 4e-04 | |
| 2y25_A | 317 | Myomesin; structural protein, sarcomere, M-BAND, i | 7e-04 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 4e-04 | |
| 2vr9_A | 217 | Roundabout 1, ROBO; immunoglobulin-like domain, AX | 4e-04 | |
| 2vr9_A | 217 | Roundabout 1, ROBO; immunoglobulin-like domain, AX | 4e-04 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 4e-04 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 5e-04 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 5e-04 | |
| 4dep_C | 349 | Interleukin-1 receptor accessory protein; B-trefoi | 5e-04 | |
| 2cpc_A | 113 | KIAA0657 protein; immunoglobulin domain, IG domain | 5e-04 | |
| 3bp6_B | 202 | Programmed cell death 1 ligand 2; PD-1, PD-L2, com | 6e-04 | |
| 2yuz_A | 100 | Myosin-binding protein C, SLOW-type; immunoglobuli | 6e-04 | |
| 2k1m_A | 95 | Myosin-binding protein C, cardiac-type; IG-I domai | 7e-04 | |
| 2dlt_A | 106 | Myosin binding protein C, fast-type; IG-like domai | 7e-04 | |
| 1eaj_A | 126 | Coxsackie virus and adenovirus receptor; virus/vir | 8e-04 | |
| 1n1i_A | 105 | Merozoite surface protein-1; MSP1, malaria, surfac | 8e-04 | |
| 2pnd_A | 119 | V-SET and immunoglobulin domain containing 4; comp | 8e-04 | |
| 2cry_A | 122 | KIN of IRRE-like protein 3; IG fold, KIN of irregu | 9e-04 |
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
Score = 257 bits (656), Expect = 4e-72
Identities = 144/806 (17%), Positives = 271/806 (33%), Gaps = 140/806 (17%)
Query: 60 MFVDGIGPFSGESQGAFQGLDLSELVYIGAVPD------FGEIHPSAGFSNGFKGCVSRL 113
+ V+ + + G + LDL + +Y+G +P+ F +A + G+ GC+ L
Sbjct: 531 ISVNTL-RTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDL 589
Query: 114 KYNKTEFELFKMAVERVGVDSCNTCKSSKHNNCINNGLCQDAATRIGYTCICPPGFSGDR 173
+ ++ +MA + +C C++N
Sbjct: 590 FIDGQSKDIRQMAEVQSTAGVKPSCSRETAKPCLSN------------------------ 625
Query: 174 CSVLGEPCYPGACGDGSCQDVDGAMKCLCPIGTAGKRCEQKIKILQPAFKHGSYLAYPTP 233
PC G C+D C C R ++ + + ++ P
Sbjct: 626 ------PCKNN----GMCRDGWNRYVCDCSGTGYLGRSCEREATVLS-YDGSMFMKIQLP 674
Query: 234 KTM--RKFKVSLRLNPRDVRDGIILYSGQSDDGLGDFISLAIREKHMEFRFDTGSATPLY 291
M VSLR + GI++ + D D + L + ++ + G
Sbjct: 675 VVMHTEAEDVSLRFRSQR-AYGILMATTSRDSA--DTLRLELDAGRVKLTVNLGKGPETL 731
Query: 292 SNDAPA--FNPVSTKEAPYGSKITLTCNNDLEAPVEYTWSKRSNG------------HVL 337
+ + G + LT ++ + + +
Sbjct: 732 FAGYNLNDNEWHTVRVVRRGKSLKLTVDD--QQAMTGQMAGDHTRLEFHNIETGIITERR 789
Query: 338 PFGAFSRENTLTLQEIKNSDAGMYVCKVSNKDMTVEIPSILLVTDSV--PLFTQKPLSYL 395
+ LQ + + + E+ + + + P+ + SY+
Sbjct: 790 YLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIADPVTFKTKSSYV 849
Query: 396 ALPTLTDAHLHFSIELSFKPTDYNGLIMYTGDSNMKSYKGKGDFVSFGLEDGYPVFRFDV 455
AL TL A+ + FK T +GLI+Y DF+ L GY + FD+
Sbjct: 850 ALATL-QAYTSMHLFFQFKTTSLDGLILYNSG-------DGNDFIVVELVKGYLHYVFDL 901
Query: 456 G----LVVLRSKVTLVPHEWVVVTIIKDFKEGKLSVGGEPLIVGSTPGEKLQVLNLRTPL 511
G L+ S L ++W V I +D + T G + L+L++ L
Sbjct: 902 GNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKIDTKITTQITAGARN--LDLKSDL 959
Query: 512 YLGG-YNIYHVTPSLSVEVTEGFHGCISTIDVLGSELDLINSAVDSANIMDCSDLESSPV 570
Y+GG + + V EGF GC++++D+ G DLI+ A+ ++ S
Sbjct: 960 YIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLPDLISDALFCNGQIERGCEGPSTT 1019
Query: 571 CAPKPCQNYGICYPTDTSERGYNCSC-LTGYSGDHCEKENNMCMKGDVCKNGGMCKVTPD 629
C C N G+C G++C C +T +SG C +
Sbjct: 1020 CQEDSCSNQGVCLQQWD---GFSCDCSMTSFSGPLCNDPGTTYI---------------- 1060
Query: 630 SYECLCSLGYAPPNCAKRVSIGSEVHFLGEGYVELKKELIEER-RNEETIAFDFVTDDKN 688
G G + K + + +A F T K
Sbjct: 1061 -------------------------FSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKE 1095
Query: 689 ALLLWNGQPSYKNGIGREFIAVAVVNGYLEYSYDLGDGVVTIKFSKKPVNDGIKHSVNVT 748
A+L+ S +++ + + G + +++G + I+ S +NDG H V T
Sbjct: 1096 AVLVRVDSSSGLG----DYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFT 1151
Query: 749 RINKFGSLEVDSVIVGKGESPGSQ-DVINTRGNIYLGGTPNMDLMTGGRYVHPMSGLMMN 807
R +L+VDS V + G Q + N++ I +GG P G +
Sbjct: 1152 RSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQ---------PFQGQLSG 1202
Query: 808 IHIQNKHISNIGSSASSGLHVMPWIR 833
++ + N+ + + + ++ +R
Sbjct: 1203 LYYNGLKVLNMAAENDANIAIVGNVR 1228
|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 | Back alignment and structure |
|---|
| >3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A Length = 195 | Back alignment and structure |
|---|
| >3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A Length = 195 | Back alignment and structure |
|---|
| >3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A Length = 195 | Back alignment and structure |
|---|
| >3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A Length = 195 | Back alignment and structure |
|---|
| >1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A Length = 204 | Back alignment and structure |
|---|
| >1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A Length = 204 | Back alignment and structure |
|---|
| >1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A Length = 204 | Back alignment and structure |
|---|
| >1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A Length = 204 | Back alignment and structure |
|---|
| >3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} Length = 189 | Back alignment and structure |
|---|
| >3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} Length = 189 | Back alignment and structure |
|---|
| >3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} Length = 189 | Back alignment and structure |
|---|
| >3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} Length = 189 | Back alignment and structure |
|---|
| >3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Length = 191 | Back alignment and structure |
|---|
| >3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Length = 191 | Back alignment and structure |
|---|
| >3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Length = 191 | Back alignment and structure |
|---|
| >3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Length = 191 | Back alignment and structure |
|---|
| >2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Length = 184 | Back alignment and structure |
|---|
| >2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Length = 184 | Back alignment and structure |
|---|
| >2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Length = 184 | Back alignment and structure |
|---|
| >2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Length = 184 | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 | Back alignment and structure |
|---|
| >2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 | Back alignment and structure |
|---|
| >2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 | Back alignment and structure |
|---|
| >2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 | Back alignment and structure |
|---|
| >2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 | Back alignment and structure |
|---|
| >2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 | Back alignment and structure |
|---|
| >2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 | Back alignment and structure |
|---|
| >2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 | Back alignment and structure |
|---|
| >1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 | Back alignment and structure |
|---|
| >1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 | Back alignment and structure |
|---|
| >1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 | Back alignment and structure |
|---|
| >1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 | Back alignment and structure |
|---|
| >1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 | Back alignment and structure |
|---|
| >1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 | Back alignment and structure |
|---|
| >1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* Length = 205 | Back alignment and structure |
|---|
| >1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* Length = 205 | Back alignment and structure |
|---|
| >1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* Length = 205 | Back alignment and structure |
|---|
| >3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* Length = 178 | Back alignment and structure |
|---|
| >3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* Length = 178 | Back alignment and structure |
|---|
| >3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* Length = 178 | Back alignment and structure |
|---|
| >2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} Length = 182 | Back alignment and structure |
|---|
| >2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} Length = 182 | Back alignment and structure |
|---|
| >2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} Length = 182 | Back alignment and structure |
|---|
| >2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} Length = 182 | Back alignment and structure |
|---|
| >1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Length = 422 | Back alignment and structure |
|---|
| >1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Length = 422 | Back alignment and structure |
|---|
| >1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Length = 422 | Back alignment and structure |
|---|
| >1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Length = 422 | Back alignment and structure |
|---|
| >1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Length = 422 | Back alignment and structure |
|---|
| >1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* Length = 170 | Back alignment and structure |
|---|
| >1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* Length = 170 | Back alignment and structure |
|---|
| >1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* Length = 170 | Back alignment and structure |
|---|
| >1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* Length = 170 | Back alignment and structure |
|---|
| >2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* Length = 226 | Back alignment and structure |
|---|
| >2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* Length = 226 | Back alignment and structure |
|---|
| >2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* Length = 226 | Back alignment and structure |
|---|
| >2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* Length = 220 | Back alignment and structure |
|---|
| >2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* Length = 220 | Back alignment and structure |
|---|
| >2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* Length = 220 | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 | Back alignment and structure |
|---|
| >1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Length = 53 | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Length = 53 | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 | Back alignment and structure |
|---|
| >3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 | Back alignment and structure |
|---|
| >3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 | Back alignment and structure |
|---|
| >1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 | Back alignment and structure |
|---|
| >1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 | Back alignment and structure |
|---|
| >1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 | Back alignment and structure |
|---|
| >1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 | Back alignment and structure |
|---|
| >2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 | Back alignment and structure |
|---|
| >2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 | Back alignment and structure |
|---|
| >3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 | Back alignment and structure |
|---|
| >3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 | Back alignment and structure |
|---|
| >2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 | Back alignment and structure |
|---|
| >2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 | Back alignment and structure |
|---|
| >2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 | Back alignment and structure |
|---|
| >2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 | Back alignment and structure |
|---|
| >3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
| >2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 | Back alignment and structure |
|---|
| >3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 | Back alignment and structure |
|---|
| >1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 | Back alignment and structure |
|---|
| >1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 | Back alignment and structure |
|---|
| >1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 | Back alignment and structure |
|---|
| >1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Length = 53 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 | Back alignment and structure |
|---|
| >2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 | Back alignment and structure |
|---|
| >2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 | Back alignment and structure |
|---|
| >1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 | Back alignment and structure |
|---|
| >1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 | Back alignment and structure |
|---|
| >1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 | Back alignment and structure |
|---|
| >1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 | Back alignment and structure |
|---|
| >1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 | Back alignment and structure |
|---|
| >3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 | Back alignment and structure |
|---|
| >3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 | Back alignment and structure |
|---|
| >3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 | Back alignment and structure |
|---|
| >3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 | Back alignment and structure |
|---|
| >3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 | Back alignment and structure |
|---|
| >2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 | Back alignment and structure |
|---|
| >3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 | Back alignment and structure |
|---|
| >3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 | Back alignment and structure |
|---|
| >3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 | Back alignment and structure |
|---|
| >3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 | Back alignment and structure |
|---|
| >3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 | Back alignment and structure |
|---|
| >3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 | Back alignment and structure |
|---|
| >2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 | Back alignment and structure |
|---|
| >2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 | Back alignment and structure |
|---|
| >2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Length = 162 | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 | Back alignment and structure |
|---|
| >3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 | Back alignment and structure |
|---|
| >3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 | Back alignment and structure |
|---|
| >3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 | Back alignment and structure |
|---|
| >3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 | Back alignment and structure |
|---|
| >3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 | Back alignment and structure |
|---|
| >1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 | Back alignment and structure |
|---|
| >2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 | Back alignment and structure |
|---|
| >2edo_A CD48 antigen; beta-sandwich, IG-fold, B-lymphocyte activation marker blast-1, BCM1 surface antigen, leukocyte antigen MEM-102, TCT.1; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 | Back alignment and structure |
|---|
| >2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 | Back alignment and structure |
|---|
| >3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 | Back alignment and structure |
|---|
| >1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 | Back alignment and structure |
|---|
| >2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Length = 157 | Back alignment and structure |
|---|
| >1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 | Back alignment and structure |
|---|
| >3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 | Back alignment and structure |
|---|
| >2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 | Back alignment and structure |
|---|
| >1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 | Back alignment and structure |
|---|
| >1pko_A Myelin oligodendrocyte glycoprotein; IGV-domain, immune system; 1.45A {Rattus norvegicus} SCOP: b.1.1.1 PDB: 1pkq_E 3csp_A 1py9_A Length = 139 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Length = 58 | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Length = 63 | Back alignment and structure |
|---|
| >2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 | Back alignment and structure |
|---|
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Length = 50 | Back alignment and structure |
|---|
| >2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Length = 112 | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* 3krk_A* ... Length = 587 | Back alignment and structure |
|---|
| >1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 | Back alignment and structure |
|---|
| >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 | Back alignment and structure |
|---|
| >3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Length = 50 | Back alignment and structure |
|---|
| >2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 | Back alignment and structure |
|---|
| >3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 | Back alignment and structure |
|---|
| >1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 | Back alignment and structure |
|---|
| >2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Length = 145 | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 | Back alignment and structure |
|---|
| >2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Length = 46 | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Length = 79 | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Length = 553 | Back alignment and structure |
|---|
| >4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 | Back alignment and structure |
|---|
| >2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Length = 202 | Back alignment and structure |
|---|
| >2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 | Back alignment and structure |
|---|
| >1eaj_A Coxsackie virus and adenovirus receptor; virus/viral protein receptor, immunoglobulin V domain fold, symmetric dimer; 1.35A {Homo sapiens} SCOP: b.1.1.1 PDB: 1f5w_A 2j12_B 2j1k_A 2wbw_B* 2w9l_A* 1rsf_A 1jew_R 1kac_B 1p69_B 1p6a_B Length = 126 | Back alignment and structure |
|---|
| >1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Length = 105 | Back alignment and structure |
|---|
| >2pnd_A V-SET and immunoglobulin domain containing 4; complement receptor, IG-like domain, immune system; 1.00A {Mus musculus} PDB: 2icc_A 2ice_S* 2icf_S* Length = 119 | Back alignment and structure |
|---|
| >2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 834 | |||
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 100.0 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 100.0 | |
| 2wjs_A | 608 | Laminin subunit alpha-2; integrin, secreted, coile | 100.0 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 100.0 | |
| 2jd4_A | 383 | Laminin subunit alpha-1; basement membrane protein | 100.0 | |
| 1dyk_A | 394 | Laminin alpha 2 chain; metal binding protein; 2.0A | 100.0 | |
| 1h30_A | 422 | GAS6, growth-arrest-specific protein; laminin G-do | 100.0 | |
| 2wjs_A | 608 | Laminin subunit alpha-2; integrin, secreted, coile | 100.0 | |
| 3sh4_A | 195 | LG3 peptide; actin disassambly, integrin alpha12 B | 99.97 | |
| 1pz7_A | 204 | Agrin; structural protein; 1.42A {Gallus gallus} S | 99.96 | |
| 2jd4_A | 383 | Laminin subunit alpha-1; basement membrane protein | 99.96 | |
| 3v64_A | 191 | Low-density lipoprotein receptor-related protein; | 99.96 | |
| 1dyk_A | 394 | Laminin alpha 2 chain; metal binding protein; 2.0A | 99.96 | |
| 3pve_A | 189 | Agrin, AGRN protein; mRNA splicing, structural gen | 99.95 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 99.95 | |
| 2r16_A | 182 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sp | 99.94 | |
| 1d2s_A | 170 | SHBG, sex hormone-binding globulin; steroid transp | 99.94 | |
| 1h30_A | 422 | GAS6, growth-arrest-specific protein; laminin G-do | 99.94 | |
| 2h0b_A | 184 | Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A | 99.93 | |
| 3bod_A | 178 | Neurexin-1-alpha; neurexin1D, LNS6, alternative sp | 99.93 | |
| 1f5f_A | 205 | SHBG, sex hormone-binding globulin; jellyroll, sig | 99.93 | |
| 2r1d_A | 226 | Neurexin-1-beta, neurexin I-beta; beta-sandwich, c | 99.92 | |
| 2r1b_A | 220 | Neurexin-1-beta, neurexin I-beta; beta-sandwich, c | 99.92 | |
| 3v64_A | 191 | Low-density lipoprotein receptor-related protein; | 99.9 | |
| 1pz7_A | 204 | Agrin; structural protein; 1.42A {Gallus gallus} S | 99.9 | |
| 3pve_A | 189 | Agrin, AGRN protein; mRNA splicing, structural gen | 99.88 | |
| 3sh4_A | 195 | LG3 peptide; actin disassambly, integrin alpha12 B | 99.88 | |
| 1d2s_A | 170 | SHBG, sex hormone-binding globulin; steroid transp | 99.88 | |
| 1f5f_A | 205 | SHBG, sex hormone-binding globulin; jellyroll, sig | 99.84 | |
| 2r16_A | 182 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sp | 99.83 | |
| 3bod_A | 178 | Neurexin-1-alpha; neurexin1D, LNS6, alternative sp | 99.82 | |
| 2h0b_A | 184 | Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A | 99.82 | |
| 2r1b_A | 220 | Neurexin-1-beta, neurexin I-beta; beta-sandwich, c | 99.78 | |
| 2r1d_A | 226 | Neurexin-1-beta, neurexin I-beta; beta-sandwich, c | 99.78 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 99.77 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 99.75 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 99.75 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 99.74 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 99.74 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 99.68 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 99.64 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 99.62 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 99.53 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 99.51 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 99.5 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 99.5 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 99.47 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 99.47 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 99.44 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 99.44 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 99.41 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 99.37 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 99.37 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 99.34 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 99.32 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 99.3 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 99.29 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 99.28 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 99.28 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 99.28 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 99.27 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 99.27 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 99.25 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 99.24 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 99.23 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 99.2 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 99.19 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 99.19 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 99.19 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 99.19 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 99.17 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 99.16 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 99.15 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 99.12 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 99.11 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 99.11 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 99.08 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 99.06 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 99.01 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 99.0 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 98.97 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 98.96 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 98.88 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 98.82 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 98.82 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 98.78 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 98.76 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 98.75 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 98.71 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 98.7 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 98.69 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 98.66 | |
| 3flp_A | 217 | SAP-like pentraxin; physiological doubly-stacked h | 98.65 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 98.65 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 98.64 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 98.64 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 98.62 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 98.62 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 98.61 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 98.61 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 98.6 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 98.58 | |
| 3kqr_A | 204 | Serum amyloid P-component; glycoprotein, disulfide | 98.56 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 98.53 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 98.53 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 98.52 | |
| 3pvn_A | 206 | C-reactive protein; pentraxin family, immune syste | 98.52 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 98.45 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 98.45 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 98.44 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 98.44 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 98.43 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 98.4 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 98.39 | |
| 2erf_A | 209 | Thrombospondin-1; TSP-1, N-terminal TSPN, HBD, sug | 98.35 | |
| 1za4_A | 251 | Thrombospondin 1; TSP-1, NTSP-1, HBD, arixtra, cel | 98.34 | |
| 2v73_A | 191 | CBM40, putative EXO-alpha-sialidase; carbohydrate- | 98.33 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 98.31 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 98.3 | |
| 2uur_A | 245 | Collagen alpha-1(IX) chain; glycoprotein, hydroxyl | 98.15 | |
| 4dqa_A | 355 | Uncharacterized protein; two domains structure, DU | 98.06 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 98.06 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 98.04 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 97.98 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 97.95 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 97.9 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 97.84 | |
| 2i9a_A | 145 | Urokinase-type plasminogen activator; growth facto | 97.82 | |
| 3flp_A | 217 | SAP-like pentraxin; physiological doubly-stacked h | 97.81 | |
| 2i9a_A | 145 | Urokinase-type plasminogen activator; growth facto | 97.79 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 97.71 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 97.7 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 97.66 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 97.63 | |
| 3kqr_A | 204 | Serum amyloid P-component; glycoprotein, disulfide | 97.63 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 97.62 | |
| 3pvn_A | 206 | C-reactive protein; pentraxin family, immune syste | 97.61 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 97.61 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 97.58 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 97.56 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 97.53 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 97.5 | |
| 3r08_E | 82 | T-cell surface glycoprotein CD3 epsilon chain; ant | 97.5 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 97.47 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 97.46 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 97.43 | |
| 2rnl_A | 50 | Amphiregulin; AR, colorectum cell-derived growth f | 97.43 | |
| 2v73_A | 191 | CBM40, putative EXO-alpha-sialidase; carbohydrate- | 97.43 | |
| 2lu7_A | 84 | Obscurin-like protein 1; structural genomics, nort | 97.39 | |
| 1xau_A | 122 | B- and T-lymphocyte attenuator; IG domain, beta sa | 97.37 | |
| 2erf_A | 209 | Thrombospondin-1; TSP-1, N-terminal TSPN, HBD, sug | 97.35 | |
| 2lvc_A | 91 | Obscurin-like protein 1; structural genomics, nort | 97.35 | |
| 3knb_B | 107 | Obscurin-like protein 1; IG-like, titin, OBSL1, AT | 97.34 | |
| 1za4_A | 251 | Thrombospondin 1; TSP-1, NTSP-1, HBD, arixtra, cel | 97.32 | |
| 4hwu_A | 95 | Fibroblast growth factor receptor 2; FGFR2, KGFR, | 97.31 | |
| 1gl4_B | 98 | Basement membrane-specific heparan sulfate proteog | 97.31 | |
| 2jkb_A | 686 | Sialidase B; intramolecular trans-sialidase, lyase | 97.29 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 97.27 | |
| 2ckn_A | 95 | Basic fibroblast growth factor receptor 1; kinase, | 97.26 | |
| 1waa_A | 93 | Titin; metal binding protein, calmodulin-binding, | 97.25 | |
| 2cr3_A | 99 | Basic fibroblast growth factor receptor 1; IG fold | 97.24 | |
| 3knb_A | 100 | Titin; IG-like, titin, OBSL1, ATP-binding, calmodu | 97.21 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 97.21 | |
| 2edj_A | 100 | Roundabout homolog 2; KIAA1568 protein, beta sandw | 97.2 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 97.2 | |
| 2yr3_A | 99 | Myosin light chain kinase, smooth muscle; IG domai | 97.19 | |
| 2yuz_A | 100 | Myosin-binding protein C, SLOW-type; immunoglobuli | 97.18 | |
| 2sli_A | 679 | Intramolecular trans-sialidase; hydrolase, neurami | 97.14 | |
| 3kvq_A | 108 | Vascular endothelial growth factor receptor 2; veg | 97.14 | |
| 1wit_A | 93 | Twitchin 18TH IGSF module; immunoglobulin superfam | 97.11 | |
| 2aw2_A | 120 | B and T lymphocyte attenuator; IGI domain, IGG dom | 97.1 | |
| 2rnl_A | 50 | Amphiregulin; AR, colorectum cell-derived growth f | 97.08 | |
| 1wwb_X | 103 | Protein (brain derived neurotrophic factor recepto | 97.07 | |
| 2cqv_A | 114 | MLCK, myosin light chain kinase, smooth muscle and | 97.06 | |
| 1he7_A | 126 | High affinity nerve growth factor receptor; transf | 97.03 | |
| 2e7c_A | 118 | Myosin-binding protein C, fast-type; IG-like domai | 97.01 | |
| 2bk8_A | 97 | Connectin, M1, titin heart isoform N2-B; IG domain | 97.01 | |
| 2eo9_A | 118 | Roundabout homolog 1; beta-sandwich, IG-fold, H-RO | 96.99 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 96.98 | |
| 3bfo_A | 91 | Mucosa-associated lymphoid tissue lymphoma translo | 96.94 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 96.92 | |
| 3caf_A | 100 | Fibroblast growth factor receptor 2; FGFR2, D2, AT | 96.9 | |
| 1g1c_A | 99 | Immunoglobulin-like domain I1 from titin; immunogl | 96.9 | |
| 2kdg_A | 100 | Myotilin; immonoglobulin domain, actin-binding, st | 96.86 | |
| 1u2h_A | 99 | APEG-1, aortic preferentially expressed protein 1; | 96.82 | |
| 4fqp_A | 313 | Poliovirus receptor; immunoglobulin-like domain, I | 96.81 | |
| 1wwc_A | 118 | Protein (NT-3 growth factor receptor TRKC); TRK re | 96.8 | |
| 3irg_B | 107 | Obscurin-like protein 1; IG-like, titin, OBSL1, co | 96.79 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 96.78 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 96.78 | |
| 2dlt_A | 106 | Myosin binding protein C, fast-type; IG-like domai | 96.77 | |
| 1gxe_A | 139 | Myosin binding protein C, cardiac-type; cytoskelet | 96.77 | |
| 2ens_A | 96 | Advanced glycosylation END product-specific recept | 96.74 | |
| 3puc_A | 99 | Titin; I-SET IG-like domain, M-BAND, transferase; | 96.73 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 96.73 | |
| 1nct_A | 106 | Titin; cell adhesion, glycoprotein, transmembrane, | 96.72 | |
| 4dqa_A | 355 | Uncharacterized protein; two domains structure, DU | 96.72 | |
| 3qp3_A | 103 | Titin; I-SET IG-like, sarcomere, M-BAND, transfera | 96.72 | |
| 2edf_A | 103 | Obscurin; beta-sandwich, IG-fold, structural genom | 96.7 | |
| 2uur_A | 245 | Collagen alpha-1(IX) chain; glycoprotein, hydroxyl | 96.69 | |
| 1a8d_A | 452 | Tetanus neurotoxin; clostridial, ganglioside bindi | 96.67 | |
| 2dm3_A | 110 | KIAA0992 protein, palladin; beta-sandwich, myopall | 96.64 | |
| 1pd6_A | 104 | Cardiac MYBP-C;, myosin-binding protein C, cardiac | 96.64 | |
| 2dm7_A | 108 | KIAA1556 protein; beta-sandwich, IG-fold, obscurin | 96.64 | |
| 3cx2_A | 108 | Myosin-binding protein C, cardiac-type; protonatio | 96.61 | |
| 1x44_A | 103 | Myosin-binding protein C, SLOW-type; IG-like domai | 96.61 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 96.59 | |
| 2edn_A | 118 | Myosin-binding protein C, fast-type; beta-sandwich | 96.59 | |
| 2dm2_A | 110 | Palladin; beta-sandwich, KIAA0992, actin-associate | 96.57 | |
| 2cpc_A | 113 | KIAA0657 protein; immunoglobulin domain, IG domain | 96.56 | |
| 3s35_X | 122 | Vascular endothelial growth factor receptor 2; ant | 96.56 | |
| 2eny_A | 104 | Obscurin; beta-sandwich, IG-fold, structural genom | 96.55 | |
| 2edh_A | 113 | Obscurin; structural genomics, NPPSFA, national pr | 96.54 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 96.54 | |
| 2qsq_A | 111 | Carcinoembryonic antigen-related cell adhesion MO; | 96.52 | |
| 2kkq_A | 116 | Myotilin; unknown function, actin-binding, cell me | 96.51 | |
| 3so5_A | 112 | LIG-3, leucine-rich repeats and immunoglobulin-lik | 96.51 | |
| 4b1m_A | 185 | Levanase; hydrolase, CBM66; HET: FRU; 1.10A {Bacil | 96.47 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 96.46 | |
| 3irg_A | 100 | Titin; IG-like, titin, OBSL1, complex, alternative | 96.46 | |
| 2eo1_A | 102 | OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 | 96.45 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 96.43 | |
| 2k1m_A | 95 | Myosin-binding protein C, cardiac-type; IG-I domai | 96.43 | |
| 1jbj_A | 186 | CD3 epsilon and gamma ectodomain fragment complex; | 96.34 | |
| 2e6p_A | 104 | Obscurin-like protein 1; IG-like domain, structura | 96.32 | |
| 2yuv_A | 100 | Myosin-binding protein C, SLOW-type; SLOW-type myo | 96.3 | |
| 2dku_A | 103 | KIAA1556 protein; beta-sandwich, IG-fold, obscurin | 96.28 | |
| 2dav_A | 126 | SLOW MYBP-C, myosin-binding protein C, SLOW-type; | 96.28 | |
| 2e6q_A | 112 | Obscurin-like protein 1; IG-like domain, structura | 96.26 | |
| 2edk_A | 101 | Myosin-binding protein C, fast-type; IG fold, fast | 96.23 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 96.23 | |
| 1fhg_A | 154 | Telokin; immunoglobulin fold, beta barrel, contrac | 96.17 | |
| 1hnf_A | 182 | CD2; T lymphocyte adhesion glycoprotein; HET: NAG; | 96.11 | |
| 1gl4_A | 285 | Nidogen-1, entactin; immunoglobulin-like domain, e | 96.08 | |
| 1uct_A | 218 | Immunoglobulin alpha FC receptor; beta stands, imm | 96.04 | |
| 3r4d_A | 208 | CEA-related cell adhesion molecule 1, isoform 1/2; | 96.02 | |
| 3qr2_A | 137 | Basigin; CD147, EMMPRIN, immunoglobulin-like domai | 96.01 | |
| 3rbs_A | 207 | Myomesin-1; immunoglobulin C-SET domain, contractI | 96.0 | |
| 2gi7_A | 184 | GPVI protein; IG-like domains, blood clotting, cel | 95.89 | |
| 3p2t_A | 196 | Leukocyte immunoglobulin-like receptor subfamily 4 | 95.87 | |
| 1hng_A | 176 | CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra | 95.84 | |
| 1oll_A | 188 | NK receptor; immune system/receptor, NK cell trigg | 95.82 | |
| 1gsm_A | 210 | Madcam-1, mucosal addressin cell adhesion molecule | 95.81 | |
| 4fom_A | 308 | Poliovirus receptor-related protein 3; immunoglobu | 95.79 | |
| 2iep_A | 192 | Muscle-specific kinase receptor; beta-sandwich, si | 95.78 | |
| 1ugn_A | 198 | LIR1, leukocyte immunoglobulin-like receptor 1; im | 95.78 | |
| 2yd1_A | 212 | Tyrosine-protein phosphatase LAR; hydrolase; 1.80A | 95.77 | |
| 2kl7_A | 71 | Fibulin-4; secreted, calcium, disease mutation, di | 95.76 | |
| 4hwn_A | 108 | FC receptor-like A; FCRLA, FCRL, IG-C2 domain, IG | 95.73 | |
| 3m45_A | 108 | Cell adhesion molecule 2; IG fold, dimer, disulfid | 95.72 | |
| 2wv3_A | 190 | Neuroplastin; igcam, membrane, glycoprotein, cell | 95.72 | |
| 2d3v_A | 196 | Leukocyte immunoglobulin-like receptor subfamily A | 95.71 | |
| 2e7b_A | 103 | Obscurin; IG-like domain, structural genomics, NPP | 95.71 | |
| 3kld_A | 384 | Contactin 4, axcam, BIG-2; cell adhesion, protein | 95.69 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 95.68 | |
| 3u83_A | 331 | Poliovirus receptor-related protein 1; nectin-1, h | 95.65 | |
| 2vr9_A | 217 | Roundabout 1, ROBO; immunoglobulin-like domain, AX | 95.64 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 95.59 | |
| 2cr6_A | 115 | KIAA1556 protein, obscurin; IG-fold, immunoglobuli | 95.59 | |
| 2v9r_A | 212 | Roundabout homolog 1; proto-oncogene, differentiat | 95.59 | |
| 2x1w_L | 213 | Vascular endothelial growth factor receptor 2; hor | 95.54 | |
| 4gos_A | 125 | V-SET domain-containing T-cell activation inhibit; | 95.48 | |
| 3p2t_A | 196 | Leukocyte immunoglobulin-like receptor subfamily 4 | 95.45 | |
| 1ugn_A | 198 | LIR1, leukocyte immunoglobulin-like receptor 1; im | 95.43 | |
| 2vsd_A | 105 | CHIR AB1; immune system receptor, FC receptor; HET | 95.42 | |
| 1jhl_L | 108 | IGG1-kappa D11.15 FV (light chain); complex(antibo | 95.42 | |
| 2d3v_A | 196 | Leukocyte immunoglobulin-like receptor subfamily A | 95.41 | |
| 2v9t_A | 117 | Roundabout homolog 1; structural protein-receptor | 95.35 | |
| 2cry_A | 122 | KIN of IRRE-like protein 3; IG fold, KIN of irregu | 95.33 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 95.32 | |
| 2va4_A | 192 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; t | 95.29 | |
| 1f2q_A | 176 | High affinity immunoglobulin epsilon receptor ALP | 95.24 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 95.24 | |
| 3rbg_A | 124 | Cytotoxic and regulatory T-cell molecule; IGV, crt | 95.23 | |
| 2kl7_A | 71 | Fibulin-4; secreted, calcium, disease mutation, di | 95.21 | |
| 3ejj_X | 289 | Macrophage colony-stimulating factor 1 receptor; g | 95.2 | |
| 2r15_A | 212 | Myomesin-1; sarcomeric protein, IG-like domains, h | 95.2 | |
| 2wim_A | 291 | N-CAM 2, NCAM2, neural cell adhesion molecule 2; c | 95.19 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 95.18 | |
| 2gi7_A | 184 | GPVI protein; IG-like domains, blood clotting, cel | 95.17 | |
| 3s97_C | 201 | Contactin-1; carbonic anhdyrase like immunoglobuli | 95.16 | |
| 3sgj_C | 204 | Human FCG3A receptor; receptor complex, FC recepto | 95.16 | |
| 3k0w_A | 218 | Mucosa-associated lymphoid tissue lymphoma translo | 95.14 | |
| 1f97_A | 212 | Junction adhesion molecule; immunoglobulin superfa | 95.13 | |
| 1sy6_A | 204 | T-cell surface glycoprotein CD3 gamma/epsilon chai | 95.12 | |
| 2v44_A | 189 | NCAM2, neural cell adhesion molecule 2; phosphoryl | 95.1 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 95.08 | |
| 1uct_A | 218 | Immunoglobulin alpha FC receptor; beta stands, imm | 95.05 | |
| 2yd6_A | 212 | PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa | 95.03 | |
| 2x1w_L | 213 | Vascular endothelial growth factor receptor 2; hor | 95.01 | |
| 3k0w_A | 218 | Mucosa-associated lymphoid tissue lymphoma translo | 94.95 | |
| 1ob1_C | 99 | Major merozoite surface protein; immune system, im | 94.91 | |
| 1f2q_A | 176 | High affinity immunoglobulin epsilon receptor ALP | 94.9 | |
| 4frw_A | 218 | Poliovirus receptor-related protein 4; immunoglobu | 94.9 | |
| 2iep_A | 192 | Muscle-specific kinase receptor; beta-sandwich, si | 94.88 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 94.88 | |
| 3lcy_A | 197 | Titin; A-BAND, IG tandem domains, ATP-binding, cal | 94.85 | |
| 1gl4_A | 285 | Nidogen-1, entactin; immunoglobulin-like domain, e | 94.76 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 94.75 | |
| 3qs7_E | 423 | FL cytokine receptor; immunoglobulin-like domain, | 94.73 | |
| 4fmk_A | 225 | Poliovirus receptor-related protein 2; immunoglobu | 94.69 | |
| 1rhf_A | 182 | Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 | 94.68 | |
| 2j8h_A | 197 | Titin, connectin; cardiomyopathy, nuclear protein, | 94.68 | |
| 1nkr_A | 201 | P58-CL42 KIR; inhibitory receptor, natural killer | 94.67 | |
| 1z9m_A | 145 | GAPA225; nectin-like, IG-like domain, V domain, ce | 94.66 | |
| 1ob1_C | 99 | Major merozoite surface protein; immune system, im | 94.61 | |
| 2yd6_A | 212 | PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa | 94.61 | |
| 1cs6_A | 382 | Axonin-1; neural cell adhesion, cell adhesion; 1.8 | 94.58 | |
| 1oll_A | 188 | NK receptor; immune system/receptor, NK cell trigg | 94.56 | |
| 3bp6_B | 202 | Programmed cell death 1 ligand 2; PD-1, PD-L2, com | 94.55 | |
| 3ojm_B | 231 | Fibroblast growth factor receptor 2; beta trefoil | 94.54 | |
| 2y23_A | 312 | Myomesin; structural protein, sarcomere, M-BAND, i | 94.53 | |
| 3sgj_C | 204 | Human FCG3A receptor; receptor complex, FC recepto | 94.53 | |
| 2oyp_A | 109 | Hepatitis A virus cellular receptor 2; TIM-3, T-ce | 94.53 | |
| 2y25_A | 317 | Myomesin; structural protein, sarcomere, M-BAND, i | 94.52 | |
| 4fa8_A | 203 | Secreted protein BARF1; immunoglobulin-like domain | 94.51 | |
| 2v5t_A | 189 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; p | 94.48 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 94.45 | |
| 3oq3_B | 329 | IFN-alpha/beta binding protein C12R; mousepox viru | 94.44 | |
| 1vca_A | 202 | VCAM-D1,2, human vascular cell adhesion molecule-1 | 94.43 | |
| 1p6f_A | 242 | NKP46, natural cytotoxicity triggering receptor 1; | 94.39 | |
| 3oq3_B | 329 | IFN-alpha/beta binding protein C12R; mousepox viru | 94.38 | |
| 2a38_A | 194 | Titin; Z1Z2, structural protein; 2.00A {Homo sapie | 94.38 | |
| 1epf_A | 191 | NCAM, protein (neural cell adhesion molecule); imm | 94.37 | |
| 4f80_A | 226 | Butyrophilin subfamily 3 member A1; B7 superfamily | 94.35 | |
| 4gjt_B | 123 | Poliovirus receptor-related protein 4; six-bladed | 94.32 | |
| 3vh8_G | 316 | Killer cell immunoglobulin-like receptor 3DL1; imm | 94.28 | |
| 3grw_A | 241 | Fibroblast growth factor receptor 3; FGFR3, protei | 94.23 | |
| 2or8_A | 116 | Hepatitis A virus cellular receptor 1 homolog; bet | 94.22 | |
| 4f80_A | 226 | Butyrophilin subfamily 3 member A1; B7 superfamily | 94.21 | |
| 2c5d_C | 195 | AXL oncogene, tyrosine-protein kinase receptor UFO | 94.2 | |
| 3udw_C | 118 | Poliovirus receptor; PVR tigit IGSF signal transdu | 94.19 | |
| 4dep_C | 349 | Interleukin-1 receptor accessory protein; B-trefoi | 94.07 | |
| 1qfw_M | 108 | FV, antibody (anti beta subunit) (light chain); gl | 94.07 | |
| 1qz1_A | 291 | Neural cell adhesion molecule 1, 140 kDa isoform; | 94.07 | |
| 1eaj_A | 126 | Coxsackie virus and adenovirus receptor; virus/vir | 94.06 | |
| 1ccz_A | 171 | Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 | 94.06 | |
| 3mj6_A | 268 | Junctional adhesion molecule-like; immunoglobulin | 94.01 | |
| 1h5b_A | 113 | Murine T cell receptor (TCR) valpha domain; immune | 93.99 | |
| 1mqk_L | 120 | Antibody 7E2 FV fragment, light chain; membrane pr | 93.96 | |
| 1kig_L | 51 | Factor XA; glycoprotein, serine protease, plasma, | 93.94 | |
| 3q0h_A | 117 | T cell immunoreceptor with IG and ITIM domains; im | 93.94 | |
| 3qs9_E | 527 | FL cytokine receptor; immunoglobulin-like domain, | 93.93 | |
| 3qs7_E | 423 | FL cytokine receptor; immunoglobulin-like domain, | 93.89 | |
| 1f97_A | 212 | Junction adhesion molecule; immunoglobulin superfa | 93.88 | |
| 3khq_A | 133 | B-cell antigen receptor complex-associated protei | 93.86 | |
| 1fnl_A | 175 | Low affinity immunoglobulin gamma FC region recept | 93.85 | |
| 1xt5_A | 135 | Variable region-containing chitin-binding protein | 93.8 | |
| 2rik_A | 284 | Titin; I-SET IG fold, poly-IG linear array, struct | 93.79 | |
| 2yd1_A | 212 | Tyrosine-protein phosphatase LAR; hydrolase; 1.80A | 93.74 | |
| 4dep_C | 349 | Interleukin-1 receptor accessory protein; B-trefoi | 93.71 | |
| 1nbq_A | 209 | JAM, junctional adhesion molecule 1, PAM-1; reovir | 93.71 | |
| 2o26_X | 290 | MAST/stem cell growth factor receptor; stem cell f | 93.7 | |
| 3p3y_A | 404 | Neurofascin; IG domains, cell adhesion; HET: NAG; | 93.69 | |
| 1pko_A | 139 | Myelin oligodendrocyte glycoprotein; IGV-domain, i | 93.69 | |
| 1bih_A | 395 | Hemolin; insect immunity, LPS-binding, homophilic | 93.63 | |
| 3v0a_B | 1196 | NTNH; botulinum neurotoxin, toxin, neurotoxin asso | 93.59 | |
| 2vol_A | 207 | Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, | 93.56 | |
| 2wim_A | 291 | N-CAM 2, NCAM2, neural cell adhesion molecule 2; c | 93.54 | |
| 2yz1_A | 120 | Tyrosine-protein phosphatase non-receptor type sub | 93.52 | |
| 1itb_B | 315 | Type 1 interleukin-1 receptor; immunoglobulin fold | 93.51 | |
| 3ry4_A | 170 | Low affinity immunoglobulin gamma FC region recep; | 93.51 | |
| 4dkd_C | 292 | Macrophage colony-stimulating factor 1 receptor; d | 93.51 | |
| 2q20_A | 109 | VK1 O18/O8 germline light chain variable domain; A | 93.44 | |
| 1b6u_A | 257 | KIR2DL3, P58 killer cell inhibitory receptor; natu | 93.44 | |
| 2edo_A | 121 | CD48 antigen; beta-sandwich, IG-fold, B-lymphocyte | 93.44 | |
| 1qz1_A | 291 | Neural cell adhesion molecule 1, 140 kDa isoform; | 93.43 | |
| 3mj8_L | 213 | Stimulatory hamster antibody HL4E10 FAB light CHA; | 93.42 | |
| 2yd9_A | 304 | Receptor-type tyrosine-protein phosphatase S; hydr | 93.35 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 93.34 | |
| 2yd9_A | 304 | Receptor-type tyrosine-protein phosphatase S; hydr | 93.32 | |
| 3rjd_A | 262 | High affinity immunoglobulin gamma FC receptor I; | 93.25 | |
| 1n1i_A | 105 | Merozoite surface protein-1; MSP1, malaria, surfac | 93.23 | |
| 1kli_L | 69 | Factor VIIA; extrinsic coagulation pathway, serine | 93.23 | |
| 2y25_A | 317 | Myomesin; structural protein, sarcomere, M-BAND, i | 93.23 | |
| 3grw_A | 241 | Fibroblast growth factor receptor 3; FGFR3, protei | 93.22 | |
| 1ry7_B | 334 | FGFR-3, fibroblast growth factor receptor 3; FGF-F | 93.2 | |
| 1itb_B | 315 | Type 1 interleukin-1 receptor; immunoglobulin fold | 93.19 | |
| 2rik_A | 284 | Titin; I-SET IG fold, poly-IG linear array, struct | 93.18 | |
| 2rgs_A | 218 | I, IG gamma-2B heavy chain; FC-fragment, immunoglo | 93.02 | |
| 2ywz_A | 111 | NEW antigen receptor variable domain; IG VNAR, imm | 93.01 | |
| 2jju_A | 127 | Signal regulatory protein beta-1; immunoglobulin d | 93.0 | |
| 2dru_A | 180 | Chimera of CD48 antigen and T-cell surface antige; | 93.0 | |
| 4i0k_A | 222 | CD276 antigen; immunoglobulin domain, glycoprotein | 93.0 | |
| 2ny1_B | 184 | T-cell surface glycoprotein CD4; HIV, GP120, CD4, | 92.99 | |
| 4dkd_C | 292 | Macrophage colony-stimulating factor 1 receptor; d | 92.97 | |
| 1wio_A | 363 | CD4, T-cell surface glycoprotein CD4; immunoglobul | 92.97 | |
| 3o4o_C | 339 | Interleukin-1 receptor type 2; cytokine-receptor c | 92.94 | |
| 3tv3_L | 211 | PGT128 light chain, IG lambda-2 chain C regions; F | 92.91 | |
| 2if7_A | 193 | SLAM family member 6; NTB-A, homophilic receptor, | 92.9 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 92.84 | |
| 2p1y_A | 238 | Bispecific alpha/beta TCR; autoimmunity, immunoglo | 92.84 | |
| 2wng_A | 327 | Tyrosine-protein phosphatase non-receptor type sub | 92.8 | |
| 3d9a_L | 213 | Light chain of hyhel10 antibody fragment (FAB); ly | 92.8 | |
| 3vh8_G | 316 | Killer cell immunoglobulin-like receptor 3DL1; imm | 92.78 | |
| 4fom_A | 308 | Poliovirus receptor-related protein 3; immunoglobu | 92.76 | |
| 3ojm_B | 231 | Fibroblast growth factor receptor 2; beta trefoil | 92.75 | |
| 1dr9_A | 201 | B7-1 (CD80), T lymphocyte activation antigen; IG s | 92.75 | |
| 2bz6_L | 53 | Blood coagulation factor VIIA; serine protease, en | 92.72 | |
| 3o4o_C | 339 | Interleukin-1 receptor type 2; cytokine-receptor c | 92.72 | |
| 3qs9_E | 527 | FL cytokine receptor; immunoglobulin-like domain, | 92.71 | |
| 3nl4_L | 213 | Antigen binding fragment, immunoglobulin IGG - LI; | 92.71 | |
| 2d9c_A | 136 | Signal-regulatory protein beta-1; beta-sandwich, S | 92.65 | |
| 1p6f_A | 242 | NKP46, natural cytotoxicity triggering receptor 1; | 92.63 | |
| 3mj6_A | 268 | Junctional adhesion molecule-like; immunoglobulin | 92.62 | |
| 3jz7_A | 214 | MCAR, CAR, coxsackievirus and adenovirus receptor | 92.58 | |
| 3kld_A | 384 | Contactin 4, axcam, BIG-2; cell adhesion, protein | 92.57 | |
| 3r06_A | 213 | Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; | 92.56 | |
| 3laf_A | 403 | Deleted in colorectal cancer; netrin-1 receptor, i | 92.55 | |
| 1b6u_A | 257 | KIR2DL3, P58 killer cell inhibitory receptor; natu | 92.55 | |
| 3mjg_X | 289 | Beta-type platelet-derived growth factor receptor; | 92.51 | |
| 2fbo_J | 250 | V1V2;, variable region-containing chitin-binding p | 92.49 | |
| 2vr9_A | 217 | Roundabout 1, ROBO; immunoglobulin-like domain, AX | 92.49 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 92.46 | |
| 1ry7_B | 334 | FGFR-3, fibroblast growth factor receptor 3; FGF-F | 92.43 | |
| 3eow_R | 221 | Poliovirus receptor; immunoglobulin super family, | 92.42 | |
| 2v5m_A | 388 | Dscam; neurobiology SPL immunoglobulin domain, cel | 92.38 | |
| 3laf_A | 403 | Deleted in colorectal cancer; netrin-1 receptor, i | 92.36 | |
| 4i0k_A | 222 | CD276 antigen; immunoglobulin domain, glycoprotein | 92.36 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 92.36 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 92.33 | |
| 4b1m_A | 185 | Levanase; hydrolase, CBM66; HET: FRU; 1.10A {Bacil | 92.31 | |
| 1xiw_B | 79 | T-cell surface glycoprotein CD3 delta chain; CD3-e | 92.31 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 92.28 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 92.28 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 92.23 | |
| 1cs6_A | 382 | Axonin-1; neural cell adhesion, cell adhesion; 1.8 | 92.22 | |
| 3r4d_A | 208 | CEA-related cell adhesion molecule 1, isoform 1/2; | 92.18 | |
| 1olz_A | 663 | Semaphorin 4D; developmental protein, CD100, beta- | 92.13 | |
| 1nqb_A | 256 | Single-chain antibody fragment; multivalent antibo | 92.09 | |
| 2o26_X | 290 | MAST/stem cell growth factor receptor; stem cell f | 92.01 | |
| 1i1c_A | 239 | IGG2A, IG gamma-2A chain C region; FC, immune syst | 92.01 | |
| 2znx_A | 242 | SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s | 91.99 | |
| 2v5m_A | 388 | Dscam; neurobiology SPL immunoglobulin domain, cel | 91.98 | |
| 3ejj_X | 289 | Macrophage colony-stimulating factor 1 receptor; g | 91.97 | |
| 4frw_A | 218 | Poliovirus receptor-related protein 4; immunoglobu | 91.93 | |
| 1a8d_A | 452 | Tetanus neurotoxin; clostridial, ganglioside bindi | 91.93 | |
| 3noi_A | 120 | Natural cytotoxicity triggering receptor 3; immune | 91.87 | |
| 3bqu_C | 233 | 3H6 FAB light chain; beta sheet, immune system; 3. | 91.85 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 91.85 | |
| 1kli_L | 69 | Factor VIIA; extrinsic coagulation pathway, serine | 91.83 | |
| 1n1i_A | 105 | Merozoite surface protein-1; MSP1, malaria, surfac | 91.82 | |
| 3mjg_X | 289 | Beta-type platelet-derived growth factor receptor; | 91.82 | |
| 3pv7_A | 248 | B7-H6, IG-like domain-containing protein DKFZP686O | 91.81 | |
| 1bih_A | 395 | Hemolin; insect immunity, LPS-binding, homophilic | 91.81 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 91.81 | |
| 2p1y_A | 238 | Bispecific alpha/beta TCR; autoimmunity, immunoglo | 91.78 | |
| 1c1e_H | 219 | Catalytic antibody 1E9 (heavy chain); diels-alder, | 91.78 | |
| 2pet_A | 231 | Lutheran blood group glycoprotein; immunoglobulin | 91.78 | |
| 2e26_A | 725 | Reelin, reeler protein; signaling protein; HET: NA | 91.78 | |
| 3sob_L | 237 | Antibody light chain; beta propeller, protein bind | 91.77 | |
| 2ghw_B | 247 | Anti-SARS SCFV antibody, 80R; S protein, neutraliz | 91.73 | |
| 3sbw_C | 222 | Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- | 91.73 | |
| 1lk3_L | 210 | 9D7 light chain; antigen-antibody complex, immune | 91.65 | |
| 3uzq_A | 253 | Anti-dengue MAB 4E11; dengue antibody neutralizati | 91.61 | |
| 2zg1_A | 214 | Sialic acid-binding IG-like lectin 5; siglec-5 inh | 91.54 | |
| 3ux9_B | 256 | SCFV antibody; five helices, long loop connecting | 91.53 | |
| 2jjs_C | 127 | Leukocyte surface antigen CD47; signal regulatory | 91.45 | |
| 2xzc_L | 216 | FAB A.17 light chain; immune system; HET: XOP; 1.3 | 91.37 | |
| 4fmk_A | 225 | Poliovirus receptor-related protein 2; immunoglobu | 91.34 | |
| 3s96_B | 218 | 3B5H10 FAB light chain; huntingtin, immune system; | 91.34 | |
| 2ptt_A | 110 | CD48 antigen; CD244, CD48, NK cell receptor, X-RAY | 91.34 | |
| 1nzi_A | 159 | Complement C1S component; calcium, innate immunity | 91.32 | |
| 1wio_A | 363 | CD4, T-cell surface glycoprotein CD4; immunoglobul | 91.31 | |
| 2jkb_A | 686 | Sialidase B; intramolecular trans-sialidase, lyase | 91.27 | |
| 2c1o_A | 254 | IGK-C protein; FAB fragment, enantioselective, fin | 91.26 | |
| 2p26_A | 280 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 91.25 | |
| 1ncn_A | 110 | T lymphocyte activation antigen CD86; IG V, beta s | 91.23 | |
| 1f3r_B | 257 | FV antibody fragment; IG-fold, immuno complex, ant | 91.15 | |
| 3r0n_A | 128 | Poliovirus receptor-related protein 2; IG-domain, | 91.13 | |
| 3tf7_C | 256 | 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; | 91.12 | |
| 2ocw_A | 585 | Polymeric-immunoglobulin receptor; SC, secretory, | 91.12 | |
| 3d9a_H | 210 | Heavy chain of hyhel10 antibody fragment (FAB); ly | 91.11 | |
| 2or7_A | 115 | T-cell immunoglobulin and mucin domain- containing | 91.05 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 90.94 | |
| 1moe_A | 240 | Anti-CEA MAB T84.66; anti carcinoembryonic antigen | 90.89 | |
| 2ec8_A | 524 | MAST/stem cell growth factor receptor; glycoprotei | 90.88 | |
| 3bkj_L | 252 | WO2 IGG2A FAB fragment light chain kappa; abeta, F | 90.86 | |
| 1nfd_E | 212 | H57 FAB; complex (immunoreceptor-immunoglobulin), | 90.84 | |
| 2j6e_L | 234 | IGM, FAB light chain; autoimmune complex human IGM | 90.82 | |
| 1n26_A | 325 | IL-6 receptor alpha chain; transmembrane, glycopro | 90.8 | |
| 3pl6_D | 268 | MBP peptide / T-cell receptor beta chain chimera; | 90.65 | |
| 3moq_A | 126 | NEW antigen receptor variable domain, P3(40) PEPT | 90.57 | |
| 2y23_A | 312 | Myomesin; structural protein, sarcomere, M-BAND, i | 90.52 | |
| 1q0x_L | 212 | FAB 9B1, light chain; anti-morphine antibody, FAB | 90.5 | |
| 1i8k_A | 107 | Epidermal growth factor receptor antibody MR1SCFV | 90.48 | |
| 2ghw_B | 247 | Anti-SARS SCFV antibody, 80R; S protein, neutraliz | 90.46 | |
| 1neu_A | 124 | Myelin P0 protein; structural protein, glycoprotei | 90.45 | |
| 1z7z_I | 450 | Intercellular adhesion molecule-1; ICAM-1,kilifi,C | 90.41 | |
| 2sli_A | 679 | Intramolecular trans-sialidase; hydrolase, neurami | 90.4 | |
| 3bp6_B | 202 | Programmed cell death 1 ligand 2; PD-1, PD-L2, com | 90.37 | |
| 1igt_B | 444 | IGG2A intact antibody - MAB231; intact immunoglobu | 90.31 | |
| 1f3r_B | 257 | FV antibody fragment; IG-fold, immuno complex, ant | 90.25 | |
| 3t5o_A | 913 | Complement component C6; macpf, MAC, membrane atta | 90.2 | |
| 2wqr_A | 323 | IG epsilon chain C region; immune system, immunogl | 90.15 | |
| 1svz_A | 247 | Immunoglobulin;, single-chain FV fragment 1696; an | 90.14 | |
| 3rjd_A | 262 | High affinity immunoglobulin gamma FC receptor I; | 90.13 | |
| 2znx_A | 242 | SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s | 90.12 | |
| 2w59_A | 231 | IGY FCU3-4; immunoglobulin, avian, immune system; | 90.1 | |
| 3esu_F | 250 | Antibody 14B7* light chain and antibody 14B7* heav | 90.09 |
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.5e-65 Score=641.10 Aligned_cols=658 Identities=21% Similarity=0.350 Sum_probs=380.5
Q ss_pred CceeEEEcCCcceeeeeCCcccCCCcceeeeeCCCCCCCcCCC------CccCCCCccceEEEEEEcCEEEEeecccccc
Q psy9228 56 VERMMFVDGIGPFSGESQGAFQGLDLSELVYIGAVPDFGEIHP------SAGFSNGFKGCVSRLKYNKTEFELFKMAVER 129 (834)
Q Consensus 56 ~~g~~cvd~~~~~~~~~~~~~~g~~~~~~~~~gg~p~~~~~~~------~~~~~~gf~gCi~~~~~~~~~~~~~~~~~~~ 129 (834)
+++.|.||+.....-+.+.....++....+||||+|....... ......+|.|||+++.++++++.+++.....
T Consensus 94 ~~~~L~Vd~~~~~~~~~~~~~~~~~~~~~l~vGG~p~~~~~~~~~l~~~~v~~~~~F~Gci~~l~~~~~~~~l~~~~~~~ 173 (1245)
T 3qcw_A 94 RNTTLFIDQVEAKWVEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVQSSLALPVDSGEVK 173 (1245)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred CeEEEEECCccceeeeecCCcccccccCceeeeeCChHHhcccccccCccccccCCcceEEEEEEECCcccccccccCcc
Confidence 5778899995443344444455567778999999997654221 1223479999999999999987776532211
Q ss_pred ---cCCCCCCccCCCCCCCCCCCCEeccCCCCCceEeeCCCCCCCCCCCCCCCCccCCCCCC-CeeecCCCCeEEeCCC-
Q psy9228 130 ---VGVDSCNTCKSSKHNNCINNGLCQDAATRIGYTCICPPGFSGDRCSVLGEPCYPGACGD-GSCQDVDGAMKCLCPI- 204 (834)
Q Consensus 130 ---~~~~~c~~C~~~~~~pC~n~g~C~~~~~~~~~~C~C~~g~~G~~Ce~~~~~C~~~~C~~-g~C~~~~~~~~C~C~~- 204 (834)
.++. .|. .+||. ..++|..+||+| |+|+...++|.|.|+.
T Consensus 174 ~~~~~~~---~~~---~~pC~-----------------------------~~~~~~~~~C~ngg~C~~~~~~~~C~C~~~ 218 (1245)
T 3qcw_A 174 LDDEPPN---SGG---GSPCE-----------------------------AGEEGEGGVCLNGGVCSVVDDQAVCDCSRT 218 (1245)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred ccccccc---ccC---CCCcC-----------------------------CcccCCCCCCCCCCCCccCCCCceeECCCC
Confidence 1111 111 22222 112455555554 3555555556666664
Q ss_pred CcccCcccccccccccCCCCcceEEcCCCCCc---ceEEEEEEEcccCCCceEEEeecccCCCCCCeEEEEEecCeEEEE
Q psy9228 205 GTAGKRCEQKIKILQPAFKHGSYLAYPTPKTM---RKFKVSLRLNPRDVRDGIILYSGQSDDGLGDFISLAIREKHMEFR 281 (834)
Q Consensus 205 g~~G~~Ce~~~~~~~~~F~g~~y~~~~~~~~~---~~~~i~l~f~t~~~~~glll~~~~~~~~~~d~~~l~l~~G~v~~~ 281 (834)
||.|+.||+......+.|+|.+|+.|+.+... ....|+|.|||. .++|||||.+.. .||++|+|++|+++++
T Consensus 219 g~~G~~Ce~~~~~~~~~F~G~~~~~y~~~~~~~~~~~~~i~l~FrT~-~~~GlLl~~g~~----~d~l~L~L~~G~l~l~ 293 (1245)
T 3qcw_A 219 GFRGKDCSQGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTL-QRNGLMLHTGKS----ADYVNLALKNGAVSLV 293 (1245)
T ss_dssp ------------CCEEEECSSCEEEEECTTSCEEESEEEEEEEEECS-CSCEEEEEECSS----SEEEEEEEETTEEEEE
T ss_pred CccCCccccCcccceeeeCCcEEEEEccccCcccccccEEEEEEEeC-CCCceEEEecCC----CCEEEEEEECCEEEEE
Confidence 66666666544446789999999999876433 457899999999 699999999743 6999999999999999
Q ss_pred EecCCCcc--eecC--CCCCccccc-ceeccCCCeEEEEecCCCCC----CceeeeeecCCCceeccccccccccccccc
Q psy9228 282 FDTGSATP--LYSN--DAPAFNPVS-TKEAPYGSKITLTCNNDLEA----PVEYTWSKRSNGHVLPFGAFSRENTLTLQE 352 (834)
Q Consensus 282 ~~~g~~~~--~~~~--~~~~~~~~~-~~~~~~~~~v~l~vd~~~~~----~~~~~~~~~~~~~~~~~gg~~~~~~~~~~~ 352 (834)
+++|++.. +... .......|| +.+.|.+++++|+||..... +..+.. ......+++||+|......
T Consensus 294 ~~lG~g~~~~~~~~~~~~l~Dg~WH~V~v~r~~~~~~l~VD~~~~~~~~~~~~~~~--l~~~~~l~vGG~p~~~~~~--- 368 (1245)
T 3qcw_A 294 INLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTM--LGSDDFFYVGGSPSTADLP--- 368 (1245)
T ss_dssp EEESSCCEEEEECCCSSCSSSSSCEEEEEEEETTEEEEEESSSCCEEEECSSSCCC--EEECSEEEESCCSSTTTST---
T ss_pred EEcCCCeEEEEEccCCcccCCCCEEEEEEEEeCCEEEEEECCcceeeeecCCCccc--ccCCCCEEECCcCChhhcc---
Confidence 99998862 2222 233344455 55678899999999975421 111111 1123458899988543211
Q ss_pred cccCCCceEEEEeCCC----Ccee--------EeeEEe-------e---eeccccccCCCcccccccCCccccceeEEEE
Q psy9228 353 IKNSDAGMYVCKVSNK----DMTV--------EIPSIL-------L---VTDSVPLFTQKPLSYLALPTLTDAHLHFSIE 410 (834)
Q Consensus 353 ~~~~~~~~~~C~~~~~----~~~~--------~~~~~~-------~---~~~~~~~f~~~~~s~l~~~~~~~~~~~~~i~ 410 (834)
......++.+|+.+.. .+.. ..+... . .....|..|..+.||+.+|.+.. ...++|+
T Consensus 369 ~~~~~~~F~GCi~~l~~n~~~i~l~~~~~~~~~~~~~~~~g~~~~~C~~~~~~~~vsF~~~~syl~lp~~~~-~~~~~is 447 (1245)
T 3qcw_A 369 GSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNA-KKTGSIS 447 (1245)
T ss_dssp TCCCCCCCCEEEEEEEEEESSCEECHHHHHHSCCTTEEEESSCCCCCSCCCCCCCEEECSTTCCEEECCCCC-SSEEEEE
T ss_pred CCccCCCceeEeeeeEECCccccccchhhhhcCCCccccCCceeecccCCCccccceeCCCCeEEEecCCCc-cCceEEE
Confidence 1122346778876521 1000 000000 0 01123566677889999998864 4578999
Q ss_pred EEEeeCCCCeeEEEeccCCc------cccCCCCCeEEEEEECcEEEEEEeccc--EEEE-eeeeecCCCeEEEEEEEECC
Q psy9228 411 LSFKPTDYNGLIMYTGDSNM------KSYKGKGDFVSFGLEDGYPVFRFDVGL--VVLR-SKVTLVPHEWVVVTIIKDFK 481 (834)
Q Consensus 411 ~~frt~~~~GlLl~~~~~~~------~~~~~~~d~~~l~L~~G~l~~~~~~G~--~~i~-s~~~~~dg~wH~V~v~~~~~ 481 (834)
|+|||.+++|||||...... .......||++|+|.+|+++++++.|. ..+. +..+++||+||+|.+.|..+
T Consensus 448 ~~FrT~~~~GlLly~~~~~~~~~~~~~~~~~~~df~~LeL~~G~l~l~~~~G~g~~~l~~s~~~vnDG~WH~V~l~r~~~ 527 (1245)
T 3qcw_A 448 FDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGR 527 (1245)
T ss_dssp EEEECCCSCEEEEEEECCCCSSCCSSCTTSCCCCEEEEEEETTEEEEEEESSSCEEEEESCSSCCCSSCCEEEEEEEETT
T ss_pred EEEEeCCCCeEEEEecCccccccccccccccCCCEEEEEEeCCeEEEEEECCCCeEEEeecccEecCCCEEEEEEEEecC
Confidence 99999999999999864321 011245799999999999999999984 4444 56789999999999999999
Q ss_pred eEEEEECCeeeeeeecCCCccccccCCCceeeccccCCCcccCcC-----cccccCceeEEeeeEEcCeeeeecccc--c
Q psy9228 482 EGKLSVGGEPLIVGSTPGEKLQVLNLRTPLYLGGYNIYHVTPSLS-----VEVTEGFHGCISTIDVLGSELDLINSA--V 554 (834)
Q Consensus 482 ~~~l~VD~~~~~~~~~~g~~~~~l~~~~~l~iGG~~~~~~~~~~~-----~~~~~gF~GCi~~v~ing~~~~~~~~~--~ 554 (834)
.++|.||+..... ..++. ...|++..++||||+|........+ .....+|.|||++|.||++.+++.... .
T Consensus 528 ~~~L~VD~~~~~~-~~~~~-~~~l~~~~~lylGG~p~~~~~~~~p~~~~~~~~~~gF~GCir~l~ing~~~dl~~~~~~~ 605 (1245)
T 3qcw_A 528 SGTISVNTLRTPY-TAPGE-SEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEVQ 605 (1245)
T ss_dssp EEEEEETTEEEEE-ECSSS-CCCCCCCSCEEESSCCSSCTTCCCCTTCHHHHTTCBCCEEEEEEEETTEEECHHHHTTTT
T ss_pred EEEEEEccccccc-ccCCC-cceeccCCceEEcccccccccccccccccccccccCceEEEEEEEECCEEcCchhhhhhh
Confidence 9999999976543 44555 6778899999999999853211111 123579999999999999999986532 1
Q ss_pred ccCCc-ccCCCCCCCCCCCCCCCCCCCeecccCCCCCceeeecCCCCCCCCCccCccCCCCCCccCCCceeeecCCCcEE
Q psy9228 555 DSANI-MDCSDLESSPVCAPKPCQNYGICYPTDTSERGYNCSCLTGYSGDHCEKENNMCMKGDVCKNGGMCKVTPDSYEC 633 (834)
Q Consensus 555 ~~~~~-~~C~~~~~~~~C~~~pC~ngg~C~~~~~~~~~~~C~C~~G~~G~~Ce~~~~~C~~~~pC~ngg~C~~~~~~~~C 633 (834)
...++ .+|... ..+.|.++ ||+|+|+|.+.+.+|.|
T Consensus 606 ~~~gv~~gC~~~------------------------------------------~~~~C~~~-pC~ngg~C~~~~~~~~C 642 (1245)
T 3qcw_A 606 STAGVKPSCSRE------------------------------------------TAKPCLSN-PCKNNGMCRDGWNRYVC 642 (1245)
T ss_dssp TCTTEESSCCCC------------------------------------------SSCGGGSC-CCCTTCEEEECSSSEEE
T ss_pred cccccccccccc------------------------------------------CCCCCCcc-CCCCCCEEeCCCCCeEE
Confidence 12222 244310 11345555 77777777777777777
Q ss_pred cCC-CCCCCCCcccccccceeeEEcCCceeeechhhhhhccCcceEEEEEEeCCCCeeEEecCCCCCCCCCCcceEEEEE
Q psy9228 634 LCS-LGYAPPNCAKRVSIGSEVHFLGEGYVELKKELIEERRNEETIAFDFVTDDKNALLLWNGQPSYKNGIGREFIAVAV 712 (834)
Q Consensus 634 ~C~-~g~~G~~Ce~~~~~~~~~~F~g~s~~~~~~~~~~~~~~~~~i~~~frT~~~~GlLl~~~~~~~~~~~~~~~~~l~l 712 (834)
.|+ +||+|+.|+.+. ..+.|+|.+|+.+...... ......|+|+|||..++|+|||++... ..||++|+|
T Consensus 643 ~C~~~g~~G~~C~~~~---~~~~fdGs~~l~~~~~~~~-~~~~~~isl~FrT~~~~GlLl~~~~~~-----~~d~l~L~L 713 (1245)
T 3qcw_A 643 DCSGTGYLGRSCEREA---TVLSYDGSMFMKIQLPVVM-HTEAEDVSLRFRSQRAYGILMATTSRD-----SADTLRLEL 713 (1245)
T ss_dssp ECTTTTEESTTSCEEC---CEEEEESSCCEEEEEEEEE-EESEEEEEEEEECSSSCEEEEEEEBTT-----BSCEEEEEE
T ss_pred ECCCCCcccccCcccc---cccccCCCCceEEeccccc-ccccceEEEEEEEcCCCEEEEEecCCC-----CccEEEEEE
Confidence 777 577777777653 2468999999876432221 135678999999999999999986532 368999999
Q ss_pred ECCEEEEEEEcCCcEEEEEeCCceecCCCcEEEEEEEECCEEEEEEcCeeeecccCCCCccceecCCceEEcCcCCCCCC
Q psy9228 713 VNGYLEYSYDLGDGVVTIKFSKKPVNDGIKHSVNVTRINKFGSLEVDSVIVGKGESPGSQDVINTRGNIYLGGTPNMDLM 792 (834)
Q Consensus 713 ~~G~l~~~~~~g~~~~~l~~s~~~~nDg~wH~V~i~r~~~~~~l~VD~~~~~~~~~~~~~~~l~~~~~lyiGG~p~~~~~ 792 (834)
.+|+|++++++|.++..+. +..+++||+||+|.+.|.++.++|+||+........++....++.. .+|+|+++.....
T Consensus 714 ~~G~l~l~~nlg~g~~~~~-~~~~~~DG~WH~V~v~r~~~~~~l~vD~~~~~~g~~~g~~~~l~~~-~~~~G~~~~~~~~ 791 (1245)
T 3qcw_A 714 DAGRVKLTVNLGKGPETLF-AGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFH-NIETGIITERRYL 791 (1245)
T ss_dssp ETTEEEEEEESSSSEEEEE-ECSCCCSSSCEEEEEEEETTEEEEEETTSCCEEEECSSSCCCEEEE-EEEESSCCCCTTC
T ss_pred eCCEEEEEEECCCCceEEE-eCccccCCCcEEEEEEEeCCEEEEEECCccceeEecCCCcceeecc-ccccccccccccc
Confidence 9999999999999888776 6788999999999999999999999999877666666655555443 4788988754222
Q ss_pred CCCccCCCceEEEEEEEECCceecc
Q psy9228 793 TGGRYVHPMSGLMMNIHIQNKHISN 817 (834)
Q Consensus 793 ~~~~~~~~F~GCi~~v~in~~~~~~ 817 (834)
.....+|+|||++|++|+..+++
T Consensus 792 --~~~~~~F~GCl~~v~~ng~~~~~ 814 (1245)
T 3qcw_A 792 --SSVPSNFIGHLQSLTFNGMAYID 814 (1245)
T ss_dssp --SCCCCCCEEEEEEEEETTEEHHH
T ss_pred --CCCCCCCEEEeeeEEECCEEchh
Confidence 12345899999999999976544
|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} | Back alignment and structure |
|---|
| >2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} | Back alignment and structure |
|---|
| >1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A | Back alignment and structure |
|---|
| >1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A | Back alignment and structure |
|---|
| >1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A | Back alignment and structure |
|---|
| >2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} | Back alignment and structure |
|---|
| >3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A | Back alignment and structure |
|---|
| >1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A | Back alignment and structure |
|---|
| >3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} | Back alignment and structure |
|---|
| >2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} | Back alignment and structure |
|---|
| >1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* | Back alignment and structure |
|---|
| >1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* | Back alignment and structure |
|---|
| >2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} | Back alignment and structure |
|---|
| >3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* | Back alignment and structure |
|---|
| >1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* | Back alignment and structure |
|---|
| >2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* | Back alignment and structure |
|---|
| >2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* | Back alignment and structure |
|---|
| >3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A | Back alignment and structure |
|---|
| >1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A | Back alignment and structure |
|---|
| >3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} | Back alignment and structure |
|---|
| >3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A | Back alignment and structure |
|---|
| >1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* | Back alignment and structure |
|---|
| >1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* | Back alignment and structure |
|---|
| >2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} | Back alignment and structure |
|---|
| >3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* | Back alignment and structure |
|---|
| >2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} | Back alignment and structure |
|---|
| >2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* | Back alignment and structure |
|---|
| >2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >3flp_A SAP-like pentraxin; physiological doubly-stacked heptamer, pentraxin fold, cyclic heptamer, invertebrate lectin, sugar binding protein; 2.30A {Limulus polyphemus} PDB: 3flr_A 3flt_A | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >3kqr_A Serum amyloid P-component; glycoprotein, disulfide bond, lectin, metal-binding secreted; HET: NAG; 1.50A {Homo sapiens} SCOP: b.29.1.5 PDB: 1lgn_A* 1gyk_A 2a3w_A* 2a3x_A* 2a3y_A* 1sac_A* 3d5o_A* 2w08_A* | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >3pvn_A C-reactive protein; pentraxin family, immune system; 1.98A {Homo sapiens} SCOP: b.29.1.5 PDB: 1gnh_A 1lj7_A 3l2y_A 1b09_A 3pvo_A | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >2erf_A Thrombospondin-1; TSP-1, N-terminal TSPN, HBD, sugar binding protein; 1.45A {Homo sapiens} SCOP: b.29.1.4 PDB: 2es3_A 1z78_A | Back alignment and structure |
|---|
| >1za4_A Thrombospondin 1; TSP-1, NTSP-1, HBD, arixtra, cell adhesion; HET: SGN; 1.90A {Homo sapiens} SCOP: b.29.1.4 PDB: 2ouh_A 2ouj_A | Back alignment and structure |
|---|
| >2v73_A CBM40, putative EXO-alpha-sialidase; carbohydrate-binding module, bacterial pathogen, sialic acid, sugar-binding protein; HET: SIA; 2.2A {Clostridium perfringens} | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >2uur_A Collagen alpha-1(IX) chain; glycoprotein, hydroxylation, structural protein, NC4, collagen IX, polymorphism, extracellular matrix; 1.8A {Homo sapiens} | Back alignment and structure |
|---|
| >4dqa_A Uncharacterized protein; two domains structure, DUF 1735, laminin_G_3 concanavalin A- lectin/glucanases superfamily domain; HET: MSE; 1.50A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* | Back alignment and structure |
|---|
| >3flp_A SAP-like pentraxin; physiological doubly-stacked heptamer, pentraxin fold, cyclic heptamer, invertebrate lectin, sugar binding protein; 2.30A {Limulus polyphemus} PDB: 3flr_A 3flt_A | Back alignment and structure |
|---|
| >2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3kqr_A Serum amyloid P-component; glycoprotein, disulfide bond, lectin, metal-binding secreted; HET: NAG; 1.50A {Homo sapiens} SCOP: b.29.1.5 PDB: 1lgn_A* 1gyk_A 2a3w_A* 2a3x_A* 2a3y_A* 1sac_A* 3d5o_A* 2w08_A* | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >3pvn_A C-reactive protein; pentraxin family, immune system; 1.98A {Homo sapiens} SCOP: b.29.1.5 PDB: 1gnh_A 1lj7_A 3l2y_A 1b09_A 3pvo_A | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >3r08_E T-cell surface glycoprotein CD3 epsilon chain; antibody, T-cell receptor, signalling, immune SY; 4.10A {Cricetulus migratorius} | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2v73_A CBM40, putative EXO-alpha-sialidase; carbohydrate-binding module, bacterial pathogen, sialic acid, sugar-binding protein; HET: SIA; 2.2A {Clostridium perfringens} | Back alignment and structure |
|---|
| >2lu7_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1xau_A B- and T-lymphocyte attenuator; IG domain, beta sandwich, structural genomics, PSI, protein structure initiative; 1.80A {Mus musculus} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >2erf_A Thrombospondin-1; TSP-1, N-terminal TSPN, HBD, sugar binding protein; 1.45A {Homo sapiens} SCOP: b.29.1.4 PDB: 2es3_A 1z78_A | Back alignment and structure |
|---|
| >2lvc_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3knb_B Obscurin-like protein 1; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2wp3_O* 2wwm_C 2wwk_O | Back alignment and structure |
|---|
| >1za4_A Thrombospondin 1; TSP-1, NTSP-1, HBD, arixtra, cell adhesion; HET: SGN; 1.90A {Homo sapiens} SCOP: b.29.1.4 PDB: 2ouh_A 2ouj_A | Back alignment and structure |
|---|
| >4hwu_A Fibroblast growth factor receptor 2; FGFR2, KGFR, CD332, IG-C2 type 1 domain, IG superfamily, IMM system, structural genomics, PSI-biology; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >2jkb_A Sialidase B; intramolecular trans-sialidase, lyase, glycosidase, neuraminidase; HET: SKD; 1.54A {Streptococcus pneumoniae} PDB: 2vw2_A* 2vw1_A* 2vw0_A* | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A | Back alignment and structure |
|---|
| >2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3knb_A Titin; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 3q5o_A 2wp3_T* 2wwk_T 2wwm_D 2y9r_T* | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2sli_A Intramolecular trans-sialidase; hydrolase, neuraminidase; HET: SKD; 1.80A {Macrobdella decora} SCOP: b.29.1.9 b.68.1.1 PDB: 1sll_A 1sli_A* 3sli_A* 4sli_A* | Back alignment and structure |
|---|
| >3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} SCOP: b.1.1.0 | Back alignment and structure |
|---|
| >1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A | Back alignment and structure |
|---|
| >2aw2_A B and T lymphocyte attenuator; IGI domain, IGG domain, TNFRSF, protein-protein complex, IMM system; HET: NAG FUL; 2.80A {Homo sapiens} SCOP: b.1.1.1 | Back alignment and structure |
|---|
| >2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X | Back alignment and structure |
|---|
| >2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X | Back alignment and structure |
|---|
| >2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} | Back alignment and structure |
|---|
| >2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A | Back alignment and structure |
|---|
| >3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A | Back alignment and structure |
|---|
| >1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} | Back alignment and structure |
|---|
| >4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R | Back alignment and structure |
|---|
| >1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A | Back alignment and structure |
|---|
| >2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A | Back alignment and structure |
|---|
| >4dqa_A Uncharacterized protein; two domains structure, DUF 1735, laminin_G_3 concanavalin A- lectin/glucanases superfamily domain; HET: MSE; 1.50A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2uur_A Collagen alpha-1(IX) chain; glycoprotein, hydroxylation, structural protein, NC4, collagen IX, polymorphism, extracellular matrix; 1.8A {Homo sapiens} | Back alignment and structure |
|---|
| >1a8d_A Tetanus neurotoxin; clostridial, ganglioside binding region; 1.57A {Clostridium tetani} SCOP: b.29.1.6 b.42.4.2 PDB: 1af9_A 1fv3_A* 1fv2_A* 3hmy_A* 3hn1_A* 1d0h_A* 1dfq_A* 1dll_A* 1yxw_A* 1yyn_A* 1diw_A* | Back alignment and structure |
|---|
| >2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A | Back alignment and structure |
|---|
| >3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A | Back alignment and structure |
|---|
| >1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X | Back alignment and structure |
|---|
| >2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >2qsq_A Carcinoembryonic antigen-related cell adhesion MO; glycoprotein, GPI-anchor, immunoglobulin DOMA lipoprotein, membrane; 1.95A {Homo sapiens} PDB: 2qst_A 2ver_N* 2gk2_A | Back alignment and structure |
|---|
| >2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >4b1m_A Levanase; hydrolase, CBM66; HET: FRU; 1.10A {Bacillus subtilis} PDB: 4b1l_A* 4azz_A | Back alignment and structure |
|---|
| >2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A | Back alignment and structure |
|---|
| >2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A | Back alignment and structure |
|---|
| >2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >2e6q_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... | Back alignment and structure |
|---|
| >1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A | Back alignment and structure |
|---|
| >1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A | Back alignment and structure |
|---|
| >1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A | Back alignment and structure |
|---|
| >1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* | Back alignment and structure |
|---|
| >3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* | Back alignment and structure |
|---|
| >3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A | Back alignment and structure |
|---|
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 | Back alignment and structure |
|---|
| >1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* | Back alignment and structure |
|---|
| >4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A | Back alignment and structure |
|---|
| >2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A | Back alignment and structure |
|---|
| >2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4hwn_A FC receptor-like A; FCRLA, FCRL, IG-C2 domain, IG superfamily, immune system, ST genomics, PSI-biology; 2.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3m45_A Cell adhesion molecule 2; IG fold, dimer, disulfide bond, glycoprotein, immunoglobulin membrane, transmembrane; HET: NAG; 2.21A {Mus musculus} | Back alignment and structure |
|---|
| >2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A | Back alignment and structure |
|---|
| >2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A | Back alignment and structure |
|---|
| >2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* | Back alignment and structure |
|---|
| >4gos_A V-SET domain-containing T-cell activation inhibit; immunoglobulin domain, glycoprotein, disulfide bond, immunit adaptive immunity; HET: NAG BMA MAN; 1.59A {Homo sapiens} | Back alignment and structure |
|---|
| >3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A | Back alignment and structure |
|---|
| >2vsd_A CHIR AB1; immune system receptor, FC receptor; HET: NAG NDG MAN; 1.82A {Gallus gallus} | Back alignment and structure |
|---|
| >1jhl_L IGG1-kappa D11.15 FV (light chain); complex(antibody-antigen); 2.40A {Mus musculus} SCOP: b.1.1.1 | Back alignment and structure |
|---|
| >2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... | Back alignment and structure |
|---|
| >1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 | Back alignment and structure |
|---|
| >1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A | Back alignment and structure |
|---|
| >2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A | Back alignment and structure |
|---|
| >1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* | Back alignment and structure |
|---|
| >4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* | Back alignment and structure |
|---|
| >1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A | Back alignment and structure |
|---|
| >1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A | Back alignment and structure |
|---|
| >1z9m_A GAPA225; nectin-like, IG-like domain, V domain, cell adhesion; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A | Back alignment and structure |
|---|
| >1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* | Back alignment and structure |
|---|
| >2oyp_A Hepatitis A virus cellular receptor 2; TIM-3, T-cell immunoglobulin mucin, signaling protein; 1.95A {Mus musculus} PDB: 3kaa_A* | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} | Back alignment and structure |
|---|
| >1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A | Back alignment and structure |
|---|
| >1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A | Back alignment and structure |
|---|
| >1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A | Back alignment and structure |
|---|
| >4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A | Back alignment and structure |
|---|
| >4gjt_B Poliovirus receptor-related protein 4; six-bladed -propeller, IGV-like fold, viral entry, MV-H, NEC BETA4/BETA5 groove; HET: NAG; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2or8_A Hepatitis A virus cellular receptor 1 homolog; beta barrel, immunoglobulin fold, IGV domain, TIM, immune system; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A | Back alignment and structure |
|---|
| >2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3udw_C Poliovirus receptor; PVR tigit IGSF signal transduction immunology, IGSF, cell SU receptor signalling, glycosylation, membrane protein; HET: NAG; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* | Back alignment and structure |
|---|
| >1qfw_M FV, antibody (anti beta subunit) (light chain); glycoprotein hormone; HET: NAG; 3.50A {Mus musculus} SCOP: b.1.1.1 | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A | Back alignment and structure |
|---|
| >1eaj_A Coxsackie virus and adenovirus receptor; virus/viral protein receptor, immunoglobulin V domain fold, symmetric dimer; 1.35A {Homo sapiens} SCOP: b.1.1.1 PDB: 1f5w_A 2j12_B 2j1k_A 2wbw_B* 2w9l_A* 1rsf_A 1jew_R 1kac_B 1p69_B 1p6a_B | Back alignment and structure |
|---|
| >1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B | Back alignment and structure |
|---|
| >3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* | Back alignment and structure |
|---|
| >1h5b_A Murine T cell receptor (TCR) valpha domain; immune response, immunoglobulin fold; 1.85A {Mus musculus} SCOP: b.1.1.1 PDB: 1h5b_C 1h5b_B | Back alignment and structure |
|---|
| >1mqk_L Antibody 7E2 FV fragment, light chain; membrane protein, cytochrome C oxidase, high- resolution structure, immune system; 1.28A {Mus musculus} SCOP: b.1.1.1 PDB: 1ar1_D 3ehb_D* 3hb3_D* 1qle_L* 1f6l_L 3iy2_A 1vfa_A 1dvf_A 1kir_A 1g7i_A 1g7j_A 1a2y_A 1kip_A 1kiq_A 1vfb_A 1g7h_A 1a7o_L 1g7l_A 1g7m_A 1a7n_L ... | Back alignment and structure |
|---|
| >1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >3q0h_A T cell immunoreceptor with IG and ITIM domains; immune receptor, adhesion, structural genomics, NEW YORK STR genomics research consortium, nysgrc; 1.70A {Homo sapiens} PDB: 3rq3_A 3udw_A* 3ucr_A | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 | Back alignment and structure |
|---|
| >3khq_A B-cell antigen receptor complex-associated protei chain; CD79B, CD79A, IG-beta, BCR, IG domain, V-SET, immunoglobulin protein binding; HET: FLC GSH; 1.70A {Mus musculus} PDB: 3kho_A* | Back alignment and structure |
|---|
| >1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* | Back alignment and structure |
|---|
| >1xt5_A Variable region-containing chitin-binding protein 3; innate immunity, VCBP, primordial antigen receptor, florida lancelet, amphioxus; 1.15A {Branchiostoma floridae} | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A | Back alignment and structure |
|---|
| >2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A | Back alignment and structure |
|---|
| >4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* | Back alignment and structure |
|---|
| >1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G | Back alignment and structure |
|---|
| >2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* | Back alignment and structure |
|---|
| >1pko_A Myelin oligodendrocyte glycoprotein; IGV-domain, immune system; 1.45A {Rattus norvegicus} SCOP: b.1.1.1 PDB: 1pkq_E 3csp_A 1py9_A | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >3v0a_B NTNH; botulinum neurotoxin, toxin, neurotoxin associated protein, progenitor toxin complex, VHH bound interlocked complex; HET: MES; 2.70A {Clostridium botulinum} PDB: 3v0b_B | Back alignment and structure |
|---|
| >2vol_A Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, cytoplasm, mouse IGG, zinc-finger, DNA-binding, RNA-binding, tripartite motif (TRIM) protein; HET: NAG MAN GAL FUC; 1.95A {Mus musculus} PDB: 3hkf_A 1i1a_C* 1cqk_A | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2yz1_A Tyrosine-protein phosphatase non-receptor type substrate 1; beta-sandwich, structural genomics, NPPSFA; 1.40A {Mus musculus} | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R | Back alignment and structure |
|---|
| >3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2q20_A VK1 O18/O8 germline light chain variable domain; Al, light chain amyloidosis, amyloid, immunoglobulin, protein fibril; 1.30A {Homo sapiens} PDB: 2kqm_A 3cdf_A 3cdc_A 2kqn_A 3cdy_A 2q1e_A 3dvi_A 1igm_L 1bww_A 1b0w_A 1bre_A 1qp1_A 3dvf_A 1rei_A 1wtl_A 1ar2_A 1fgv_L 2bx5_A 2uzi_L* 1bvk_A ... | Back alignment and structure |
|---|
| >1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >2edo_A CD48 antigen; beta-sandwich, IG-fold, B-lymphocyte activation marker blast-1, BCM1 surface antigen, leukocyte antigen MEM-102, TCT.1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A | Back alignment and structure |
|---|
| >3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 | Back alignment and structure |
|---|
| >1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A | Back alignment and structure |
|---|
| >2rgs_A I, IG gamma-2B heavy chain; FC-fragment, immunoglobulin, glycosylation, immune system; HET: NAG FUC MAN GAL; 2.13A {Mus musculus} | Back alignment and structure |
|---|
| >2ywz_A NEW antigen receptor variable domain; IG VNAR, immune system; 2.21A {Orectolobus maculatus} PDB: 2ywy_A | Back alignment and structure |
|---|
| >2jju_A Signal regulatory protein beta-1; immunoglobulin domain, immunoglobulin superfamily, immune system, transmembrane, paired receptor; 1.19A {Homo sapiens} PDB: 2jjv_A 2uv3_A* 2jjt_A* 2jjs_A* 2jjw_A | Back alignment and structure |
|---|
| >2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} | Back alignment and structure |
|---|
| >2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3tv3_L PGT128 light chain, IG lambda-2 chain C regions; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_L* 3twc_L* 3tnm_L 2mcg_1 1mcw_M 1a8j_L 3mcg_1 1dcl_A 1mcb_A* 1mcc_A* 1mcd_A* 1mce_A* 1mcf_A* 1mch_A 1mci_A* 1mcj_A* 1mck_A 1mcl_A* 1mcn_A* 1mcq_A ... | Back alignment and structure |
|---|
| >2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} | Back alignment and structure |
|---|
| >2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A | Back alignment and structure |
|---|
| >2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} | Back alignment and structure |
|---|
| >3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... | Back alignment and structure |
|---|
| >3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D | Back alignment and structure |
|---|
| >4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C | Back alignment and structure |
|---|
| >1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* | Back alignment and structure |
|---|
| >2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2d9c_A Signal-regulatory protein beta-1; beta-sandwich, SIRP-beta-1, CD172B antigen, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* | Back alignment and structure |
|---|
| >3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* | Back alignment and structure |
|---|
| >3r06_A Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; anti-CD3epsilon, T-cell receptor, signalling, IMMU; 2.50A {Cricetulus migratorius} PDB: 3r08_L 3ld8_B 3ldb_B* | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} | Back alignment and structure |
|---|
| >2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >4b1m_A Levanase; hydrolase, CBM66; HET: FRU; 1.10A {Bacillus subtilis} PDB: 4b1l_A* 4azz_A | Back alignment and structure |
|---|
| >1xiw_B T-cell surface glycoprotein CD3 delta chain; CD3-epsilon, CD3-delta, UCHT1-SCFV, immunoglobulin fold, antibody-antigen complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A | Back alignment and structure |
|---|
| >3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* | Back alignment and structure |
|---|
| >1olz_A Semaphorin 4D; developmental protein, CD100, beta-propeller, PSI domain, IG-like domain, extracellular receptor, neurogenesis; 2.0A {Homo sapiens} SCOP: b.1.1.4 b.69.12.1 g.16.2.1 PDB: 3ol2_A* | Back alignment and structure |
|---|
| >1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H | Back alignment and structure |
|---|
| >2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1i1c_A IGG2A, IG gamma-2A chain C region; FC, immune system; HET: NAG FUL BMA MAN FUC; 2.70A {Rattus norvegicus} SCOP: b.1.1.2 b.1.1.2 PDB: 1i1a_D* | Back alignment and structure |
|---|
| >2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* | Back alignment and structure |
|---|
| >4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1a8d_A Tetanus neurotoxin; clostridial, ganglioside binding region; 1.57A {Clostridium tetani} SCOP: b.29.1.6 b.42.4.2 PDB: 1af9_A 1fv3_A* 1fv2_A* 3hmy_A* 3hn1_A* 1d0h_A* 1dfq_A* 1dll_A* 1yxw_A* 1yyn_A* 1diw_A* | Back alignment and structure |
|---|
| >3noi_A Natural cytotoxicity triggering receptor 3; immune system, innate immunity, immunoglobulin-like I2 type natural killer cell activation; HET: 1PG; 1.84A {Homo sapiens} PDB: 3pv6_B* | Back alignment and structure |
|---|
| >3bqu_C 3H6 FAB light chain; beta sheet, immune system; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* | Back alignment and structure |
|---|
| >1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 | Back alignment and structure |
|---|
| >3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A | Back alignment and structure |
|---|
| >2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A | Back alignment and structure |
|---|
| >1c1e_H Catalytic antibody 1E9 (heavy chain); diels-alder, immunoglobulin, immune system; HET: ENH; 1.90A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1dbb_H* 1dba_H* 1dbj_H* 1dbk_H* 1dbm_H* 2dbl_H* 3ojd_B 1jgl_H* 1jhk_H 1ghf_H 1tet_H* 3e8u_H 1fj1_B 1cl7_H | Back alignment and structure |
|---|
| >2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A | Back alignment and structure |
|---|
| >2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* | Back alignment and structure |
|---|
| >3sob_L Antibody light chain; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_A 3u1s_L* | Back alignment and structure |
|---|
| >2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A | Back alignment and structure |
|---|
| >1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* | Back alignment and structure |
|---|
| >3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A | Back alignment and structure |
|---|
| >2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A | Back alignment and structure |
|---|
| >3ux9_B SCFV antibody; five helices, long loop connecting helix, hydrophobic intera cytokine-immune system complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2jjs_C Leukocyte surface antigen CD47; signal regulatory protein alpha, immunoglobulin superfamily, transmembrane, phosphoprotein, paired receptor; HET: NAG; 1.85A {Homo sapiens} PDB: 2jjt_C* 2vsc_A* | Back alignment and structure |
|---|
| >2xzc_L FAB A.17 light chain; immune system; HET: XOP; 1.36A {Homo sapiens} PDB: 2xza_L* 3kdm_L* 3nps_C 1dn0_A 1qlr_A* 2v7n_A 3eo0_A 3eo1_A 2agj_L* 2fx7_L 1tzg_L 2fx8_L 2fx9_L* 1u6a_L 3hi1_L* 3kym_A 3kyk_L 3qwo_L* 3ixt_L* 3qeg_L ... | Back alignment and structure |
|---|
| >4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* | Back alignment and structure |
|---|
| >3s96_B 3B5H10 FAB light chain; huntingtin, immune system; 1.90A {Mus musculus} PDB: 2qhr_L 3ffd_B 4dcq_A | Back alignment and structure |
|---|
| >2ptt_A CD48 antigen; CD244, CD48, NK cell receptor, X-RAY, immune system; 1.63A {Mus musculus} PDB: 2ptv_A | Back alignment and structure |
|---|
| >1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E | Back alignment and structure |
|---|
| >2jkb_A Sialidase B; intramolecular trans-sialidase, lyase, glycosidase, neuraminidase; HET: SKD; 1.54A {Streptococcus pneumoniae} PDB: 2vw2_A* 2vw1_A* 2vw0_A* | Back alignment and structure |
|---|
| >2c1o_A IGK-C protein; FAB fragment, enantioselective, finrozole, immune system, antibody, ENA11His antibody, immunoglobulin domain; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* | Back alignment and structure |
|---|
| >1ncn_A T lymphocyte activation antigen CD86; IG V, beta strands, immune system; 2.70A {Homo sapiens} SCOP: b.1.1.1 PDB: 1i85_A | Back alignment and structure |
|---|
| >1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >3r0n_A Poliovirus receptor-related protein 2; IG-domain, cell-adhesion molecule, virus entry receptor, STR genomics, PSI-biology; 1.30A {Homo sapiens} PDB: 4dfh_A 4dfi_A | Back alignment and structure |
|---|
| >3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J | Back alignment and structure |
|---|
| >3d9a_H Heavy chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_H 1gpo_H 3ks0_H* 1dqd_H 1ndm_B 1nak_H 1dqq_B 1dqm_H 1dqj_B 1nby_B 1nbz_B 1xgu_B 1ndg_B 1xgt_B 1xgp_B 1xgq_B 1xgr_B 1s5i_H 1f8t_H 1f90_H ... | Back alignment and structure |
|---|
| >2or7_A T-cell immunoglobulin and mucin domain- containing protein 2; beta barrel, immunoglobulin fold, IGV domain, TIM, immune system; 1.50A {Mus musculus} | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R | Back alignment and structure |
|---|
| >1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* | Back alignment and structure |
|---|
| >3bkj_L WO2 IGG2A FAB fragment light chain kappa; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} PDB: 3bkc_L 3bkm_L 2zuq_B* 1h3p_L | Back alignment and structure |
|---|
| >1nfd_E H57 FAB; complex (immunoreceptor-immunoglobulin), complex (immunorece immunoglobulin) complex; HET: NAG NDG; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 | Back alignment and structure |
|---|
| >2j6e_L IGM, FAB light chain; autoimmune complex human IGM rheumatoid factor IGG1-FC, immunoglobulin C region, membrane, glycoprotein, transmembrane; HET: NAG FUL BMA MAN NDG GAL; 3.0A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A | Back alignment and structure |
|---|
| >3pl6_D MBP peptide / T-cell receptor beta chain chimera; TCR-MHC complex, immunoglobulin fold, immune receptor, membr immune system; HET: NAG; 2.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3moq_A NEW antigen receptor variable domain, P3(40) PEPT amyloid beta A4 protein; AB-ignar, AB-12Y-2, glycoprotein, membran protease inhibitor; 2.05A {Orectolobus maculatus} PDB: 2z8w_C 2z8v_C 1ves_A 1ver_A | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1q0x_L FAB 9B1, light chain; anti-morphine antibody, FAB fragment, immune system; HET: PG4; 1.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q0y_L* 1ngp_L* 1ngq_L 3ks0_L* 1gig_L 2vir_A 2vis_A* 2vit_A 1sm3_L 4a6y_L 1ind_L* 1ine_L* 1yuh_L* 2zpk_L 3rhw_K* 3ri5_K* 3ria_K* 3rif_K* 1mfe_L* 1mfb_L* ... | Back alignment and structure |
|---|
| >1i8k_A Epidermal growth factor receptor antibody MR1SCFV light chain; antibody-peptide complex, immunoglobulin fold, type II' beta turn., immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 PDB: 1i8i_A | Back alignment and structure |
|---|
| >2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >1neu_A Myelin P0 protein; structural protein, glycoprotein, transmembrane, phosphorylation, immunoglobulin fold, signal; 1.90A {Rattus norvegicus} SCOP: b.1.1.1 | Back alignment and structure |
|---|
| >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >2sli_A Intramolecular trans-sialidase; hydrolase, neuraminidase; HET: SKD; 1.80A {Macrobdella decora} SCOP: b.29.1.9 b.68.1.1 PDB: 1sll_A 1sli_A* 3sli_A* 4sli_A* | Back alignment and structure |
|---|
| >3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B | Back alignment and structure |
|---|
| >1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 | Back alignment and structure |
|---|
| >1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* | Back alignment and structure |
|---|
| >2wqr_A IG epsilon chain C region; immune system, immunoglobulin domain, glycoprotein; HET: NAG BMA MAN PG4; 1.90A {Homo sapiens} PDB: 2y7q_B* 1o0v_A* 3h9y_A* 3h9z_A* 3ha0_A* 1fp5_A 1f6a_B 1g84_A | Back alignment and structure |
|---|
| >1svz_A Immunoglobulin;, single-chain FV fragment 1696; antibody-antigen complex, HIV inhibiting antibody; 1.89A {Mus musculus} PDB: 1jp5_A | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* | Back alignment and structure |
|---|
| >2w59_A IGY FCU3-4; immunoglobulin, avian, immune system; HET: NAG MAN; 1.75A {Gallus gallus} | Back alignment and structure |
|---|
| >3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 834 | ||||
| d1pz7a_ | 195 | b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxI | 1e-27 | |
| d1pz7a_ | 195 | b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxI | 4e-20 | |
| d1pz7a_ | 195 | b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxI | 3e-09 | |
| d1pz7a_ | 195 | b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxI | 2e-05 | |
| d1dyka2 | 185 | b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse | 7e-23 | |
| d1dyka2 | 185 | b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse | 1e-21 | |
| d1dyka2 | 185 | b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse | 9e-06 | |
| d1dyka1 | 189 | b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse | 9e-22 | |
| d1dyka1 | 189 | b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse | 1e-18 | |
| d1dyka1 | 189 | b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse | 1e-05 | |
| d1dyka1 | 189 | b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse | 2e-05 | |
| d1h30a1 | 191 | b.29.1.4 (A:261-451) Growth-arrest-specific protei | 9e-22 | |
| d1h30a1 | 191 | b.29.1.4 (A:261-451) Growth-arrest-specific protei | 2e-21 | |
| d1h30a1 | 191 | b.29.1.4 (A:261-451) Growth-arrest-specific protei | 2e-07 | |
| d1d2sa_ | 170 | b.29.1.4 (A:) Sex hormone-binding globulin {Human | 3e-21 | |
| d1d2sa_ | 170 | b.29.1.4 (A:) Sex hormone-binding globulin {Human | 8e-19 | |
| d1d2sa_ | 170 | b.29.1.4 (A:) Sex hormone-binding globulin {Human | 5e-05 | |
| d1d2sa_ | 170 | b.29.1.4 (A:) Sex hormone-binding globulin {Human | 1e-04 | |
| d2r1da1 | 177 | b.29.1.4 (A:36-212) Ligand-binding domain of neure | 1e-16 | |
| d2r1da1 | 177 | b.29.1.4 (A:36-212) Ligand-binding domain of neure | 1e-16 | |
| d1h30a2 | 218 | b.29.1.4 (A:461-678) Growth-arrest-specific protei | 1e-12 | |
| d1h30a2 | 218 | b.29.1.4 (A:461-678) Growth-arrest-specific protei | 3e-12 | |
| d1haea_ | 63 | g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu | 2e-09 | |
| d1haea_ | 63 | g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu | 2e-06 | |
| d1haea_ | 63 | g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu | 0.002 | |
| d1haea_ | 63 | g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu | 0.004 | |
| d3egfa_ | 53 | g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse | 5e-09 | |
| d3egfa_ | 53 | g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse | 2e-08 | |
| d3egfa_ | 53 | g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse | 2e-04 | |
| d3egfa_ | 53 | g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse | 4e-04 | |
| d1tpga1 | 41 | g.3.11.1 (A:51-91) Plasminogen activator (tissue-t | 8e-09 | |
| d1tpga1 | 41 | g.3.11.1 (A:51-91) Plasminogen activator (tissue-t | 2e-06 | |
| d2vj3a3 | 35 | g.3.11.1 (A:492-526) Neurogenic locus notch homolo | 2e-08 | |
| d2vj3a3 | 35 | g.3.11.1 (A:492-526) Neurogenic locus notch homolo | 3e-06 | |
| d2vj3a3 | 35 | g.3.11.1 (A:492-526) Neurogenic locus notch homolo | 8e-05 | |
| d2vj3a3 | 35 | g.3.11.1 (A:492-526) Neurogenic locus notch homolo | 0.001 | |
| d1g1ta2 | 39 | g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human | 3e-08 | |
| d1g1ta2 | 39 | g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human | 4e-05 | |
| d1g1ta2 | 39 | g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human | 1e-04 | |
| d1g1ta2 | 39 | g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human | 2e-04 | |
| d1cvua2 | 41 | g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG | 3e-08 | |
| d1cvua2 | 41 | g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG | 1e-04 | |
| d1g1sa2 | 40 | g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human | 3e-08 | |
| d1g1sa2 | 40 | g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human | 2e-05 | |
| d1g1sa2 | 40 | g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human | 1e-04 | |
| d1g1sa2 | 40 | g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human | 0.001 | |
| d2c4fl1 | 37 | g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof | 3e-08 | |
| d2c4fl1 | 37 | g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof | 3e-06 | |
| d2c4fl1 | 37 | g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof | 1e-04 | |
| d2c4fl1 | 37 | g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof | 0.003 | |
| d1nqlb_ | 48 | g.3.11.1 (B:) Epidermal growth factor, EGF {Human | 4e-08 | |
| d1nqlb_ | 48 | g.3.11.1 (B:) Epidermal growth factor, EGF {Human | 2e-07 | |
| d1nqlb_ | 48 | g.3.11.1 (B:) Epidermal growth factor, EGF {Human | 0.001 | |
| d1nqlb_ | 48 | g.3.11.1 (B:) Epidermal growth factor, EGF {Human | 0.001 | |
| d1xkba1 | 39 | g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu | 4e-08 | |
| d1xkba1 | 39 | g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu | 2e-06 | |
| d1xkba1 | 39 | g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu | 9e-05 | |
| d1xkba1 | 39 | g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu | 0.002 | |
| d2vj3a2 | 39 | g.3.11.1 (A:453-491) Neurogenic locus notch homolo | 4e-08 | |
| d2vj3a2 | 39 | g.3.11.1 (A:453-491) Neurogenic locus notch homolo | 2e-06 | |
| d2vj3a2 | 39 | g.3.11.1 (A:453-491) Neurogenic locus notch homolo | 9e-05 | |
| d2vj3a2 | 39 | g.3.11.1 (A:453-491) Neurogenic locus notch homolo | 0.003 | |
| d1edmb_ | 39 | g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens | 4e-08 | |
| d1edmb_ | 39 | g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens | 2e-06 | |
| d1edmb_ | 39 | g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens | 6e-05 | |
| d1edmb_ | 39 | g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens | 0.003 | |
| d1q4ga2 | 42 | g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG | 7e-08 | |
| d1q4ga2 | 42 | g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG | 9e-05 | |
| d1autl1 | 48 | g.3.11.1 (L:49-96) Activated protein c (autoprothr | 3e-07 | |
| d1autl1 | 48 | g.3.11.1 (L:49-96) Activated protein c (autoprothr | 8e-07 | |
| d1autl1 | 48 | g.3.11.1 (L:49-96) Activated protein c (autoprothr | 5e-04 | |
| d2vj3a1 | 42 | g.3.11.1 (A:411-452) Neurogenic locus notch homolo | 4e-07 | |
| d2vj3a1 | 42 | g.3.11.1 (A:411-452) Neurogenic locus notch homolo | 1e-06 | |
| d2vj3a1 | 42 | g.3.11.1 (A:411-452) Neurogenic locus notch homolo | 2e-05 | |
| d2vj3a1 | 42 | g.3.11.1 (A:411-452) Neurogenic locus notch homolo | 7e-05 | |
| d1ioxa_ | 50 | g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) | 5e-06 | |
| d1ioxa_ | 50 | g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) | 4e-05 | |
| d1biha4 | 89 | b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr | 1e-05 | |
| d1k36a_ | 46 | g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo | 2e-05 | |
| d1k36a_ | 46 | g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo | 2e-04 | |
| d1moxc_ | 49 | g.3.11.1 (C:) Transforming growth factor alpha {Hu | 2e-05 | |
| d1moxc_ | 49 | g.3.11.1 (C:) Transforming growth factor alpha {Hu | 4e-04 | |
| d3dara1 | 97 | b.1.1.4 (A:153-249) Fibroblast growth factor recep | 7e-05 | |
| d1l6za1 | 107 | b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, C | 9e-05 | |
| d2cqva1 | 101 | b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T | 1e-04 | |
| d1kloa1 | 55 | g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mu | 1e-04 | |
| d1cs6a3 | 91 | b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall | 3e-04 | |
| d1koaa1 | 97 | b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha | 5e-04 | |
| d1cs6a4 | 89 | b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall | 7e-04 | |
| d1n26a1 | 93 | b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chai | 8e-04 | |
| d1xdtr_ | 41 | g.3.11.1 (R:) Heparin-binding epidermal growth fac | 0.001 | |
| d1apqa_ | 53 | g.3.11.1 (A:) Complement protease C1R {Human (Homo | 0.001 | |
| d1biha1 | 94 | b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropi | 0.002 | |
| d1gl4a2 | 40 | g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 | 0.004 |
| >d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 195 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Concanavalin A-like lectins/glucanases superfamily: Concanavalin A-like lectins/glucanases family: Laminin G-like module domain: Agrin species: Chicken (Gallus gallus) [TaxId: 9031]
Score = 108 bits (271), Expect = 1e-27
Identities = 54/178 (30%), Positives = 82/178 (46%), Gaps = 9/178 (5%)
Query: 387 FTQKPLSYLALPTLTDAHLHFSIELSFKPTDYNGLIMYTGDSNMKSYKGKGDFVSFGLED 446
+ L Y A P+ A ELS K GLI+++G + D+++ + D
Sbjct: 25 KSPDALDYPAEPSE-KALQSNHFELSIKTEATQGLILWSGKGL-----ERSDYIALAIVD 78
Query: 447 GYPVFRFDVG--LVVLRSKVTLVPHEWVVVTIIKDFKEGKLSVGGEPLIVGSTPGEKLQV 504
G+ +D+G VVLRS V + + W + + +EG L VG E I GS+P
Sbjct: 79 GFVQMMYDLGSKPVVLRSTVPINTNHWTHIKAYRVQREGSLQVGNEAPITGSSPL-GATQ 137
Query: 505 LNLRTPLYLGGYNIYHVTPSLSVEVTEGFHGCISTIDVLGSELDLINSAVDSANIMDC 562
L+ L+LGG V L + GF GCI + V EL L+ A+++ I+ C
Sbjct: 138 LDTDGALWLGGMERLSVAHKLPKAYSTGFIGCIRDVIVDRQELHLVEDALNNPTILHC 195
|
| >d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 195 | Back information, alignment and structure |
|---|
| >d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 195 | Back information, alignment and structure |
|---|
| >d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 195 | Back information, alignment and structure |
|---|
| >d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 185 | Back information, alignment and structure |
|---|
| >d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 185 | Back information, alignment and structure |
|---|
| >d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 185 | Back information, alignment and structure |
|---|
| >d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 189 | Back information, alignment and structure |
|---|
| >d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 189 | Back information, alignment and structure |
|---|
| >d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 189 | Back information, alignment and structure |
|---|
| >d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 189 | Back information, alignment and structure |
|---|
| >d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 | Back information, alignment and structure |
|---|
| >d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 | Back information, alignment and structure |
|---|
| >d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 | Back information, alignment and structure |
|---|
| >d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d2r1da1 b.29.1.4 (A:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 177 | Back information, alignment and structure |
|---|
| >d2r1da1 b.29.1.4 (A:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 177 | Back information, alignment and structure |
|---|
| >d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Length = 218 | Back information, alignment and structure |
|---|
| >d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Length = 218 | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 50 | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 50 | Back information, alignment and structure |
|---|
| >d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 46 | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 46 | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 49 | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 49 | Back information, alignment and structure |
|---|
| >d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 | Back information, alignment and structure |
|---|
| >d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 55 | Back information, alignment and structure |
|---|
| >d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 | Back information, alignment and structure |
|---|
| >d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 | Back information, alignment and structure |
|---|
| >d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 | Back information, alignment and structure |
|---|
| >d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 94 | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 834 | |||
| d1dyka1 | 189 | Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: | 99.96 | |
| d1pz7a_ | 195 | Agrin {Chicken (Gallus gallus) [TaxId: 9031]} | 99.95 | |
| d1h30a1 | 191 | Growth-arrest-specific protein Gas6 {Human (Homo s | 99.93 | |
| d1dyka2 | 185 | Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: | 99.93 | |
| d2r1da1 | 177 | Ligand-binding domain of neurexin 1beta {Rat (Ratt | 99.92 | |
| d1d2sa_ | 170 | Sex hormone-binding globulin {Human (Homo sapiens) | 99.91 | |
| d1dyka1 | 189 | Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: | 99.89 | |
| d1pz7a_ | 195 | Agrin {Chicken (Gallus gallus) [TaxId: 9031]} | 99.87 | |
| d1h30a2 | 218 | Growth-arrest-specific protein Gas6 {Human (Homo s | 99.85 | |
| d1d2sa_ | 170 | Sex hormone-binding globulin {Human (Homo sapiens) | 99.82 | |
| d1dyka2 | 185 | Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: | 99.81 | |
| d2r1da1 | 177 | Ligand-binding domain of neurexin 1beta {Rat (Ratt | 99.8 | |
| d1h30a1 | 191 | Growth-arrest-specific protein Gas6 {Human (Homo s | 99.77 | |
| d1h30a2 | 218 | Growth-arrest-specific protein Gas6 {Human (Homo s | 99.69 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 99.19 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 99.19 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 99.16 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 99.16 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 99.14 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 99.13 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 99.13 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 99.12 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 99.11 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 99.1 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 99.09 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 99.09 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 99.08 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 99.06 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 99.04 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 99.02 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 99.0 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 99.0 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.99 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 98.96 | |
| d2erfa1 | 206 | Thrombospondin 1 N-terminal domain {Human (Homo sa | 98.9 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 98.88 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 98.87 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 98.86 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 98.83 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 98.82 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 98.81 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 98.77 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 98.61 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 98.47 | |
| d1b09a_ | 206 | C-reactive protein (CRP) {Human (Homo sapiens) [Ta | 98.41 | |
| d1saca_ | 204 | Serum amyloid P component (SAP) {Human (Homo sapie | 98.38 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 98.37 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 98.35 | |
| d2slia1 | 196 | Leech intramolecular trans-sialidase, N-terminal d | 98.14 | |
| d2erfa1 | 206 | Thrombospondin 1 N-terminal domain {Human (Homo sa | 98.02 | |
| d1n26a1 | 93 | Interleukin-6 receptor alpha chain, N-terminal dom | 98.02 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.01 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.0 | |
| d1cs6a3 | 91 | Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | 97.97 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.97 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 97.93 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.92 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 97.89 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 97.88 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.85 | |
| d1gsma1 | 90 | Mucosal addressin cell adhesion molecule-1 (MADCAM | 97.85 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 97.81 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.79 | |
| d1a8da1 | 247 | Tetanus neurotoxin {Clostridium tetani [TaxId: 151 | 97.77 | |
| d1biha4 | 89 | Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | 97.73 | |
| d1gl4b_ | 89 | Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: | 97.73 | |
| d3btaa1 | 207 | Botulinum neurotoxin {Clostridium botulinum, serot | 97.72 | |
| d1b09a_ | 206 | C-reactive protein (CRP) {Human (Homo sapiens) [Ta | 97.71 | |
| d1cs6a4 | 89 | Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | 97.64 | |
| d1epwa1 | 218 | Botulinum neurotoxin {Clostridium botulinum, serot | 97.63 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.62 | |
| d1saca_ | 204 | Serum amyloid P component (SAP) {Human (Homo sapie | 97.61 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 97.57 | |
| d1iray1 | 101 | Type-1 interleukin-1 receptor {Human (Homo sapiens | 97.53 | |
| d1olza1 | 92 | Semaphorin 4d Ig-like domain {Human (Homo sapiens) | 97.52 | |
| d1biha1 | 94 | Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | 97.52 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 97.47 | |
| d1epfa2 | 92 | Neural cell adhesion molecule (NCAM) {Rat (Rattus | 97.46 | |
| d1biha3 | 97 | Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | 97.44 | |
| d1tnna_ | 91 | Titin {Human (Homo sapiens), different modules [Ta | 97.42 | |
| d1iray2 | 103 | Type-1 interleukin-1 receptor {Human (Homo sapiens | 97.42 | |
| d1l6za2 | 96 | Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t | 97.41 | |
| d1vcaa2 | 90 | Vascular cell adhesion molecule-1 (VCAM-1) {Human | 97.39 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.35 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 97.35 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 97.32 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.31 | |
| d1cs6a2 | 105 | Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | 97.31 | |
| d2cqva1 | 101 | Telokin {Human (Homo sapiens) [TaxId: 9606]} | 97.3 | |
| d3dara1 | 97 | Fibroblast growth factor receptor, FGFR {Human (Ho | 97.3 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 97.3 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.29 | |
| d1wiua_ | 93 | Twitchin {Nematode (Caenorhabditis elegans) [TaxId | 97.25 | |
| d1xdtr_ | 41 | Heparin-binding epidermal growth factor, HBEGF {Hu | 97.24 | |
| d1koaa1 | 97 | Twitchin {Nematode (Caenorhabditis elegans) [TaxId | 97.22 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 97.17 | |
| d1qz1a3 | 100 | Neural cell adhesion molecule (NCAM) {Rat (Rattus | 97.15 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 97.12 | |
| d1fhga_ | 102 | Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 | 97.12 | |
| d1g1ca_ | 98 | Titin {Human (Homo sapiens), different modules [Ta | 97.12 | |
| d1epfa1 | 97 | Neural cell adhesion molecule (NCAM) {Rat (Rattus | 97.11 | |
| d1rhfa1 | 91 | Tyrosine-protein kinase receptor tyro3, N-terminal | 97.1 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 97.09 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.09 | |
| d2nxyb2 | 84 | CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 | 97.05 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.04 | |
| d1nt0a3 | 45 | Mannose-binding protein associated serine protease | 97.0 | |
| d1nbqa2 | 104 | Junction adhesion molecule, JAM, C-terminal domain | 96.99 | |
| d2fcba2 | 88 | Fc gamma receptor ectodomain (CD32) {Human (Homo s | 96.98 | |
| d1wwbx_ | 103 | Ligand binding domain of trkB receptor {Human (Hom | 96.98 | |
| d2aw2a1 | 104 | B- and T-lymphocyte attenuator CD272 {Human (Homo | 96.9 | |
| d1pd6a_ | 94 | Cardiac myosin binding protein C, different domain | 96.87 | |
| d1fnla2 | 89 | Fc gamma receptor ectodomain (CD32) {Human (Homo s | 96.86 | |
| d1f97a2 | 110 | Junction adhesion molecule, JAM, C-terminal domain | 96.86 | |
| d1szba2 | 45 | Mannose-binding protein associated serine protease | 96.86 | |
| d1kloa1 | 55 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 96.82 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 96.78 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 96.78 | |
| d1cs6a1 | 97 | Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | 96.75 | |
| d1nbqa1 | 105 | Junction adhesion molecule, JAM, N-terminal domain | 96.75 | |
| d1wwca_ | 105 | NT3 binding domain of trkC receptor {Human (Homo s | 96.74 | |
| d2ifga1 | 92 | High affinity nerve growth factor receptor TrkA, d | 96.72 | |
| d1he7a_ | 107 | High affinity nerve growth factor receptor TrkA, d | 96.69 | |
| d1x44a1 | 90 | Myosin-binding protein C, slow-type {Human (Homo s | 96.68 | |
| d1tiua_ | 89 | Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI | 96.63 | |
| d1f2qa2 | 89 | IgE high affinity receptor alpha subunit {Human (H | 96.63 | |
| d1f97a1 | 102 | Junction adhesion molecule, JAM, N-terminal domain | 96.6 | |
| d1ccza1 | 93 | CD2-binding domain of CD58, N-terminal domain {Hum | 96.53 | |
| d1nzia2 | 42 | Complement C1S component {Human (Homo sapiens) [Ta | 96.52 | |
| d2dava1 | 113 | Myosin-binding protein C, slow-type {Human (Homo s | 96.52 | |
| d2slia1 | 196 | Leech intramolecular trans-sialidase, N-terminal d | 96.48 | |
| d3bpse1 | 40 | Low density lipoprotein (LDL) receptor, different | 96.45 | |
| d2avga1 | 110 | Cardiac myosin binding protein C, different domain | 96.39 | |
| d1nzia2 | 42 | Complement C1S component {Human (Homo sapiens) [Ta | 96.38 | |
| d1gxea_ | 130 | Cardiac myosin binding protein C, different domain | 96.35 | |
| d3btaa1 | 207 | Botulinum neurotoxin {Clostridium botulinum, serot | 96.34 | |
| d1hnga1 | 98 | CD2, first domain {Rat (Rattus norvegicus) [TaxId: | 96.33 | |
| d1rhfa2 | 85 | Tyrosine-protein kinase receptor tyro3, second dom | 96.32 | |
| d1biha2 | 111 | Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | 96.16 | |
| d2fdbp2 | 109 | Fibroblast growth factor receptor, FGFR {Human (Ho | 96.1 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 96.08 | |
| d2oz4a3 | 84 | Intercellular adhesion molecule-1, ICAM-1 {Human ( | 96.06 | |
| d1epwa1 | 218 | Botulinum neurotoxin {Clostridium botulinum, serot | 96.0 | |
| d3b5ha1 | 101 | Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 | 95.93 | |
| d1kloa1 | 55 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 95.9 | |
| d1xdtr_ | 41 | Heparin-binding epidermal growth factor, HBEGF {Hu | 95.88 | |
| d1a8da1 | 247 | Tetanus neurotoxin {Clostridium tetani [TaxId: 151 | 95.84 | |
| d1szba2 | 45 | Mannose-binding protein associated serine protease | 95.76 | |
| d2fcba1 | 85 | Fc gamma receptor ectodomain (CD32) {Human (Homo s | 95.69 | |
| d3bpse1 | 40 | Low density lipoprotein (LDL) receptor, different | 95.59 | |
| d1fnla1 | 84 | Fc gamma receptor ectodomain (CD32) {Human (Homo s | 95.5 | |
| d2c9aa1 | 96 | Receptor-type tyrosine-protein phosphatase mu {Hum | 95.45 | |
| d1nt0a3 | 45 | Mannose-binding protein associated serine protease | 95.43 | |
| d1f2qa1 | 82 | IgE high affinity receptor alpha subunit {Human (H | 95.3 | |
| d1l6za1 | 107 | Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-t | 95.21 | |
| d1iray3 | 107 | Type-1 interleukin-1 receptor {Human (Homo sapiens | 95.18 | |
| d1iama1 | 103 | Intercellular cell adhesion molecule-1 (ICAM-1) {H | 95.11 | |
| d2ah2a1 | 225 | Trypanosoma sialidase, C-terminal domain {Parasiti | 94.1 | |
| d2crya1 | 115 | Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s | 93.89 | |
| d2nxyb1 | 97 | CD4 V-set domains {Human (Homo sapiens) [TaxId: 96 | 91.76 | |
| d1dr9a1 | 105 | CD80, N-terminal domain {Human (Homo sapiens) [Tax | 91.4 | |
| d1n1ta1 | 222 | Trypanosoma sialidase, C-terminal domain {Trypanos | 91.2 | |
| d1ijqa2 | 50 | Low density lipoprotein (LDL) receptor, different | 90.99 | |
| d1zxqa1 | 106 | Intercellular cell adhesion molecule-2 (ICAM-2) {H | 90.47 | |
| d1ncna_ | 110 | CD86 (b7-2), N-terminal domain {Human (Homo sapien | 90.04 | |
| d1neua_ | 119 | Myelin membrane adhesion molecule P0 {Rat (Rattus | 89.94 | |
| d1pkoa_ | 126 | Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra | 89.74 | |
| d1ucta2 | 96 | Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa | 89.43 | |
| d1ucta1 | 99 | Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa | 89.41 | |
| d1autl2 | 50 | Activated protein c (autoprothrombin IIa) {Human ( | 89.37 | |
| d1olla1 | 95 | Ligand binding domain of NK receptor NKp46 {Human | 89.19 | |
| d1jbja2 | 100 | CD3 epsilon chain ectodomain fragment {Mouse (Mus | 88.95 | |
| d1eaja_ | 124 | Coxsackie virus and adenovirus receptor (Car), dom | 88.54 | |
| d1autl2 | 50 | Activated protein c (autoprothrombin IIa) {Human ( | 88.14 | |
| d1dx5i1 | 43 | Thrombomodulin, different EGF-like domains {Human | 86.63 | |
| d2p3ua1 | 51 | Factor X, N-terminal module {Human (Homo sapiens) | 86.57 | |
| d1jv2b5 | 43 | Integrin beta EGF-like domains {Human (Homo sapien | 86.24 | |
| d1hkfa_ | 108 | NK cell activating receptor NKP44 {Human (Homo sap | 85.98 | |
| d1xeda_ | 116 | Polymeric-immunoglobulin receptor, PIGR {Human (Ho | 85.83 | |
| d1jv2b4 | 31 | Integrin beta EGF-like domains {Human (Homo sapien | 85.82 | |
| d1qfoa_ | 118 | N-terminal domain of sialoadhesin {Mouse (Mus musc | 85.75 | |
| d1hnfa1 | 101 | CD2, first domain {Human (Homo sapiens) [TaxId: 96 | 85.64 | |
| d1kigl_ | 51 | Factor X, N-terminal module {Cow (Bos taurus) [Tax | 84.95 | |
| d1l3ya_ | 41 | Integrin beta EGF-like domains {Human (Homo sapien | 84.86 | |
| d1olla2 | 93 | Ligand binding domain of NK receptor NKp46 {Human | 84.12 | |
| d1ijqa2 | 50 | Low density lipoprotein (LDL) receptor, different | 83.85 | |
| d1nezg_ | 122 | CD8 {Mouse (Mus musculus) [TaxId: 10090]} | 83.13 | |
| d1dx5i1 | 43 | Thrombomodulin, different EGF-like domains {Human | 82.89 | |
| d1xaua_ | 104 | B and T lymphocyte attenuator, Btla {Mouse (Mus mu | 82.83 | |
| d2gj6d1 | 94 | T-cell antigen receptor {Mouse (Mus musculus), bet | 82.72 | |
| d2g5ra1 | 121 | N-terminal domain of sialic acid binding Ig-like l | 81.52 | |
| d1akjd_ | 114 | CD8 {Human (Homo sapiens) [TaxId: 9606]} | 81.26 | |
| d1i9ea_ | 115 | T-cell antigen receptor {Mouse (Mus musculus), alp | 81.15 | |
| d3bp5a1 | 114 | Programmed cell death protein 1, PD1, extracellula | 80.66 | |
| d2cdea1 | 114 | T-cell antigen receptor {Human (Homo sapiens), bet | 80.29 | |
| d1smoa_ | 113 | TREM-1 (triggering receptor expressed on myeloid c | 80.26 | |
| d1i8ka_ | 106 | Immunoglobulin light chain kappa variable domain, | 80.13 | |
| d1j1pl_ | 107 | Immunoglobulin light chain kappa variable domain, | 80.09 | |
| d2p3ua1 | 51 | Factor X, N-terminal module {Human (Homo sapiens) | 80.01 |
| >d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Concanavalin A-like lectins/glucanases superfamily: Concanavalin A-like lectins/glucanases family: Laminin G-like module domain: Laminin alpha2 chain species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.96 E-value=5.7e-28 Score=234.71 Aligned_cols=171 Identities=24% Similarity=0.405 Sum_probs=139.9
Q ss_pred eeeEEc--CCceeeechhhhhhccCcceEEEEEEeCCCCeeEEecCCCCCCCCCCcceEEEEEECCEEEEEEEcCCcEEE
Q psy9228 652 SEVHFL--GEGYVELKKELIEERRNEETIAFDFVTDDKNALLLWNGQPSYKNGIGREFIAVAVVNGYLEYSYDLGDGVVT 729 (834)
Q Consensus 652 ~~~~F~--g~s~~~~~~~~~~~~~~~~~i~~~frT~~~~GlLl~~~~~~~~~~~~~~~~~l~l~~G~l~~~~~~g~~~~~ 729 (834)
.++.|. ++||+.++..... .+...+|+|+|||.+++|+|||++... ..|||+|+|.||+|++.+++|++...
T Consensus 15 ~~~~fg~s~~s~~~~~~~~~~-~~~~~~i~~~frT~~~~GlL~~~~~~~-----~~dfi~l~l~~G~l~~~~~~g~~~~~ 88 (189)
T d1dyka1 15 GSKQFGLSRNSHIAIAFDDTK-VKNRLTIELEVRTEAESGLLFYMARIN-----HADFATVQLRNGFPYFSYDLGSGDTS 88 (189)
T ss_dssp TCEECCSSTTCEEEEECCGGG-GSSEEEEEEEEEECCSCEEEEEEECTT-----SSSEEEEEEETTEEEEEEESSSCEEE
T ss_pred CceecCCCCCceEEEecCccc-ccccEEEEEEEEECCCCEEEEEEcCCC-----CCcEEEEEEECCEEEEEEECCCccEE
Confidence 356674 4789998754332 357789999999999999999987543 36899999999999999999999888
Q ss_pred EEeCCceecCCCcEEEEEEEECCEEEEEEcCeeeecccCCCCccceecCCceEEcCcCCCCCCC-CCccCCCceEEEEEE
Q psy9228 730 IKFSKKPVNDGIKHSVNVTRINKFGSLEVDSVIVGKGESPGSQDVINTRGNIYLGGTPNMDLMT-GGRYVHPMSGLMMNI 808 (834)
Q Consensus 730 l~~s~~~~nDg~wH~V~i~r~~~~~~l~VD~~~~~~~~~~~~~~~l~~~~~lyiGG~p~~~~~~-~~~~~~~F~GCi~~v 808 (834)
+. +..+|+||+||+|.|.|.++.++|+||+...... .++....++..+.|||||+|...... ......+|+|||++|
T Consensus 89 ~~-~~~~v~Dg~WH~V~v~~~~~~~~l~VD~~~~~~~-~~~~~~~l~~~~~lyiGG~p~~~~~~~~~~~~~~F~GCi~~v 166 (189)
T d1dyka1 89 TM-IPTKINDGQWHKIKIVRVKQEGILYVDDASSQTI-SPKKADILDVVGILYVGGLPINYTTRRIGPVTYSLDGCVRNL 166 (189)
T ss_dssp EE-CCSCCCSSSCEEEEEEEETTEEEEEETTEEEEEE-CSTTCCCCCCCSEEEESSCCTTCCCCSSCSCCSBCSEEEEEE
T ss_pred ec-CCcEeeCCCEEEEEEEEcccEEEEEECCcceeeE-ccCcccccccccceEEecccccccccccCcCCCCcEEEEeEE
Confidence 87 7789999999999999999999999999876543 44555667888899999999754332 234567899999999
Q ss_pred EECCceecccCCCCCCCccccccc
Q psy9228 809 HIQNKHISNIGSSASSGLHVMPWI 832 (834)
Q Consensus 809 ~in~~~~~~l~~~a~~~~nv~~c~ 832 (834)
+||++ .++|.+ +....||.+||
T Consensus 167 ~in~~-~~~L~~-~~~~~~V~~Cf 188 (189)
T d1dyka1 167 HMEQA-PVDLDQ-PTSSFHVGTCF 188 (189)
T ss_dssp EESSS-CCCTTS-CSEEESCBCCB
T ss_pred EECCE-EecCCC-cccCCCccCcc
Confidence 99996 568876 46999999998
|
| >d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2r1da1 b.29.1.4 (A:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2r1da1 b.29.1.4 (A:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erfa1 b.29.1.4 (A:10-215) Thrombospondin 1 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1b09a_ b.29.1.5 (A:) C-reactive protein (CRP) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1saca_ b.29.1.5 (A:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2slia1 b.29.1.9 (A:81-276) Leech intramolecular trans-sialidase, N-terminal domain {North american leech (Macrobdella decora) [TaxId: 6405]} | Back information, alignment and structure |
|---|
| >d2erfa1 b.29.1.4 (A:10-215) Thrombospondin 1 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a8da1 b.29.1.6 (A:1-247) Tetanus neurotoxin {Clostridium tetani [TaxId: 1513]} | Back information, alignment and structure |
|---|
| >d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | Back information, alignment and structure |
|---|
| >d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3btaa1 b.29.1.6 (A:872-1078) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]} | Back information, alignment and structure |
|---|
| >d1b09a_ b.29.1.5 (A:) C-reactive protein (CRP) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1epwa1 b.29.1.6 (A:862-1079) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1saca_ b.29.1.5 (A:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | Back information, alignment and structure |
|---|
| >d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} | Back information, alignment and structure |
|---|
| >d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2slia1 b.29.1.9 (A:81-276) Leech intramolecular trans-sialidase, N-terminal domain {North american leech (Macrobdella decora) [TaxId: 6405]} | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3btaa1 b.29.1.6 (A:872-1078) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]} | Back information, alignment and structure |
|---|
| >d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | Back information, alignment and structure |
|---|
| >d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1epwa1 b.29.1.6 (A:862-1079) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]} | Back information, alignment and structure |
|---|
| >d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a8da1 b.29.1.6 (A:1-247) Tetanus neurotoxin {Clostridium tetani [TaxId: 1513]} | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ah2a1 b.29.1.15 (A:409-633) Trypanosoma sialidase, C-terminal domain {Parasitic flagellate protozoan (Trypanosoma cruzi) [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n1ta1 b.29.1.15 (A:413-634) Trypanosoma sialidase, C-terminal domain {Trypanosoma rangeli [TaxId: 5698]} | Back information, alignment and structure |
|---|
| >d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ncna_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ucta2 b.1.1.4 (A:101-196) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jbja2 b.1.1.4 (A:1-100) CD3 epsilon chain ectodomain fragment {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hkfa_ b.1.1.1 (A:) NK cell activating receptor NKP44 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xeda_ b.1.1.1 (A:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qfoa_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hnfa1 b.1.1.1 (A:4-104) CD2, first domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1olla2 b.1.1.4 (A:96-188) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xaua_ b.1.1.4 (A:) B and T lymphocyte attenuator, Btla {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gj6d1 b.1.1.1 (D:15-114) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2g5ra1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1akjd_ b.1.1.1 (D:) CD8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i9ea_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3bp5a1 b.1.1.1 (A:1-114) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cdea1 b.1.1.1 (A:2-115) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1smoa_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i8ka_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j1pl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|