Psyllid ID: psy942


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760--
MSTAVNASRLTGKVAVVTASSDGIGFAIAKRLSAEGASVVISSRKESNVNKAVETLQKEGHQKISGVVCHVAKKEDRQKLFEHAEKKFGGIDILVSNAAVNPATGPVVECPENVWDKIFEVNVKSTFLLTQEVLPYIRKRNGGSIVYVSSIGGLAPFKLLGAYSVSKTALLGLTKAVAQDLASENIRVNCLAPGITKTKFAAAKKEVKKKETNDEPIVYTSNTAPGEMKDVLGPLPSSYSPQYVEAAWYPWWEKQGFFKPEYGRKSIGEKNPKGKFVMVIPPPNVTGTLHLGHALTNAVEDSITRWNRMKGKTTLWNPGCDHAGIATQVVVEKKLWREEKKTRHEIGREKFIEKVWEWKKEVFSTSTKIMSTAVNASRLAGKVAVVTASSDGIGFAIAKRLSTEGASVVISSRKESNVNKAVETLQKEGHQKISGVVCHVAKKEDRQKLFEHAEKKFGGIDILVSNAAVNPATGPVVECPENVWDKIFEVNVKSTFLLTQEVLPYIRKRNGGSIVYVSSIGGLAPFKLLGAYSVSKTALLGLTKAVAQDLASENIRVNCLAPGITKTKFAAALYETEEAHEIAVSNVPMGRLAVPDEMGGIVAFLCSDDASYITGEVIVAAGGMQSRLTKSTVEFRFIGAYSVSKTALFGLTKVVAEDLAPENIRVNCLAPGLIRTKFGDRMIAMLSTDKLYGGIDILVSNAAVNPANEPLVECSEVVWDKIFDVNLKSSFLLTQEVLPYMRKKKGGSIVYVSSIGGFKQFK
cccccccccccccEEEEEccccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHHHHcccccEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccccccHHHHHccHHHccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEEccccHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHcccccEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccccccHHHHcccHHHHHHHHHcccccccccHHHHHHHHHHHcccccccccccEEEEcccccccccccHHHHccccHHHHHHHHHccccHHHHHHHcccccEEEEEEcccccccHHHHHHHHHHHHHHcccccEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccc
cccccccccccccEEEEcccccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHcccEEEEEEEEcccHHHHHHHHHHHHHHHcccEEEEEccccccccccEEcccHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccEEEEEEccHHHccccccEHHHHHHHHHHHHHHHHHHHHHHHHcEEEEEEEEccEccHHHHHccHHHHHHHHHHHcccccccccccHHHHHHHHHccccccccEEEEEEEccccccccccccccccccccHcHEEEEccccccccEEEEEEEccccHHHHHHHHHHHHcccEEEEcccccccccEEHEEEccHcHHHccccccccccccccccccccccccccccccHcccccccccccccEEEEcccccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHHHHHccccEEEEcccccccccccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccEEEEEEccHHHccccccEHHHHHHHHHHHHHHHHHHHHHHHHcEEEEEEEEccEccHHHHHHcccHHHHHHHHHHccccccEcHHHHHHHHHHHHcHHHccccccEEEEcccHEEEEEEEcccccHcHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEccEccccccHHHHHHHHHHHHcccEEEEEccccccccccEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEEcccc
mstavnasrLTGKVAVVTASSDGIGFAIAKRLSAEGASVVISSRKESNVNKAVETLQKEGHQKISGVVCHVAKKEDRQKLFEHAEKKFGGidilvsnaavnpatgpvvecpenvwDKIFEVNVKSTFLLTQEVLPyirkrnggsivyvssigglapfkLLGAYSVSKTALLGLTKAVAQDLAsenirvnclapgitKTKFAAAKKEVKkketndepivytsntapgemkdvlgplpssyspqyveaawypwwekqgffkpeygrksigeknpkgkfvmvipppnvtgtlhLGHALTNAVEDSITRWNrmkgkttlwnpgcdhagiATQVVVEKKLWREEKKTRHEIGREKFIEKVWEWKKEVFSTSTKIMSTAVNASRLAGKVAVVTASSDGIGFAIAKRLSTEGASVVISSRKESNVNKAVETLQKEGHQKISGVVCHVAKKEDRQKLFEHAEKKFGGidilvsnaavnpatgpvvecpenvwDKIFEVNVKSTFLLTQEVLPyirkrnggsivyvssigglapfkLLGAYSVSKTALLGLTKAVAQDLAsenirvnclapgitKTKFAAALYETEEAHEIavsnvpmgrlavpdemGGIVAFLCSDDASYITGEVIVAAggmqsrltkstvEFRFIGAYSVSKTALFGLTKVvaedlapenirvnclapglirtkFGDRMIAMLStdklyggidilvsnaavnpaneplvecSEVVWDKIFDVNLKSSFLLTQEVLPYMRKKKGGSIVYVSSiggfkqfk
mstavnasrltgkvavvtassdGIGFAIAKRLSAEGASvvissrkesnvNKAVEtlqkeghqkisgVVCHVAKKEDRQKLFEHAEKKFGGIDILVSNAAVNPATGPVVECPENVWDKIFEVNVKSTFLLTQEVLPYIRKRNGGSIVYVSSIGGLAPFKLLGAYSVSKTALLGLTKAVAQDLASenirvnclapgiTKTKFAAAKkevkkketndepivytsntapgemKDVLGPLPSSYSPQYVEAAWYPWWEKQGFFKPEYGRKSIGEKNPKGKFVMVIPPPNVTGTLHLGHALTNAVEDSITRWNRMKGKTTlwnpgcdhagiaTQVVVEKKLwreekktrheigrekfiekVWEWKKEVFSTSTKIMSTAVNASRLAGKVAVVTASSDGIGFAIAKRLSTEGASvvissrkesnvNKAVEtlqkeghqkisgVVCHVAKKEDRQKLFEHAEKKFGGIDILVSNAAVNPATGPVVECPENVWDKIFEVNVKSTFLLTQEVLPYIRKRNGGSIVYVSSIGGLAPFKLLGAYSVSKTALLGLTKAVAQDLASenirvnclapgITKTKFAAALYETEEAHEIAVSNVPMGRLAVPDEMGGIVAFLCSDDASYITGEVIVaaggmqsrlTKSTVEFRFIGAYSVSKTALFGLTKVVaedlapenirvnclapglirTKFGDRMIAMLSTDKLYGGIDILVSNAAVNPANEPLVECSEVVWDKIFDVNLKSSFLLTQEVLPYMRKKKGGSIVYVSSIGGFKQFK
MSTAVNASRLTGKVAVVTASSDGIGFAIAKRLSAEGASVVISSRKESNVNKAVETLQKEGHQKISGVVCHVAKKEDRQKLFEHAEKKFGGIDILVSNAAVNPATGPVVECPENVWDKIFEVNVKSTFLLTQEVLPYIRKRNggsivyvssiggLAPFKLLGAYSVSKTALLGLTKAVAQDLASENIRVNCLAPGItktkfaaakkevkkketNDEPIVYTSNTAPGEMKDVLGPLPSSYSPQYVEAAWYPWWEKQGFFKPEYGRKSIGEKNPKGKFVMVIPPPNVTGTLHLGHALTNAVEDSITRWNRMKGKTTLWNPGCDHAGIATQVVVEKKLWREEKKTRHEIGREKFIEKVWEWKKEVFSTSTKIMSTAVNASRLAGKVAVVTASSDGIGFAIAKRLSTEGASVVISSRKESNVNKAVETLQKEGHQKISGVVCHVAKKEDRQKLFEHAEKKFGGIDILVSNAAVNPATGPVVECPENVWDKIFEVNVKSTFLLTQEVLPYIRKRNggsivyvssiggLAPFKLLGAYSVSKTALLGLTKAVAQDLASENIRVNCLAPGITKTKFAAALYETEEAHEIAVSNVPMGRLAVPDEMGGIVAFLCSDDASYITGEVIVAAGGMQSRLTKSTVEFRFIGAYSVSKTALFGLTKVVAEDLAPENIRVNCLAPGLIRTKFGDRMIAMLSTDKLYGGIDILVSNAAVNPANEPLVECSEVVWDKIFDVNLKSSFLLTQEVLPYMRKKKggsivyvssiggFKQFK
***********GKVAVVTASSDGIGFAIAKRLSAEGA*VV**********************KISGVVCHVAKKEDRQKLFEHAEKKFGGIDILVSNAAVNPATGPVVECPENVWDKIFEVNVKSTFLLTQEVLPYIRKRNGGSIVYVSSIGGLAPFKLLGAYSVSKTALLGLTKAVAQDLASENIRVNCLAPGITKTKFAA************************************YSPQYVEAAWYPWWEKQGFFKPEYGRKSIGEKNPKGKFVMVIPPPNVTGTLHLGHALTNAVEDSITRWNRMKGKTTLWNPGCDHAGIATQVVVEKKLWREEKKTRHEIGREKFIEKVWEWKKEVFSTSTKIMSTAVNASRLAGKVAVVTASSDGIGFAIAKRLSTEGASVV**********************KISGVVCHVAKKEDRQKLFEHAEKKFGGIDILVSNAAVNPATGPVVECPENVWDKIFEVNVKSTFLLTQEVLPYIRKRNGGSIVYVSSIGGLAPFKLLGAYSVSKTALLGLTKAVAQDLASENIRVNCLAPGITKTKFAAALYETEEAHEIAVSNVPMGRLAVPDEMGGIVAFLCSDDASYITGEVIVAAGGMQSRLTKSTVEFRFIGAYSVSKTALFGLTKVVAEDLAPENIRVNCLAPGLIRTKFGDRMIAMLSTDKLYGGIDILVSNAAVNPANEPLVECSEVVWDKIFDVNLKSSFLLTQEVLPYMRKKKGGSIVYVSSIGGF****
***********GKVAVVTASSDGIGFAIAKRLSAEGASVVISSRKESNVNKAVETLQKEGHQKISGVVCHVAKKEDRQKLFEHAEKKFGGIDILVSNAAVNPATGPVVECPENVWDKIFEVNVKSTFLLTQEVLPYIRKRNGGSIVYVSSIGGLAPFKLLGAYSVSKTALLGLTKAVAQDLASENIRVNCLAPGITKTKFAAAKKEVKK*******************KDVLGPLPSSYSPQYVEAAWYPWWEKQGFFKPEY***********GKFVMVIPPPNVTGTLHLGHALTNAVEDSITRWNRMKGKTTLWNPGCDHAGIATQVVVEKKLWREE***********FIEKVW**************************VAVVTASSDGIGFAIAKRLSTEGASVVISSRKESNVNKAVETLQKEGHQKISGVVCHVAKKEDRQKLFEHAEKKFGGIDILVSNAAVNPATGPVVECPENVWDKIFEVNVKSTFLLTQEVLPYIRKRNGGSIVYVSSIGGLAPFKLLGAYSVSKTALLGLTKAVAQDLASENIRVNCLAPGITKTKFAAALYETEEAHEIAVSNVPMGRLAVPDEMGGIVAFLCSDDASYITGEVIVAAGGMQSRLTKSTVEFRFIGAYSVSKTALFGLTKVVAEDLAPENIRVNCLAPGLIRTKFGDRMIAMLSTDKLYGGIDILVSNAAVNPANEPLVECSEVVWDKIFDVNLKSSFLLTQEVLPYMRKKKGGSIVYVSSIGGFKQF*
*********LTGKVAVVTASSDGIGFAIAKRLSAEGASVVISSRKESNVNKAVETLQKEGHQKISGVVCHVAKKEDRQKLFEHAEKKFGGIDILVSNAAVNPATGPVVECPENVWDKIFEVNVKSTFLLTQEVLPYIRKRNGGSIVYVSSIGGLAPFKLLGAYSVSKTALLGLTKAVAQDLASENIRVNCLAPGITKTKFAAAKKEVKKKETNDEPIVYTSNTAPGEMKDVLGPLPSSYSPQYVEAAWYPWWEKQGFFKPEYGRKSIGEKNPKGKFVMVIPPPNVTGTLHLGHALTNAVEDSITRWNRMKGKTTLWNPGCDHAGIATQVVVEKKLWREEKKTRHEIGREKFIEKVWEWKKEVFSTSTKIMSTAVNASRLAGKVAVVTASSDGIGFAIAKRLSTEGASVVISSRKESNVNKAVETLQKEGHQKISGVVCHVAKKEDRQKLFEHAEKKFGGIDILVSNAAVNPATGPVVECPENVWDKIFEVNVKSTFLLTQEVLPYIRKRNGGSIVYVSSIGGLAPFKLLGAYSVSKTALLGLTKAVAQDLASENIRVNCLAPGITKTKFAAALYETEEAHEIAVSNVPMGRLAVPDEMGGIVAFLCSDDASYITGEVIVAAGGMQSRLTKSTVEFRFIGAYSVSKTALFGLTKVVAEDLAPENIRVNCLAPGLIRTKFGDRMIAMLSTDKLYGGIDILVSNAAVNPANEPLVECSEVVWDKIFDVNLKSSFLLTQEVLPYMRKKKGGSIVYVSSIGGFKQFK
********RLTGKVAVVTASSDGIGFAIAKRLSAEGASVVISSRKESNVNKAVETLQKEGHQKISGVVCHVAKKEDRQKLFEHAEKKFGGIDILVSNAAVNPATGPVVECPENVWDKIFEVNVKSTFLLTQEVLPYIRKRNGGSIVYVSSIGGLAPFKLLGAYSVSKTALLGLTKAVAQDLASENIRVNCLAPGITKTKFAAAKKEVKKKETNDEPIVYTSNTAPGEMKDVLGPLPSSYSPQYVEAAWYPWWEKQGFFKPEYGRKSIGEKNPKGKFVMVIPPPNVTGTLHLGHALTNAVEDSITRWNRMKGKTTLWNPGCDHAGIATQVVVEKKLWREEKK*****************************STAVNASRLAGKVAVVTASSDGIGFAIAKRLSTEGASVVISSRKESNVNKAVETLQKEGHQKISGVVCHVAKKEDRQKLFEHAEKKFGGIDILVSNAAVNPATGPVVECPENVWDKIFEVNVKSTFLLTQEVLPYIRKRNGGSIVYVSSIGGLAPFKLLGAYSVSKTALLGLTKAVAQDLASENIRVNCLAPGITKTKFAAALYETEEAHEIAVSNVPMGRLAVPDEMGGIVAFLCSDDASYITGEVIVAAGGMQSRLTKSTVEFRFIGAYSVSKTALFGLTKVVAEDLAPENIRVNCLAPGLIRTKFGDRMIAMLSTDKLYGGIDILVSNAAVNPANEPLVECSEVVWDKIFDVNLKSSFLLTQEVLPYMRKKKGGSIVYVSSIGGFKQF*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTAVNASRLTGKVAVVTASSDGIGFAIAKRLSAEGASVVISSRKESNVNKAVETLQKEGHQKISGVVCHVAKKEDRQKLFEHAEKKFGGIDILVSNAAVNPATGPVVECPENVWDKIFEVNVKSTFLLTQEVLPYIRKRNGGSIVYVSSIGGLAPFKLLGAYSVSKTALLGLTKAVAQDLASENIRVNCLAPGITKTKFAAAKKEVKKKETNDEPIVYTSNTAPGEMKDVLGPLPSSYSPQYVEAAWYPWWEKQGFFKPEYGRKSIGEKNPKGKFVMVIPPPNVTGTLHLGHALTNAVEDSITRWNRMKGKTTLWNPGCDHAGIATQVVVEKKLWREEKKTRHEIGREKFIEKVWEWKKEVFSTSTKIMSTAVNASRLAGKVAVVTASSDGIGFAIAKRLSTEGASVVISSRKESNVNKAVETLQKEGHQKISGVVCHVAKKEDRQKLFEHAEKKFGGIDILVSNAAVNPATGPVVECPENVWDKIFEVNVKSTFLLTQEVLPYIRKRNGGSIVYVSSIGGLAPFKLLGAYSVSKTALLGLTKAVAQDLASENIRVNCLAPGITKTKFAAALYETEEAHEIAVSNVPMGRLAVPDEMGGIVAFLCSDDASYITGEVIVAAGGMQSRLTKSTVEFRFIGAYSVSKTALFGLTKVVAEDLAPENIRVNCLAPGLIRTKFGDRMIAMLSTDKLYGGIDILVSNAAVNPANEPLVECSEVVWDKIFDVNLKSSFLLTQEVLPYMRKKKGGSIVYVSSIGGFKQFK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query762 2.2.26 [Sep-21-2011]
Q9GKX2260 Dehydrogenase/reductase S yes N/A 0.326 0.957 0.576 6e-76
Q8SPU8279 Dehydrogenase/reductase S yes N/A 0.326 0.892 0.572 1e-74
Q8WNV7279 Dehydrogenase/reductase S yes N/A 0.343 0.939 0.545 4e-74
Q9BTZ2278 Dehydrogenase/reductase S yes N/A 0.326 0.895 0.564 6e-73
Q5RCF8278 Dehydrogenase/reductase S yes N/A 0.363 0.996 0.512 7e-73
Q99LB2279 Dehydrogenase/reductase S yes N/A 0.326 0.892 0.548 8e-73
Q8VID1279 Dehydrogenase/reductase S yes N/A 0.326 0.892 0.552 3e-71
P49696 1217 Valine--tRNA ligase OS=Ta N/A N/A 0.208 0.130 0.716 5e-69
P26640 1264 Valine--tRNA ligase OS=Ho no N/A 0.190 0.114 0.724 5e-67
Q9Z1Q9 1263 Valine--tRNA ligase OS=Mu no N/A 0.190 0.114 0.731 3e-66
>sp|Q9GKX2|DHRS4_RABIT Dehydrogenase/reductase SDR family member 4 (Fragment) OS=Oryctolagus cuniculus GN=DHRS4 PE=1 SV=1 Back     alignment and function desciption
 Score =  286 bits (731), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 144/250 (57%), Positives = 185/250 (74%), Gaps = 1/250 (0%)

Query: 379 LAGKVAVVTASSDGIGFAIAKRLSTEGASVVISSRKESNVNKAVETLQKEGHQKISGVVC 438
           LA KVA+VTAS+DGIG AIA+RL+ +GA VVISSRK+ NV++AV  LQ EG   ++G VC
Sbjct: 12  LANKVAIVTASTDGIGLAIARRLAQDGAHVVISSRKQQNVDRAVAALQAEGLS-VTGTVC 70

Query: 439 HVAKKEDRQKLFEHAEKKFGGIDILVSNAAVNPATGPVVECPENVWDKIFEVNVKSTFLL 498
           HV K EDR++L   A    GGIDILVSNAAVNP  G +++  E VWDKI ++NVK+  L+
Sbjct: 71  HVGKAEDRERLVATALNLHGGIDILVSNAAVNPFFGKLMDVTEEVWDKILDINVKAMALM 130

Query: 499 TQEVLPYIRKRNGGSIVYVSSIGGLAPFKLLGAYSVSKTALLGLTKAVAQDLASENIRVN 558
           T+ V+P + KR GGS+V V+SI    PF  LG Y+VSKTAL+GLTK +A +LA++NIRVN
Sbjct: 131 TKAVVPEMEKRGGGSVVIVASIAAFNPFSGLGPYNVSKTALVGLTKNLALELAAQNIRVN 190

Query: 559 CLAPGITKTKFAAALYETEEAHEIAVSNVPMGRLAVPDEMGGIVAFLCSDDASYITGEVI 618
           CLAPG+ KT F+ AL+E +   E  +  + + RL  P+E  GIV+FLCS+DASYITGE +
Sbjct: 191 CLAPGLIKTSFSKALWEDKAQEENIIQKLRIRRLGKPEECAGIVSFLCSEDASYITGETV 250

Query: 619 VAAGGMQSRL 628
           V AGG  SRL
Sbjct: 251 VVAGGAPSRL 260




Reduces all-trans-retinal and 9-cis retinal. Can also catalyze the oxidation of all-trans-retinol with NADP as co-factor, but with much lower efficiency. Reduces alkyl phenyl ketones and alpha-dicarbonyl compounds with aromatic rings, such as pyrimidine-4-aldehyde, 3-benzoylpyridine, 4-benzoylpyridine, menadione and 4-hexanoylpyridine. Has no activity towards aliphatic aldehydes and ketones.
Oryctolagus cuniculus (taxid: 9986)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 1EC: 8EC: 4
>sp|Q8SPU8|DHRS4_BOVIN Dehydrogenase/reductase SDR family member 4 OS=Bos taurus GN=DHRS4 PE=2 SV=2 Back     alignment and function description
>sp|Q8WNV7|DHRS4_PIG Dehydrogenase/reductase SDR family member 4 OS=Sus scrofa GN=DHRS4 PE=1 SV=2 Back     alignment and function description
>sp|Q9BTZ2|DHRS4_HUMAN Dehydrogenase/reductase SDR family member 4 OS=Homo sapiens GN=DHRS4 PE=1 SV=3 Back     alignment and function description
>sp|Q5RCF8|DHRS4_PONAB Dehydrogenase/reductase SDR family member 4 OS=Pongo abelii GN=DHRS4 PE=2 SV=3 Back     alignment and function description
>sp|Q99LB2|DHRS4_MOUSE Dehydrogenase/reductase SDR family member 4 OS=Mus musculus GN=Dhrs4 PE=2 SV=3 Back     alignment and function description
>sp|Q8VID1|DHRS4_RAT Dehydrogenase/reductase SDR family member 4 OS=Rattus norvegicus GN=Dhrs4 PE=2 SV=2 Back     alignment and function description
>sp|P49696|SYVC_TAKRU Valine--tRNA ligase OS=Takifugu rubripes GN=vars PE=3 SV=1 Back     alignment and function description
>sp|P26640|SYVC_HUMAN Valine--tRNA ligase OS=Homo sapiens GN=VARS PE=1 SV=4 Back     alignment and function description
>sp|Q9Z1Q9|SYVC_MOUSE Valine--tRNA ligase OS=Mus musculus GN=Vars PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query762
158285614282 AGAP007475-PA [Anopheles gambiae str. PE 0.335 0.907 0.657 1e-94
157112612279 short-chain dehydrogenase [Aedes aegypti 0.338 0.924 0.667 1e-93
170052100264 dehydrogenase/reductase SDR family membe 0.342 0.988 0.650 2e-90
195014113325 GH15276 [Drosophila grimshawi] gi|193897 0.328 0.769 0.649 4e-89
195127369329 GI11985 [Drosophila mojavensis] gi|19391 0.347 0.805 0.621 5e-89
195376307328 GJ12209 [Drosophila virilis] gi|19415409 0.328 0.762 0.641 2e-88
289741039311 dehydrogenase/reductase SdR family membe 0.328 0.803 0.645 4e-88
195337613317 GM13930 [Drosophila sechellia] gi|194128 0.335 0.807 0.634 4e-88
194866925317 GG14143 [Drosophila erecta] gi|190653753 0.345 0.829 0.621 8e-88
21355319317 CG10672 [Drosophila melanogaster] gi|729 0.335 0.807 0.634 2e-87
>gi|158285614|ref|XP_308397.4| AGAP007475-PA [Anopheles gambiae str. PEST] gi|157020077|gb|EAA04619.4| AGAP007475-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
 Score =  354 bits (908), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 169/257 (65%), Positives = 209/257 (81%), Gaps = 1/257 (0%)

Query: 372 TAVNASRLAGKVAVVTASSDGIGFAIAKRLSTEGASVVISSRKESNVNKAVETLQKEGHQ 431
           +A+ A RL GKVAVVTAS++GIG+AIA+RL  EGA VV+SSRK+ NV++AV  L+  G +
Sbjct: 27  SAIAAKRLTGKVAVVTASTEGIGYAIAERLGQEGAKVVVSSRKQQNVDRAVNDLRTAGLE 86

Query: 432 KISGVVCHVAKKEDRQKLFEHAEKKFGGIDILVSNAAVNPATGPVVECPENVWDKIFEVN 491
            +SG+ CHVA   DR+ LFEHA +KFGGIDILVSNAAVNP  G V+EC E+ WDKIF+VN
Sbjct: 87  -VSGIKCHVANATDRKALFEHAAQKFGGIDILVSNAAVNPEVGGVLECSESAWDKIFDVN 145

Query: 492 VKSTFLLTQEVLPYIRKRNGGSIVYVSSIGGLAPFKLLGAYSVSKTALLGLTKAVAQDLA 551
           VK ++LL +EVLP+IR+R GGSIV++SSI G  PF LLGAYSVSKTAL GLTKA +Q+LA
Sbjct: 146 VKCSYLLAKEVLPFIRERKGGSIVFISSIAGFQPFSLLGAYSVSKTALFGLTKAASQELA 205

Query: 552 SENIRVNCLAPGITKTKFAAALYETEEAHEIAVSNVPMGRLAVPDEMGGIVAFLCSDDAS 611
           +ENIRVNC+APG+ +TKFA AL E++ A E  +S +PMGR+A P E+ G+ AFL SDDAS
Sbjct: 206 AENIRVNCIAPGVVQTKFAGALQESDAAKEETLSRIPMGRIAQPKEISGVCAFLVSDDAS 265

Query: 612 YITGEVIVAAGGMQSRL 628
           YITGE IVA+GGM SRL
Sbjct: 266 YITGETIVASGGMASRL 282




Source: Anopheles gambiae str. PEST

Species: Anopheles gambiae

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|157112612|ref|XP_001657588.1| short-chain dehydrogenase [Aedes aegypti] gi|108877992|gb|EAT42217.1| AAEL006224-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170052100|ref|XP_001862068.1| dehydrogenase/reductase SDR family member 4 [Culex quinquefasciatus] gi|167873093|gb|EDS36476.1| dehydrogenase/reductase SDR family member 4 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|195014113|ref|XP_001983960.1| GH15276 [Drosophila grimshawi] gi|193897442|gb|EDV96308.1| GH15276 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195127369|ref|XP_002008141.1| GI11985 [Drosophila mojavensis] gi|193919750|gb|EDW18617.1| GI11985 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195376307|ref|XP_002046938.1| GJ12209 [Drosophila virilis] gi|194154096|gb|EDW69280.1| GJ12209 [Drosophila virilis] Back     alignment and taxonomy information
>gi|289741039|gb|ADD19267.1| dehydrogenase/reductase SdR family member [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|195337613|ref|XP_002035423.1| GM13930 [Drosophila sechellia] gi|194128516|gb|EDW50559.1| GM13930 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|194866925|ref|XP_001971970.1| GG14143 [Drosophila erecta] gi|190653753|gb|EDV50996.1| GG14143 [Drosophila erecta] Back     alignment and taxonomy information
>gi|21355319|ref|NP_647946.1| CG10672 [Drosophila melanogaster] gi|7295487|gb|AAF50801.1| CG10672 [Drosophila melanogaster] gi|17862894|gb|AAL39924.1| SD02021p [Drosophila melanogaster] gi|220944606|gb|ACL84846.1| CG10672-PA [synthetic construct] gi|220954478|gb|ACL89782.1| CG10672-PA [synthetic construct] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query762
FB|FBgn0035588317 CG10672 [Drosophila melanogast 0.345 0.829 0.594 2.1e-77
ZFIN|ZDB-GENE-040426-1498276 zgc:65987 "zgc:65987" [Danio r 0.350 0.967 0.512 1.7e-66
UNIPROTKB|Q9GKX2260 DHRS4 "Dehydrogenase/reductase 0.326 0.957 0.548 4.5e-66
UNIPROTKB|F1MZD5279 DHRS4 "Dehydrogenase/reductase 0.326 0.892 0.536 2e-65
UNIPROTKB|Q8SPU8279 DHRS4 "Dehydrogenase/reductase 0.326 0.892 0.536 2.5e-65
FB|FBgn0027079 1049 Aats-val "Valyl-tRNA synthetas 0.192 0.140 0.734 5.6e-65
UNIPROTKB|Q8WNV7279 DHRS4 "Dehydrogenase/reductase 0.343 0.939 0.518 1.1e-64
UNIPROTKB|F1PCI3279 DHRS4 "Uncharacterized protein 0.339 0.928 0.519 7.6e-64
UNIPROTKB|Q9BTZ2278 DHRS4 "Dehydrogenase/reductase 0.326 0.895 0.532 1.6e-63
MGI|MGI:90169279 Dhrs4 "dehydrogenase/reductase 0.343 0.939 0.5 2.6e-63
FB|FBgn0035588 CG10672 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 779 (279.3 bits), Expect = 2.1e-77, P = 2.1e-77
 Identities = 157/264 (59%), Positives = 198/264 (75%)

Query:   365 TSTKIMSTAVNASRLAGKVAVVTASSDGIGFAIAKRLSTEGASVVISSRKESNVNKAVET 424
             +S+   STA    RLAGKVAVVTAS+DGIGFAIAKRL+ +GA+VVISSRK+ NV+ A+  
Sbjct:    55 SSSSQSSTAGTMKRLAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAE 114

Query:   425 LQKEGHQKISGVVCHVAKKEDRQKLFEHAEKKFGGIDILVSNAAVNPATGPVVECPENVW 484
             L+K  +  + G+ CHV++ EDR++LFE    KFG ++ILVSNAA NPA G V+EC E VW
Sbjct:   115 LRKL-NLNVHGLKCHVSEPEDRKQLFEETISKFGKLNILVSNAATNPAVGGVLECDEKVW 173

Query:   485 DKIFEVNVKSTFLLTQEVLPYIRKRNXXXXXXXXXXXXLAPFKLLGAYSVSKTALLGLTK 544
             DKIF+VNVKS++LL +E LP +R++                F+LLGAYSVSKTAL+GLTK
Sbjct:   174 DKIFDVNVKSSYLLAKEALPLLRQQKNSSIVFVSSIAGYDAFELLGAYSVSKTALIGLTK 233

Query:   545 AVAQDLASENIRVNCLAPGITKTKFAAALYETEEAHEIAVSNVPMGRLAVPDEMGGIVAF 604
             A A+DLA E IRVNCLAPG+ +TKF+ ALYE E A+E A+S +PMGRL   +EM G+V+F
Sbjct:   234 AAAKDLAPEGIRVNCLAPGVIRTKFSKALYENESANEAALSKIPMGRLGTSEEMAGVVSF 293

Query:   605 LCSDDASYITGEVIVAAGGMQSRL 628
             L S+DA YITGE IVA GGM +RL
Sbjct:   294 LVSEDAGYITGESIVAGGGMTARL 317


GO:0016614 "oxidoreductase activity, acting on CH-OH group of donors" evidence=ISS
GO:0000166 "nucleotide binding" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
ZFIN|ZDB-GENE-040426-1498 zgc:65987 "zgc:65987" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9GKX2 DHRS4 "Dehydrogenase/reductase SDR family member 4" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
UNIPROTKB|F1MZD5 DHRS4 "Dehydrogenase/reductase SDR family member 4" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q8SPU8 DHRS4 "Dehydrogenase/reductase SDR family member 4" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0027079 Aats-val "Valyl-tRNA synthetase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q8WNV7 DHRS4 "Dehydrogenase/reductase SDR family member 4" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PCI3 DHRS4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BTZ2 DHRS4 "Dehydrogenase/reductase SDR family member 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:90169 Dhrs4 "dehydrogenase/reductase (SDR family) member 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8WNV7DHRS4_PIG1, ., 1, ., 1, ., 1, 8, 40.54540.34380.9390yesN/A
Q99LB2DHRS4_MOUSE1, ., 1, ., 1, ., 1, 8, 40.5480.32670.8924yesN/A
Q5RCF8DHRS4_PONAB1, ., 1, ., 1, ., 1, 8, 40.51220.36350.9964yesN/A
Q9GKX2DHRS4_RABIT1, ., 1, ., 1, ., 1, 8, 40.5760.32670.9576yesN/A
Q8SPU8DHRS4_BOVIN1, ., 1, ., 1, ., 1, 8, 40.5720.32670.8924yesN/A
Q8VID1DHRS4_RAT1, ., 1, ., 1, ., 1, 8, 40.5520.32670.8924yesN/A
Q9BTZ2DHRS4_HUMAN1, ., 1, ., 1, ., 1, 8, 40.5640.32670.8956yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.10.691
3rd Layer6.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query762
cd08936256 cd08936, CR_SDR_c, Porcine peroxisomal carbonyl re 1e-108
PRK07231251 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-85
cd08936256 cd08936, CR_SDR_c, Porcine peroxisomal carbonyl re 4e-84
PRK07035252 PRK07035, PRK07035, short chain dehydrogenase; Pro 1e-77
cd05233234 cd05233, SDR_c, classical (c) SDRs 5e-77
PRK05653246 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) 6e-72
COG1028251 COG1028, FabG, Dehydrogenases with different speci 2e-71
PRK05565247 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) 3e-70
PRK05557248 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-69
PTZ00419 995 PTZ00419, PTZ00419, valyl-tRNA synthetase-like pro 2e-68
PRK07231251 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-65
cd05344253 cd05344, BKR_like_SDR_like, putative beta-ketoacyl 2e-65
cd05333240 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein 1e-64
PRK12826251 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-prote 2e-64
TIGR01830239 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier 3e-64
PRK12825249 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-62
PRK12939250 PRK12939, PRK12939, short chain dehydrogenase; Pro 7e-62
cd05347248 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogena 1e-61
cd05233234 cd05233, SDR_c, classical (c) SDRs 2e-61
PRK05729 874 PRK05729, valS, valyl-tRNA synthetase; Reviewed 1e-60
cd05362243 cd05362, THN_reductase-like_SDR_c, tetrahydroxynap 5e-58
cd05358253 cd05358, GlcDH_SDR_c, glucose 1 dehydrogenase (Glc 1e-57
PRK08213259 PRK08213, PRK08213, gluconate 5-dehydrogenase; Pro 8e-57
PRK07035252 PRK07035, PRK07035, short chain dehydrogenase; Pro 2e-56
COG1028251 COG1028, FabG, Dehydrogenases with different speci 5e-56
cd05366257 cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol 9e-56
cd05369249 cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reducta 2e-55
PRK12429258 PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenas 4e-55
PRK09242257 PRK09242, PRK09242, tropinone reductase; Provision 3e-54
cd05329251 cd05329, TR_SDR_c, tropinone reductase-I and II (T 5e-54
PLN02381 1066 PLN02381, PLN02381, valyl-tRNA synthetase 5e-53
PRK05653246 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) 7e-53
PRK05565247 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-52
cd05345248 cd05345, BKR_3_SDR_c, putative beta-ketoacyl acyl 2e-52
PRK07478254 PRK07478, PRK07478, short chain dehydrogenase; Pro 2e-52
cd08944246 cd08944, SDR_c12, classical (c) SDR, subgroup 12 4e-52
PRK06138252 PRK06138, PRK06138, short chain dehydrogenase; Pro 8e-52
cd05341247 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta 1e-51
PRK08589272 PRK08589, PRK08589, short chain dehydrogenase; Val 3e-51
COG0525 877 COG0525, ValS, Valyl-tRNA synthetase [Translation, 4e-51
PRK06484 520 PRK06484, PRK06484, short chain dehydrogenase; Val 7e-51
PRK05557248 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-50
cd05359242 cd05359, ChcA_like_SDR_c, 1-cyclohexenylcarbonyl_c 8e-50
PRK12826251 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-prote 2e-49
PRK12829264 PRK12829, PRK12829, short chain dehydrogenase; Pro 2e-49
cd00817382 cd00817, ValRS_core, catalytic core domain of valy 7e-49
cd05364253 cd05364, SDR_c11, classical (c) SDR, subgroup 11 2e-48
PRK06172253 PRK06172, PRK06172, short chain dehydrogenase; Pro 3e-48
TIGR01963255 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase 2e-47
TIGR00422 861 TIGR00422, valS, valyl-tRNA synthetase 3e-47
PRK12824245 PRK12824, PRK12824, acetoacetyl-CoA reductase; Pro 6e-47
PRK08226263 PRK08226, PRK08226, short chain dehydrogenase; Pro 8e-47
cd05344253 cd05344, BKR_like_SDR_like, putative beta-ketoacyl 9e-47
PRK12939250 PRK12939, PRK12939, short chain dehydrogenase; Pro 2e-46
TIGR02415254 TIGR02415, 23BDH, acetoin reductases 2e-46
PRK08936261 PRK08936, PRK08936, glucose-1-dehydrogenase; Provi 2e-46
PRK12429258 PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenas 4e-46
cd05347248 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogena 2e-45
PRK06398258 PRK06398, PRK06398, aldose dehydrogenase; Validate 2e-45
cd05355270 cd05355, SDR_c1, classical (c) SDR, subgroup 1 4e-45
PRK06935258 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrog 4e-45
TIGR01830239 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier 8e-45
PRK07831262 PRK07831, PRK07831, short chain dehydrogenase; Pro 1e-44
cd05333240 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein 3e-44
PRK08643256 PRK08643, PRK08643, acetoin reductase; Validated 3e-44
PRK12825249 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) 4e-44
pfam00133606 pfam00133, tRNA-synt_1, tRNA synthetases class I ( 6e-44
cd05368241 cd05368, DHRS6_like_SDR_c, human DHRS6-like, class 7e-44
cd08940258 cd08940, HBDH_SDR_c, d-3-hydroxybutyrate dehydroge 8e-44
cd08942250 cd08942, RhlG_SDR_c, RhlG and related beta-ketoacy 2e-43
cd08945258 cd08945, PKR_SDR_c, Polyketide ketoreductase, clas 2e-43
cd05326249 cd05326, secoisolariciresinol-DH_like_SDR_c, secoi 3e-43
cd05362243 cd05362, THN_reductase-like_SDR_c, tetrahydroxynap 5e-43
PRK07774250 PRK07774, PRK07774, short chain dehydrogenase; Pro 5e-43
cd05352252 cd05352, MDH-like_SDR_c, mannitol dehydrogenase (M 5e-43
PRK12937245 PRK12937, PRK12937, short chain dehydrogenase; Pro 8e-43
PRK08213259 PRK08213, PRK08213, gluconate 5-dehydrogenase; Pro 1e-42
PRK06113255 PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydro 1e-42
PRK12827249 PRK12827, PRK12827, short chain dehydrogenase; Pro 2e-42
PRK06198260 PRK06198, PRK06198, short chain dehydrogenase; Pro 2e-42
PRK14900 1052 PRK14900, valS, valyl-tRNA synthetase; Provisional 4e-42
PRK06841255 PRK06841, PRK06841, short chain dehydrogenase; Pro 6e-42
PRK06171266 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydro 9e-42
PRK08063250 PRK08063, PRK08063, enoyl-(acyl carrier protein) r 1e-41
PRK06057255 PRK06057, PRK06057, short chain dehydrogenase; Pro 1e-41
PRK07067257 PRK07067, PRK07067, sorbitol dehydrogenase; Provis 1e-41
cd05365242 cd05365, 7_alpha_HSDH_SDR_c, 7 alpha-hydroxysteroi 2e-41
PRK07060245 PRK07060, PRK07060, short chain dehydrogenase; Pro 2e-41
PRK06077252 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-41
cd08930250 cd08930, SDR_c8, classical (c) SDR, subgroup 8 4e-41
cd05366257 cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol 5e-41
cd05358253 cd05358, GlcDH_SDR_c, glucose 1 dehydrogenase (Glc 1e-40
PRK07326237 PRK07326, PRK07326, short chain dehydrogenase; Pro 1e-40
PRK07478254 PRK07478, PRK07478, short chain dehydrogenase; Pro 2e-40
PRK07063260 PRK07063, PRK07063, short chain dehydrogenase; Pro 2e-40
PRK07856252 PRK07856, PRK07856, short chain dehydrogenase; Pro 2e-40
pfam13561239 pfam13561, adh_short_C2, Enoyl-(Acyl carrier prote 2e-40
PRK06138252 PRK06138, PRK06138, short chain dehydrogenase; Pro 3e-40
PRK07326237 PRK07326, PRK07326, short chain dehydrogenase; Pro 3e-40
TIGR01829242 TIGR01829, AcAcCoA_reduct, acetoacetyl-CoA reducta 3e-40
PRK08324681 PRK08324, PRK08324, short chain dehydrogenase; Val 3e-40
PRK08324681 PRK08324, PRK08324, short chain dehydrogenase; Val 3e-40
cd05324225 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicu 3e-40
PRK12745256 PRK12745, PRK12745, 3-ketoacyl-(acyl-carrier-prote 5e-40
PRK06124256 PRK06124, PRK06124, gluconate 5-dehydrogenase; Pro 7e-40
cd05324225 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicu 4e-39
cd08944246 cd08944, SDR_c12, classical (c) SDR, subgroup 12 5e-39
PRK12936245 PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-prote 5e-39
PRK08085254 PRK08085, PRK08085, gluconate 5-dehydrogenase; Pro 6e-39
PRK08277278 PRK08277, PRK08277, D-mannonate oxidoreductase; Pr 7e-39
PRK13394262 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenas 9e-39
cd08929226 cd08929, SDR_c4, classical (c) SDR, subgroup 4 9e-39
cd05345248 cd05345, BKR_3_SDR_c, putative beta-ketoacyl acyl 2e-38
TIGR01963255 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase 2e-38
cd05374248 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxyster 2e-38
cd05341247 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta 3e-38
PRK07890258 PRK07890, PRK07890, short chain dehydrogenase; Pro 3e-38
cd08929226 cd08929, SDR_c4, classical (c) SDR, subgroup 4 4e-38
cd08943250 cd08943, R1PA_ADH_SDR_c, rhamnulose-1-phosphate al 4e-38
PRK12829264 PRK12829, PRK12829, short chain dehydrogenase; Pro 5e-38
cd05369249 cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reducta 6e-38
PRK08265261 PRK08265, PRK08265, short chain dehydrogenase; Pro 7e-38
PRK12935247 PRK12935, PRK12935, acetoacetyl-CoA reductase; Pro 7e-38
cd05374248 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxyster 8e-38
PRK12828239 PRK12828, PRK12828, short chain dehydrogenase; Pro 9e-38
PRK07523255 PRK07523, PRK07523, gluconate 5-dehydrogenase; Pro 1e-37
TIGR04316250 TIGR04316, dhbA_paeA, 2,3-dihydro-2,3-dihydroxyben 1e-37
COG0300265 COG0300, DltE, Short-chain dehydrogenases of vario 2e-37
PRK06701290 PRK06701, PRK06701, short chain dehydrogenase; Pro 6e-37
PRK07677252 PRK07677, PRK07677, short chain dehydrogenase; Pro 7e-37
PRK07097265 PRK07097, PRK07097, gluconate 5-dehydrogenase; Pro 7e-37
TIGR01832248 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogena 8e-37
PRK08945247 PRK08945, PRK08945, putative oxoacyl-(acyl carrier 8e-37
PRK06550235 PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-36
PRK08220252 PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehy 1e-36
cd05329251 cd05329, TR_SDR_c, tropinone reductase-I and II (T 2e-36
cd08943250 cd08943, R1PA_ADH_SDR_c, rhamnulose-1-phosphate al 3e-36
PRK06500249 PRK06500, PRK06500, short chain dehydrogenase; Pro 3e-36
cd05337255 cd05337, BKR_1_SDR_c, putative beta-ketoacyl acyl 3e-36
PRK06463255 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) 3e-36
PLN02943 958 PLN02943, PLN02943, aminoacyl-tRNA ligase 3e-36
COG0300265 COG0300, DltE, Short-chain dehydrogenases of vario 4e-36
cd05323244 cd05323, ADH_SDR_c_like, insect type alcohol dehyd 4e-36
TIGR01831239 TIGR01831, fabG_rel, 3-oxoacyl-(acyl-carrier-prote 5e-36
PRK08589272 PRK08589, PRK08589, short chain dehydrogenase; Val 1e-35
PRK06077252 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-35
PRK08339263 PRK08339, PRK08339, short chain dehydrogenase; Pro 2e-35
PRK12748256 PRK12748, PRK12748, 3-ketoacyl-(acyl-carrier-prote 2e-35
cd05338246 cd05338, DHRS1_HSDL2-like_SDR_c, human dehydrogena 2e-35
cd08935271 cd08935, mannonate_red_SDR_c, putative D-mannonate 2e-35
PRK09242257 PRK09242, PRK09242, tropinone reductase; Provision 3e-35
cd05364253 cd05364, SDR_c11, classical (c) SDR, subgroup 11 3e-35
PRK06172253 PRK06172, PRK06172, short chain dehydrogenase; Pro 3e-35
PRK07831262 PRK07831, PRK07831, short chain dehydrogenase; Pro 3e-35
cd05323244 cd05323, ADH_SDR_c_like, insect type alcohol dehyd 3e-35
cd05338246 cd05338, DHRS1_HSDL2-like_SDR_c, human dehydrogena 3e-35
PLN02253280 PLN02253, PLN02253, xanthoxin dehydrogenase 5e-35
PRK07069251 PRK07069, PRK07069, short chain dehydrogenase; Val 6e-35
PRK06949258 PRK06949, PRK06949, short chain dehydrogenase; Pro 6e-35
PRK08993253 PRK08993, PRK08993, 2-deoxy-D-gluconate 3-dehydrog 7e-35
cd08939239 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine 8e-35
PRK08643256 PRK08643, PRK08643, acetoin reductase; Validated 9e-35
PRK06114254 PRK06114, PRK06114, short chain dehydrogenase; Pro 9e-35
PRK09135249 PRK09135, PRK09135, pteridine reductase; Provision 9e-35
TIGR02415254 TIGR02415, 23BDH, acetoin reductases 1e-34
PRK08945247 PRK08945, PRK08945, putative oxoacyl-(acyl carrier 1e-34
cd08940258 cd08940, HBDH_SDR_c, d-3-hydroxybutyrate dehydroge 2e-34
PRK12743256 PRK12743, PRK12743, oxidoreductase; Provisional 2e-34
PRK07666239 PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-34
cd05349246 cd05349, BKR_2_SDR_c, putative beta-ketoacyl acyl 2e-34
PRK06523260 PRK06523, PRK06523, short chain dehydrogenase; Pro 3e-34
cd05357234 cd05357, PR_SDR_c, pteridine reductase (PR), class 4e-34
PRK07062265 PRK07062, PRK07062, short chain dehydrogenase; Pro 4e-34
PRK07814263 PRK07814, PRK07814, short chain dehydrogenase; Pro 4e-34
COG4221246 COG4221, COG4221, Short-chain alcohol dehydrogenas 4e-34
PRK12823260 PRK12823, benD, 1,6-dihydroxycyclohexa-2,4-diene-1 4e-34
cd08939239 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine 5e-34
PRK07666239 PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) 5e-34
PRK12481251 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrog 5e-34
PRK07576264 PRK07576, PRK07576, short chain dehydrogenase; Pro 6e-34
PRK06398258 PRK06398, PRK06398, aldose dehydrogenase; Validate 8e-34
PRK06935258 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrog 8e-34
PRK06484520 PRK06484, PRK06484, short chain dehydrogenase; Val 9e-34
PRK13394262 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenas 9e-34
COG4221246 COG4221, COG4221, Short-chain alcohol dehydrogenas 1e-33
cd08933261 cd08933, RDH_SDR_c, retinal dehydrogenase-like, cl 1e-33
TIGR03971265 TIGR03971, SDR_subfam_1, oxidoreductase, SDR famil 1e-33
PRK12384259 PRK12384, PRK12384, sorbitol-6-phosphate dehydroge 1e-33
cd05359242 cd05359, ChcA_like_SDR_c, 1-cyclohexenylcarbonyl_c 2e-33
cd05326249 cd05326, secoisolariciresinol-DH_like_SDR_c, secoi 2e-33
PRK06123248 PRK06123, PRK06123, short chain dehydrogenase; Pro 2e-33
PRK08226263 PRK08226, PRK08226, short chain dehydrogenase; Pro 4e-33
PRK12937245 PRK12937, PRK12937, short chain dehydrogenase; Pro 4e-33
PRK12824245 PRK12824, PRK12824, acetoacetyl-CoA reductase; Pro 6e-33
PRK06171266 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydro 6e-33
cd05340236 cd05340, Ycik_SDR_c, Escherichia coli K-12 YCIK-li 6e-33
PRK06128300 PRK06128, PRK06128, oxidoreductase; Provisional 6e-33
PRK12859256 PRK12859, PRK12859, 3-ketoacyl-(acyl-carrier-prote 6e-33
PRK08936261 PRK08936, PRK08936, glucose-1-dehydrogenase; Provi 8e-33
cd08937256 cd08937, DHB_DH-like_SDR_c, 1,6-dihydroxycyclohexa 8e-33
PRK06125259 PRK06125, PRK06125, short chain dehydrogenase; Pro 9e-33
PRK06198260 PRK06198, PRK06198, short chain dehydrogenase; Pro 1e-32
PRK07067257 PRK07067, PRK07067, sorbitol dehydrogenase; Provis 1e-32
cd05343250 cd05343, Mgc4172-like_SDR_c, human Mgc4172-like, c 1e-32
cd05343250 cd05343, Mgc4172-like_SDR_c, human Mgc4172-like, c 1e-32
PRK06841255 PRK06841, PRK06841, short chain dehydrogenase; Pro 2e-32
cd05363254 cd05363, SDH_SDR_c, Sorbitol dehydrogenase (SDH), 2e-32
cd05351244 cd05351, XR_like_SDR_c, xylulose reductase-like, c 2e-32
PRK05867253 PRK05867, PRK05867, short chain dehydrogenase; Pro 2e-32
cd08932223 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like 2e-32
cd05368241 cd05368, DHRS6_like_SDR_c, human DHRS6-like, class 3e-32
cd05332257 cd05332, 11beta-HSD1_like_SDR_c, 11beta-hydroxyste 3e-32
PRK07774250 PRK07774, PRK07774, short chain dehydrogenase; Pro 4e-32
PRK07063260 PRK07063, PRK07063, short chain dehydrogenase; Pro 5e-32
PRK06113255 PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydro 6e-32
cd09761242 cd09761, A3DFK9-like_SDR_c, Clostridium thermocell 6e-32
cd05361242 cd05361, haloalcohol_DH_SDR_c-like, haloalcohol de 6e-32
cd08945258 cd08945, PKR_SDR_c, Polyketide ketoreductase, clas 1e-31
cd05352252 cd05352, MDH-like_SDR_c, mannitol dehydrogenase (M 1e-31
cd05372250 cd05372, ENR_SDR, Enoyl acyl carrier protein (ACP) 1e-31
PRK08217253 PRK08217, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-31
cd05365242 cd05365, 7_alpha_HSDH_SDR_c, 7 alpha-hydroxysteroi 3e-31
cd08930250 cd08930, SDR_c8, classical (c) SDR, subgroup 8 3e-31
PRK08063250 PRK08063, PRK08063, enoyl-(acyl carrier protein) r 4e-31
cd05332257 cd05332, 11beta-HSD1_like_SDR_c, 11beta-hydroxyste 4e-31
PRK08642253 PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) 4e-31
PRK07454241 PRK07454, PRK07454, short chain dehydrogenase; Pro 5e-31
cd05355270 cd05355, SDR_c1, classical (c) SDR, subgroup 1 6e-31
PRK07890258 PRK07890, PRK07890, short chain dehydrogenase; Pro 6e-31
PRK05875276 PRK05875, PRK05875, short chain dehydrogenase; Pro 7e-31
cd08934243 cd08934, CAD_SDR_c, clavulanic acid dehydrogenase 7e-31
cd08934243 cd08934, CAD_SDR_c, clavulanic acid dehydrogenase 8e-31
cd05331244 cd05331, DH-DHB-DH_SDR_c, 2,3 dihydro-2,3 dihydroz 8e-31
PRK07454241 PRK07454, PRK07454, short chain dehydrogenase; Pro 9e-31
PRK08085254 PRK08085, PRK08085, gluconate 5-dehydrogenase; Pro 1e-30
cd05339243 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hy 1e-30
PRK07523255 PRK07523, PRK07523, gluconate 5-dehydrogenase; Pro 2e-30
cd05340236 cd05340, Ycik_SDR_c, Escherichia coli K-12 YCIK-li 2e-30
PRK12746254 PRK12746, PRK12746, short chain dehydrogenase; Pro 2e-30
cd05339243 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hy 3e-30
TIGR03206250 TIGR03206, benzo_BadH, 2-hydroxycyclohexanecarboxy 3e-30
PRK12935247 PRK12935, PRK12935, acetoacetyl-CoA reductase; Pro 4e-30
PRK06200263 PRK06200, PRK06200, 2,3-dihydroxy-2,3-dihydropheny 4e-30
PRK06181263 PRK06181, PRK06181, short chain dehydrogenase; Pro 5e-30
PRK07097265 PRK07097, PRK07097, gluconate 5-dehydrogenase; Pro 7e-30
cd08942250 cd08942, RhlG_SDR_c, RhlG and related beta-ketoacy 1e-29
PRK12936245 PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-prote 1e-29
PLN02253280 PLN02253, PLN02253, xanthoxin dehydrogenase 1e-29
PRK06181263 PRK06181, PRK06181, short chain dehydrogenase; Pro 1e-29
PRK12828239 PRK12828, PRK12828, short chain dehydrogenase; Pro 2e-29
cd08932223 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like 2e-29
cd05353250 cd05353, hydroxyacyl-CoA-like_DH_SDR_c-like, (3R)- 2e-29
cd05330257 cd05330, cyclohexanol_reductase_SDR_c, cyclohexano 3e-29
PRK12827249 PRK12827, PRK12827, short chain dehydrogenase; Pro 5e-29
PRK12745256 PRK12745, PRK12745, 3-ketoacyl-(acyl-carrier-prote 5e-29
TIGR04316250 TIGR04316, dhbA_paeA, 2,3-dihydro-2,3-dihydroxyben 7e-29
PRK07985294 PRK07985, PRK07985, oxidoreductase; Provisional 1e-28
PRK07825273 PRK07825, PRK07825, short chain dehydrogenase; Pro 1e-28
PRK06550235 PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-28
PRK07074257 PRK07074, PRK07074, short chain dehydrogenase; Pro 2e-28
PRK08628258 PRK08628, PRK08628, short chain dehydrogenase; Pro 2e-28
PRK08340259 PRK08340, PRK08340, glucose-1-dehydrogenase; Provi 2e-28
PRK06947248 PRK06947, PRK06947, glucose-1-dehydrogenase; Provi 2e-28
cd05337255 cd05337, BKR_1_SDR_c, putative beta-ketoacyl acyl 3e-28
cd05356239 cd05356, 17beta-HSD1_like_SDR_c, 17-beta-hydroxyst 3e-28
PRK06057255 PRK06057, PRK06057, short chain dehydrogenase; Pro 4e-28
PRK06484520 PRK06484, PRK06484, short chain dehydrogenase; Val 6e-28
cd05327269 cd05327, retinol-DH_like_SDR_c_like, retinol dehyd 6e-28
cd05353250 cd05353, hydroxyacyl-CoA-like_DH_SDR_c-like, (3R)- 7e-28
PRK08277278 PRK08277, PRK08277, D-mannonate oxidoreductase; Pr 8e-28
PRK07825273 PRK07825, PRK07825, short chain dehydrogenase; Pro 8e-28
cd05356239 cd05356, 17beta-HSD1_like_SDR_c, 17-beta-hydroxyst 9e-28
PRK12747252 PRK12747, PRK12747, short chain dehydrogenase; Pro 9e-28
PRK08220252 PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehy 1e-27
cd05327269 cd05327, retinol-DH_like_SDR_c_like, retinol dehyd 1e-27
cd05346249 cd05346, SDR_c5, classical (c) SDR, subgroup 5 1e-27
cd05346249 cd05346, SDR_c5, classical (c) SDR, subgroup 5 1e-27
cd05348257 cd05348, BphB-like_SDR_c, cis-biphenyl-2,3-dihydro 1e-27
cd08933261 cd08933, RDH_SDR_c, retinal dehydrogenase-like, cl 2e-27
PRK09135249 PRK09135, PRK09135, pteridine reductase; Provision 3e-27
cd05357234 cd05357, PR_SDR_c, pteridine reductase (PR), class 3e-27
cd05371252 cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydr 3e-27
pfam13561239 pfam13561, adh_short_C2, Enoyl-(Acyl carrier prote 4e-27
PRK07060245 PRK07060, PRK07060, short chain dehydrogenase; Pro 5e-27
PRK05717255 PRK05717, PRK05717, oxidoreductase; Validated 5e-27
PRK06180277 PRK06180, PRK06180, short chain dehydrogenase; Pro 5e-27
PRK12384259 PRK12384, PRK12384, sorbitol-6-phosphate dehydroge 9e-27
cd05322257 cd05322, SDH_SDR_c_like, Sorbitol 6-phosphate dehy 1e-26
pfam00106167 pfam00106, adh_short, short chain dehydrogenase 1e-26
pfam00106167 pfam00106, adh_short, short chain dehydrogenase 1e-26
PRK08278273 PRK08278, PRK08278, short chain dehydrogenase; Pro 1e-26
TIGR01832248 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogena 2e-26
PRK07062265 PRK07062, PRK07062, short chain dehydrogenase; Pro 4e-26
PRK06500249 PRK06500, PRK06500, short chain dehydrogenase; Pro 5e-26
PRK06180277 PRK06180, PRK06180, short chain dehydrogenase; Pro 5e-26
PRK05876275 PRK05876, PRK05876, short chain dehydrogenase; Pro 5e-26
cd05351244 cd05351, XR_like_SDR_c, xylulose reductase-like, c 6e-26
PRK05876275 PRK05876, PRK05876, short chain dehydrogenase; Pro 6e-26
PRK06179270 PRK06179, PRK06179, short chain dehydrogenase; Pro 7e-26
PRK08265261 PRK08265, PRK08265, short chain dehydrogenase; Pro 1e-25
PRK06179270 PRK06179, PRK06179, short chain dehydrogenase; Pro 1e-25
TIGR02632676 TIGR02632, RhaD_aldol-ADH, rhamnulose-1-phosphate 1e-25
PRK06949258 PRK06949, PRK06949, short chain dehydrogenase; Pro 2e-25
TIGR03971265 TIGR03971, SDR_subfam_1, oxidoreductase, SDR famil 2e-25
PRK09730247 PRK09730, PRK09730, putative NAD(P)-binding oxidor 2e-25
TIGR03325262 TIGR03325, BphB_TodD, cis-2,3-dihydrobiphenyl-2,3- 2e-25
PRK07814263 PRK07814, PRK07814, short chain dehydrogenase; Pro 3e-25
PRK06200263 PRK06200, PRK06200, 2,3-dihydroxy-2,3-dihydropheny 3e-25
TIGR01829242 TIGR01829, AcAcCoA_reduct, acetoacetyl-CoA reducta 4e-25
PRK07577234 PRK07577, PRK07577, short chain dehydrogenase; Pro 4e-25
PRK08416260 PRK08416, PRK08416, 7-alpha-hydroxysteroid dehydro 5e-25
PRK07856252 PRK07856, PRK07856, short chain dehydrogenase; Pro 6e-25
cd08935271 cd08935, mannonate_red_SDR_c, putative D-mannonate 6e-25
PRK08278273 PRK08278, PRK08278, short chain dehydrogenase; Pro 6e-25
PRK09186256 PRK09186, PRK09186, flagellin modification protein 7e-25
COG0623259 COG0623, FabI, Enoyl-[acyl-carrier-protein] 8e-25
PRK08261450 PRK08261, fabG, 3-ketoacyl-(acyl-carrier-protein) 8e-25
PRK06701290 PRK06701, PRK06701, short chain dehydrogenase; Pro 1e-24
cd05349246 cd05349, BKR_2_SDR_c, putative beta-ketoacyl acyl 1e-24
cd05360233 cd05360, SDR_c3, classical (c) SDR, subgroup 3 1e-24
cd09763265 cd09763, DHRS1-like_SDR_c, human dehydrogenase/red 1e-24
PRK08993253 PRK08993, PRK08993, 2-deoxy-D-gluconate 3-dehydrog 2e-24
cd05360233 cd05360, SDR_c3, classical (c) SDR, subgroup 3 2e-24
PRK09072263 PRK09072, PRK09072, short chain dehydrogenase; Pro 3e-24
PRK06463255 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) 4e-24
PRK07069251 PRK07069, PRK07069, short chain dehydrogenase; Val 4e-24
PRK12823260 PRK12823, benD, 1,6-dihydroxycyclohexa-2,4-diene-1 4e-24
PRK06124256 PRK06124, PRK06124, gluconate 5-dehydrogenase; Pro 5e-24
cd05348257 cd05348, BphB-like_SDR_c, cis-biphenyl-2,3-dihydro 5e-24
cd05370228 cd05370, SDR_c2, classical (c) SDR, subgroup 2 5e-24
cd05363254 cd05363, SDH_SDR_c, Sorbitol dehydrogenase (SDH), 7e-24
cd05328250 cd05328, 3alpha_HSD_SDR_c, alpha hydroxysteroid de 7e-24
PRK12938246 PRK12938, PRK12938, acetyacetyl-CoA reductase; Pro 9e-24
PRK12481251 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrog 1e-23
PRK09072263 PRK09072, PRK09072, short chain dehydrogenase; Pro 1e-23
PRK08263275 PRK08263, PRK08263, short chain dehydrogenase; Pro 1e-23
PRK08339263 PRK08339, PRK08339, short chain dehydrogenase; Pro 2e-23
PRK06114254 PRK06114, PRK06114, short chain dehydrogenase; Pro 2e-23
PRK06123248 PRK06123, PRK06123, short chain dehydrogenase; Pro 2e-23
PRK08261450 PRK08261, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-23
PRK06182273 PRK06182, PRK06182, short chain dehydrogenase; Val 2e-23
PRK06182273 PRK06182, PRK06182, short chain dehydrogenase; Val 2e-23
PRK12748256 PRK12748, PRK12748, 3-ketoacyl-(acyl-carrier-prote 3e-23
PRK05650270 PRK05650, PRK05650, short chain dehydrogenase; Pro 3e-23
PRK08217253 PRK08217, fabG, 3-ketoacyl-(acyl-carrier-protein) 4e-23
cd05370228 cd05370, SDR_c2, classical (c) SDR, subgroup 2 4e-23
PRK05650270 PRK05650, PRK05650, short chain dehydrogenase; Pro 4e-23
PRK12742237 PRK12742, PRK12742, oxidoreductase; Provisional 4e-23
cd05350239 cd05350, SDR_c6, classical (c) SDR, subgroup 6 4e-23
PRK07074257 PRK07074, PRK07074, short chain dehydrogenase; Pro 5e-23
TIGR02632676 TIGR02632, RhaD_aldol-ADH, rhamnulose-1-phosphate 5e-23
PRK06128300 PRK06128, PRK06128, oxidoreductase; Provisional 6e-23
PRK05786238 PRK05786, fabG, 3-ketoacyl-(acyl-carrier-protein) 7e-23
cd05350239 cd05350, SDR_c6, classical (c) SDR, subgroup 6 8e-23
cd05325233 cd05325, carb_red_sniffer_like_SDR_c, carbonyl red 8e-23
cd08936 256 cd08936, CR_SDR_c, Porcine peroxisomal carbonyl re 1e-22
PRK06484520 PRK06484, PRK06484, short chain dehydrogenase; Val 1e-22
PRK08263275 PRK08263, PRK08263, short chain dehydrogenase; Pro 1e-22
PRK06523260 PRK06523, PRK06523, short chain dehydrogenase; Pro 2e-22
cd08937256 cd08937, DHB_DH-like_SDR_c, 1,6-dihydroxycyclohexa 2e-22
cd05371252 cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydr 2e-22
TIGR03325262 TIGR03325, BphB_TodD, cis-2,3-dihydrobiphenyl-2,3- 2e-22
cd05373238 cd05373, SDR_c10, classical (c) SDR, subgroup 10 2e-22
PRK05993277 PRK05993, PRK05993, short chain dehydrogenase; Pro 2e-22
cd05373238 cd05373, SDR_c10, classical (c) SDR, subgroup 10 3e-22
PRK07109334 PRK07109, PRK07109, short chain dehydrogenase; Pro 3e-22
cd09763265 cd09763, DHRS1-like_SDR_c, human dehydrogenase/red 4e-22
PRK05993277 PRK05993, PRK05993, short chain dehydrogenase; Pro 4e-22
cd05325233 cd05325, carb_red_sniffer_like_SDR_c, carbonyl red 6e-22
PRK08628258 PRK08628, PRK08628, short chain dehydrogenase; Pro 1e-21
cd05354235 cd05354, SDR_c7, classical (c) SDR, subgroup 7 1e-21
cd05354235 cd05354, SDR_c7, classical (c) SDR, subgroup 7 1e-21
TIGR01831239 TIGR01831, fabG_rel, 3-oxoacyl-(acyl-carrier-prote 2e-21
PRK12859256 PRK12859, PRK12859, 3-ketoacyl-(acyl-carrier-prote 2e-21
PRK08642253 PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-21
cd05331244 cd05331, DH-DHB-DH_SDR_c, 2,3 dihydro-2,3 dihydroz 2e-21
cd05322257 cd05322, SDH_SDR_c_like, Sorbitol 6-phosphate dehy 2e-21
PRK07109334 PRK07109, PRK07109, short chain dehydrogenase; Pro 2e-21
cd00668312 cd00668, Ile_Leu_Val_MetRS_core, catalytic core do 2e-21
PRK12428241 PRK12428, PRK12428, 3-alpha-hydroxysteroid dehydro 3e-21
PRK06914280 PRK06914, PRK06914, short chain dehydrogenase; Pro 3e-21
PRK06914280 PRK06914, PRK06914, short chain dehydrogenase; Pro 6e-21
PRK09186256 PRK09186, PRK09186, flagellin modification protein 7e-21
PRK05867253 PRK05867, PRK05867, short chain dehydrogenase; Pro 8e-21
PRK07985294 PRK07985, PRK07985, oxidoreductase; Provisional 8e-21
PRK06194287 PRK06194, PRK06194, hypothetical protein; Provisio 8e-21
PRK06194287 PRK06194, PRK06194, hypothetical protein; Provisio 8e-21
PRK12743256 PRK12743, PRK12743, oxidoreductase; Provisional 1e-20
PRK12746254 PRK12746, PRK12746, short chain dehydrogenase; Pro 1e-20
PRK07576264 PRK07576, PRK07576, short chain dehydrogenase; Pro 2e-20
cd09761242 cd09761, A3DFK9-like_SDR_c, Clostridium thermocell 2e-20
PRK05875276 PRK05875, PRK05875, short chain dehydrogenase; Pro 2e-20
PRK06947248 PRK06947, PRK06947, glucose-1-dehydrogenase; Provi 4e-20
PRK07533258 PRK07533, PRK07533, enoyl-(acyl carrier protein) r 4e-20
PRK08415274 PRK08415, PRK08415, enoyl-(acyl carrier protein) r 4e-20
cd05372250 cd05372, ENR_SDR, Enoyl acyl carrier protein (ACP) 5e-20
PRK05693274 PRK05693, PRK05693, short chain dehydrogenase; Pro 5e-20
PRK08264238 PRK08264, PRK08264, short chain dehydrogenase; Val 5e-20
PRK12747252 PRK12747, PRK12747, short chain dehydrogenase; Pro 6e-20
PRK05693274 PRK05693, PRK05693, short chain dehydrogenase; Pro 6e-20
PRK08264238 PRK08264, PRK08264, short chain dehydrogenase; Val 7e-20
PRK07231 251 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-19
PRK05855582 PRK05855, PRK05855, short chain dehydrogenase; Val 1e-19
cd05233234 cd05233, SDR_c, classical (c) SDRs 2e-19
COG3967245 COG3967, DltE, Short-chain dehydrogenase involved 2e-19
PRK06125259 PRK06125, PRK06125, short chain dehydrogenase; Pro 3e-19
PRK05786238 PRK05786, fabG, 3-ketoacyl-(acyl-carrier-protein) 3e-19
PRK06940275 PRK06940, PRK06940, short chain dehydrogenase; Pro 3e-19
PRK05717255 PRK05717, PRK05717, oxidoreductase; Validated 5e-19
PRK05855582 PRK05855, PRK05855, short chain dehydrogenase; Val 5e-19
cd09762243 cd09762, HSDL2_SDR_c, human hydroxysteroid dehydro 6e-19
PRK05872296 PRK05872, PRK05872, short chain dehydrogenase; Pro 6e-19
PRK08703239 PRK08703, PRK08703, short chain dehydrogenase; Pro 7e-19
PRK12742237 PRK12742, PRK12742, oxidoreductase; Provisional 9e-19
PRK08340259 PRK08340, PRK08340, glucose-1-dehydrogenase; Provi 1e-18
cd09762243 cd09762, HSDL2_SDR_c, human hydroxysteroid dehydro 1e-18
PRK05872296 PRK05872, PRK05872, short chain dehydrogenase; Pro 1e-18
PRK09291257 PRK09291, PRK09291, short chain dehydrogenase; Pro 1e-18
TIGR02685267 TIGR02685, pter_reduc_Leis, pteridine reductase 1e-18
PRK08703239 PRK08703, PRK08703, short chain dehydrogenase; Pro 2e-18
PRK12744257 PRK12744, PRK12744, short chain dehydrogenase; Pro 2e-18
PRK07792306 PRK07792, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-18
cd05330257 cd05330, cyclohexanol_reductase_SDR_c, cyclohexano 5e-18
PRK09291257 PRK09291, PRK09291, short chain dehydrogenase; Pro 5e-18
PRK09134258 PRK09134, PRK09134, short chain dehydrogenase; Pro 5e-18
cd05367241 cd05367, SPR-like_SDR_c, sepiapterin reductase (SP 5e-18
PRK07677252 PRK07677, PRK07677, short chain dehydrogenase; Pro 7e-18
COG3967245 COG3967, DltE, Short-chain dehydrogenase involved 8e-18
cd05367241 cd05367, SPR-like_SDR_c, sepiapterin reductase (SP 8e-18
PRK08594257 PRK08594, PRK08594, enoyl-(acyl carrier protein) r 2e-17
PRK07370258 PRK07370, PRK07370, enoyl-(acyl carrier protein) r 5e-17
TIGR03206250 TIGR03206, benzo_BadH, 2-hydroxycyclohexanecarboxy 7e-17
cd05361242 cd05361, haloalcohol_DH_SDR_c-like, haloalcohol de 8e-17
PRK07791286 PRK07791, PRK07791, short chain dehydrogenase; Pro 9e-17
PRK13208 800 PRK13208, valS, valyl-tRNA synthetase; Reviewed 1e-16
PRK08219227 PRK08219, PRK08219, short chain dehydrogenase; Pro 1e-16
COG0623259 COG0623, FabI, Enoyl-[acyl-carrier-protein] 2e-16
PRK05565247 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) 3e-16
PRK08219227 PRK08219, PRK08219, short chain dehydrogenase; Pro 3e-16
PRK05653246 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) 5e-16
PRK07832272 PRK07832, PRK07832, short chain dehydrogenase; Pro 6e-16
PRK07201657 PRK07201, PRK07201, short chain dehydrogenase; Pro 8e-16
PRK07041230 PRK07041, PRK07041, short chain dehydrogenase; Pro 9e-16
PRK05866293 PRK05866, PRK05866, short chain dehydrogenase; Pro 9e-16
PRK06482276 PRK06482, PRK06482, short chain dehydrogenase; Pro 9e-16
PRK12938246 PRK12938, PRK12938, acetyacetyl-CoA reductase; Pro 1e-15
PRK12826 251 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-prote 2e-15
PRK08415274 PRK08415, PRK08415, enoyl-(acyl carrier protein) r 2e-15
PRK07201657 PRK07201, PRK07201, short chain dehydrogenase; Pro 2e-15
PRK06482276 PRK06482, PRK06482, short chain dehydrogenase; Pro 2e-15
PRK12744257 PRK12744, PRK12744, short chain dehydrogenase; Pro 3e-15
PRK07832272 PRK07832, PRK07832, short chain dehydrogenase; Pro 3e-15
PRK05866293 PRK05866, PRK05866, short chain dehydrogenase; Pro 6e-15
cd08931227 cd08931, SDR_c9, classical (c) SDR, subgroup 9 7e-15
cd09806258 cd09806, type1_17beta-HSD-like_SDR_c, human estrog 9e-15
cd09806258 cd09806, type1_17beta-HSD-like_SDR_c, human estrog 1e-14
cd08931227 cd08931, SDR_c9, classical (c) SDR, subgroup 9 2e-14
cd08936256 cd08936, CR_SDR_c, Porcine peroxisomal carbonyl re 3e-14
PRK09730247 PRK09730, PRK09730, putative NAD(P)-binding oxidor 3e-14
cd11731198 cd11731, Lin1944_like_SDR_c, Lin1944 and related p 3e-14
PRK07806248 PRK07806, PRK07806, short chain dehydrogenase; Pro 5e-14
PRK05557248 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) 6e-14
PRK12825249 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) 6e-14
cd11731198 cd11731, Lin1944_like_SDR_c, Lin1944 and related p 6e-14
PRK06139330 PRK06139, PRK06139, short chain dehydrogenase; Pro 7e-14
PRK06139330 PRK06139, PRK06139, short chain dehydrogenase; Pro 8e-14
PRK07806248 PRK07806, PRK07806, short chain dehydrogenase; Pro 9e-14
cd05345 248 cd05345, BKR_3_SDR_c, putative beta-ketoacyl acyl 1e-13
PRK07041230 PRK07041, PRK07041, short chain dehydrogenase; Pro 1e-13
PRK08159272 PRK08159, PRK08159, enoyl-(acyl carrier protein) r 1e-13
TIGR00392 861 TIGR00392, ileS, isoleucyl-tRNA synthetase 1e-13
PRK08690261 PRK08690, PRK08690, enoyl-(acyl carrier protein) r 1e-13
PRK07792306 PRK07792, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-13
TIGR01830239 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier 3e-13
PRK06079252 PRK06079, PRK06079, enoyl-(acyl carrier protein) r 4e-13
cd09805281 cd09805, type2_17beta_HSD-like_SDR_c, human 17beta 6e-13
cd09805281 cd09805, type2_17beta_HSD-like_SDR_c, human 17beta 7e-13
PRK07775274 PRK07775, PRK07775, short chain dehydrogenase; Pro 7e-13
COG0060 933 COG0060, IleS, Isoleucyl-tRNA synthetase [Translat 9e-13
PRK12429 258 PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenas 1e-12
cd02266186 cd02266, SDR, Short-chain dehydrogenases/reductase 1e-12
COG1028251 COG1028, FabG, Dehydrogenases with different speci 2e-12
cd05344 253 cd05344, BKR_like_SDR_like, putative beta-ketoacyl 2e-12
PRK12939250 PRK12939, PRK12939, short chain dehydrogenase; Pro 2e-12
PRK08324 681 PRK08324, PRK08324, short chain dehydrogenase; Val 2e-12
PRK09134258 PRK09134, PRK09134, short chain dehydrogenase; Pro 2e-12
PRK07791286 PRK07791, PRK07791, short chain dehydrogenase; Pro 2e-12
PRK07035252 PRK07035, PRK07035, short chain dehydrogenase; Pro 3e-12
PRK08416260 PRK08416, PRK08416, 7-alpha-hydroxysteroid dehydro 3e-12
PRK06550235 PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) 4e-12
PRK07775274 PRK07775, PRK07775, short chain dehydrogenase; Pro 4e-12
PRK07577234 PRK07577, PRK07577, short chain dehydrogenase; Pro 8e-12
PRK06940275 PRK06940, PRK06940, short chain dehydrogenase; Pro 8e-12
PRK08267260 PRK08267, PRK08267, short chain dehydrogenase; Pro 8e-12
cd05333240 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein 1e-11
TIGR01963 255 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase 1e-11
cd05374 248 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxyster 1e-11
cd09807274 cd09807, retinol-DH_like_SDR_c, retinol dehydrogen 1e-11
cd09807274 cd09807, retinol-DH_like_SDR_c, retinol dehydrogen 1e-11
cd09809284 cd09809, human_WWOX_like_SDR_c-like, human WWOX (W 1e-11
cd09809284 cd09809, human_WWOX_like_SDR_c-like, human WWOX (W 1e-11
cd00818338 cd00818, IleRS_core, catalytic core domain of isol 1e-11
cd05359242 cd05359, ChcA_like_SDR_c, 1-cyclohexenylcarbonyl_c 2e-11
cd08943 250 cd08943, R1PA_ADH_SDR_c, rhamnulose-1-phosphate al 2e-11
cd02266186 cd02266, SDR, Short-chain dehydrogenases/reductase 2e-11
PRK06603260 PRK06603, PRK06603, enoyl-(acyl carrier protein) r 2e-11
PRK07454241 PRK07454, PRK07454, short chain dehydrogenase; Pro 3e-11
TIGR02685267 TIGR02685, pter_reduc_Leis, pteridine reductase 3e-11
PRK08594257 PRK08594, PRK08594, enoyl-(acyl carrier protein) r 3e-11
cd05332 257 cd05332, 11beta-HSD1_like_SDR_c, 11beta-hydroxyste 4e-11
PRK08267260 PRK08267, PRK08267, short chain dehydrogenase; Pro 4e-11
cd08944 246 cd08944, SDR_c12, classical (c) SDR, subgroup 12 7e-11
cd05355270 cd05355, SDR_c1, classical (c) SDR, subgroup 1 7e-11
PRK06171 266 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydro 7e-11
cd08932223 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like 8e-11
PRK06841255 PRK06841, PRK06841, short chain dehydrogenase; Pro 1e-10
PRK07067 257 PRK07067, PRK07067, sorbitol dehydrogenase; Provis 1e-10
cd08930250 cd08930, SDR_c8, classical (c) SDR, subgroup 8 1e-10
PRK10538248 PRK10538, PRK10538, malonic semialdehyde reductase 1e-10
PRK10538248 PRK10538, PRK10538, malonic semialdehyde reductase 1e-10
PLN02780320 PLN02780, PLN02780, ketoreductase/ oxidoreductase 1e-10
PRK06924251 PRK06924, PRK06924, short chain dehydrogenase; Pro 1e-10
PRK06398 258 PRK06398, PRK06398, aldose dehydrogenase; Validate 2e-10
COG4221246 COG4221, COG4221, Short-chain alcohol dehydrogenas 2e-10
PRK07024257 PRK07024, PRK07024, short chain dehydrogenase; Pro 2e-10
PRK08017256 PRK08017, PRK08017, oxidoreductase; Provisional 2e-10
PRK06039 975 PRK06039, ileS, isoleucyl-tRNA synthetase; Reviewe 2e-10
cd05353250 cd05353, hydroxyacyl-CoA-like_DH_SDR_c-like, (3R)- 3e-10
PRK07370258 PRK07370, PRK07370, enoyl-(acyl carrier protein) r 3e-10
PLN02780320 PLN02780, PLN02780, ketoreductase/ oxidoreductase 3e-10
PRK08017256 PRK08017, PRK08017, oxidoreductase; Provisional 3e-10
PLN02730303 PLN02730, PLN02730, enoyl-[acyl-carrier-protein] r 5e-10
PRK07024257 PRK07024, PRK07024, short chain dehydrogenase; Pro 7e-10
PRK08213 259 PRK08213, PRK08213, gluconate 5-dehydrogenase; Pro 9e-10
cd05233234 cd05233, SDR_c, classical (c) SDRs 1e-09
COG1028251 COG1028, FabG, Dehydrogenases with different speci 1e-09
cd05347248 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogena 1e-09
PRK07478 254 PRK07478, PRK07478, short chain dehydrogenase; Pro 1e-09
PRK08063 250 PRK08063, PRK08063, enoyl-(acyl carrier protein) r 1e-09
cd05339243 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hy 1e-09
PRK07231251 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-09
PRK12825249 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-09
PRK06138 252 PRK06138, PRK06138, short chain dehydrogenase; Pro 2e-09
cd05341 247 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta 2e-09
PRK07063 260 PRK07063, PRK07063, short chain dehydrogenase; Pro 2e-09
PRK06924251 PRK06924, PRK06924, short chain dehydrogenase; Pro 2e-09
PRK05854313 PRK05854, PRK05854, short chain dehydrogenase; Pro 2e-09
cd08951260 cd08951, DR_C-13_KR_SDR_c_like, daunorubicin C-13 2e-09
PRK07035252 PRK07035, PRK07035, short chain dehydrogenase; Pro 3e-09
cd05362243 cd05362, THN_reductase-like_SDR_c, tetrahydroxynap 3e-09
PRK07069 251 PRK07069, PRK07069, short chain dehydrogenase; Val 3e-09
cd08951260 cd08951, DR_C-13_KR_SDR_c_like, daunorubicin C-13 3e-09
cd05334221 cd05334, DHPR_SDR_c_like, dihydropteridine reducta 3e-09
cd05328250 cd05328, 3alpha_HSD_SDR_c, alpha hydroxysteroid de 4e-09
PRK08159272 PRK08159, PRK08159, enoyl-(acyl carrier protein) r 4e-09
cd05358 253 cd05358, GlcDH_SDR_c, glucose 1 dehydrogenase (Glc 5e-09
PRK06935258 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrog 5e-09
PRK06483236 PRK06483, PRK06483, dihydromonapterin reductase; P 5e-09
cd05323244 cd05323, ADH_SDR_c_like, insect type alcohol dehyd 6e-09
PRK06505271 PRK06505, PRK06505, enoyl-(acyl carrier protein) r 6e-09
PRK12829 264 PRK12829, PRK12829, short chain dehydrogenase; Pro 8e-09
PRK06057 255 PRK06057, PRK06057, short chain dehydrogenase; Pro 8e-09
PRK12827249 PRK12827, PRK12827, short chain dehydrogenase; Pro 9e-09
PRK06300299 PRK06300, PRK06300, enoyl-(acyl carrier protein) r 9e-09
PRK06172 253 PRK06172, PRK06172, short chain dehydrogenase; Pro 1e-08
PRK12824245 PRK12824, PRK12824, acetoacetyl-CoA reductase; Pro 1e-08
PRK13394 262 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenas 1e-08
PRK06179 270 PRK06179, PRK06179, short chain dehydrogenase; Pro 1e-08
cd05325233 cd05325, carb_red_sniffer_like_SDR_c, carbonyl red 1e-08
PRK06914 280 PRK06914, PRK06914, short chain dehydrogenase; Pro 1e-08
PRK07533258 PRK07533, PRK07533, enoyl-(acyl carrier protein) r 1e-08
PRK06196315 PRK06196, PRK06196, oxidoreductase; Provisional 1e-08
PRK05557248 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-08
cd05368 241 cd05368, DHRS6_like_SDR_c, human DHRS6-like, class 2e-08
cd08940 258 cd08940, HBDH_SDR_c, d-3-hydroxybutyrate dehydroge 2e-08
PRK08945247 PRK08945, PRK08945, putative oxoacyl-(acyl carrier 2e-08
PRK12428241 PRK12428, PRK12428, 3-alpha-hydroxysteroid dehydro 2e-08
PRK06483236 PRK06483, PRK06483, dihydromonapterin reductase; P 2e-08
PRK08226 263 PRK08226, PRK08226, short chain dehydrogenase; Pro 3e-08
cd05324225 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicu 3e-08
cd05346 249 cd05346, SDR_c5, classical (c) SDR, subgroup 5 3e-08
PRK06997260 PRK06997, PRK06997, enoyl-(acyl carrier protein) r 3e-08
PRK06079252 PRK06079, PRK06079, enoyl-(acyl carrier protein) r 4e-08
PRK07889256 PRK07889, PRK07889, enoyl-(acyl carrier protein) r 4e-08
PRK08589 272 PRK08589, PRK08589, short chain dehydrogenase; Val 5e-08
cd05326 249 cd05326, secoisolariciresinol-DH_like_SDR_c, secoi 5e-08
PRK05875276 PRK05875, PRK05875, short chain dehydrogenase; Pro 5e-08
PRK06182 273 PRK06182, PRK06182, short chain dehydrogenase; Val 5e-08
PRK07890 258 PRK07890, PRK07890, short chain dehydrogenase; Pro 6e-08
cd05357234 cd05357, PR_SDR_c, pteridine reductase (PR), class 6e-08
PRK07774250 PRK07774, PRK07774, short chain dehydrogenase; Pro 7e-08
PRK07666239 PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) 7e-08
PRK07984262 PRK07984, PRK07984, enoyl-(acyl carrier protein) r 7e-08
PRK06196315 PRK06196, PRK06196, oxidoreductase; Provisional 9e-08
PRK05653246 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-07
PRK06198 260 PRK06198, PRK06198, short chain dehydrogenase; Pro 1e-07
PRK12826251 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-prote 2e-07
PRK07478254 PRK07478, PRK07478, short chain dehydrogenase; Pro 2e-07
cd05364 253 cd05364, SDR_c11, classical (c) SDR, subgroup 11 2e-07
cd05338246 cd05338, DHRS1_HSDL2-like_SDR_c, human dehydrogena 2e-07
PRK08263 275 PRK08263, PRK08263, short chain dehydrogenase; Pro 2e-07
cd05334221 cd05334, DHPR_SDR_c_like, dihydropteridine reducta 2e-07
PRK05565247 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) 3e-07
cd05333240 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein 3e-07
cd05347248 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogena 3e-07
PRK12828239 PRK12828, PRK12828, short chain dehydrogenase; Pro 3e-07
TIGR03971 265 TIGR03971, SDR_subfam_1, oxidoreductase, SDR famil 3e-07
cd05351244 cd05351, XR_like_SDR_c, xylulose reductase-like, c 3e-07
cd05361 242 cd05361, haloalcohol_DH_SDR_c-like, haloalcohol de 3e-07
PRK06180 277 PRK06180, PRK06180, short chain dehydrogenase; Pro 3e-07
cd09806 258 cd09806, type1_17beta-HSD-like_SDR_c, human estrog 3e-07
PRK05854313 PRK05854, PRK05854, short chain dehydrogenase; Pro 3e-07
PRK07831262 PRK07831, PRK07831, short chain dehydrogenase; Pro 4e-07
cd05368241 cd05368, DHRS6_like_SDR_c, human DHRS6-like, class 4e-07
cd08930250 cd08930, SDR_c8, classical (c) SDR, subgroup 8 4e-07
PRK12935247 PRK12935, PRK12935, acetoacetyl-CoA reductase; Pro 4e-07
TIGR01832248 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogena 4e-07
PRK09135249 PRK09135, PRK09135, pteridine reductase; Provision 4e-07
PRK08226263 PRK08226, PRK08226, short chain dehydrogenase; Pro 5e-07
PRK12827249 PRK12827, PRK12827, short chain dehydrogenase; Pro 5e-07
PRK12829264 PRK12829, PRK12829, short chain dehydrogenase; Pro 6e-07
TIGR01829242 TIGR01829, AcAcCoA_reduct, acetoacetyl-CoA reducta 6e-07
PLN02843 974 PLN02843, PLN02843, isoleucyl-tRNA synthetase 6e-07
PRK12745 256 PRK12745, PRK12745, 3-ketoacyl-(acyl-carrier-prote 7e-07
PRK08085 254 PRK08085, PRK08085, gluconate 5-dehydrogenase; Pro 7e-07
cd05356239 cd05356, 17beta-HSD1_like_SDR_c, 17-beta-hydroxyst 8e-07
PRK06197306 PRK06197, PRK06197, short chain dehydrogenase; Pro 9e-07
PRK09242 257 PRK09242, PRK09242, tropinone reductase; Provision 1e-06
cd05364253 cd05364, SDR_c11, classical (c) SDR, subgroup 11 1e-06
PRK06077 252 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-06
COG0300 265 COG0300, DltE, Short-chain dehydrogenases of vario 1e-06
PRK06701290 PRK06701, PRK06701, short chain dehydrogenase; Pro 1e-06
PRK08945247 PRK08945, PRK08945, putative oxoacyl-(acyl carrier 1e-06
PRK06603260 PRK06603, PRK06603, enoyl-(acyl carrier protein) r 1e-06
cd08941290 cd08941, 3KS_SDR_c, 3-keto steroid reductase, clas 1e-06
PRK07060245 PRK07060, PRK07060, short chain dehydrogenase; Pro 2e-06
PRK12936245 PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-prote 2e-06
cd08929226 cd08929, SDR_c4, classical (c) SDR, subgroup 4 2e-06
cd05374248 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxyster 2e-06
cd08934243 cd08934, CAD_SDR_c, clavulanic acid dehydrogenase 2e-06
cd08941290 cd08941, 3KS_SDR_c, 3-keto steroid reductase, clas 2e-06
TIGR01830239 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier 3e-06
PRK06935258 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrog 3e-06
PRK06077252 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) 3e-06
PRK06550235 PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) 3e-06
TIGR02632 676 TIGR02632, RhaD_aldol-ADH, rhamnulose-1-phosphate 3e-06
PRK08251248 PRK08251, PRK08251, short chain dehydrogenase; Pro 3e-06
cd05369249 cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reducta 4e-06
cd08942250 cd08942, RhlG_SDR_c, RhlG and related beta-ketoacy 4e-06
PRK06138252 PRK06138, PRK06138, short chain dehydrogenase; Pro 5e-06
cd08945 258 cd08945, PKR_SDR_c, Polyketide ketoreductase, clas 5e-06
pfam00106167 pfam00106, adh_short, short chain dehydrogenase 5e-06
cd05337 255 cd05337, BKR_1_SDR_c, putative beta-ketoacyl acyl 6e-06
PRK05717 255 PRK05717, PRK05717, oxidoreductase; Validated 6e-06
cd09808255 cd09808, DHRS-12_like_SDR_c-like, human dehydrogen 6e-06
cd08942250 cd08942, RhlG_SDR_c, RhlG and related beta-ketoacy 7e-06
PRK08993253 PRK08993, PRK08993, 2-deoxy-D-gluconate 3-dehydrog 7e-06
cd05340236 cd05340, Ycik_SDR_c, Escherichia coli K-12 YCIK-li 7e-06
cd09808255 cd09808, DHRS-12_like_SDR_c-like, human dehydrogen 7e-06
cd05358253 cd05358, GlcDH_SDR_c, glucose 1 dehydrogenase (Glc 8e-06
TIGR01963255 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase 8e-06
cd05324225 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicu 8e-06
TIGR01831239 TIGR01831, fabG_rel, 3-oxoacyl-(acyl-carrier-prote 8e-06
PRK12743 256 PRK12743, PRK12743, oxidoreductase; Provisional 8e-06
cd05349246 cd05349, BKR_2_SDR_c, putative beta-ketoacyl acyl 8e-06
PRK09291 257 PRK09291, PRK09291, short chain dehydrogenase; Pro 8e-06
TIGR00395 938 TIGR00395, leuS_arch, leucyl-tRNA synthetase, arch 8e-06
PRK08220 252 PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehy 9e-06
PRK06482 276 PRK06482, PRK06482, short chain dehydrogenase; Pro 9e-06
cd09810311 cd09810, LPOR_like_SDR_c_like, light-dependent pro 9e-06
cd05366257 cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol 1e-05
TIGR02415254 TIGR02415, 23BDH, acetoin reductases 1e-05
PRK07063260 PRK07063, PRK07063, short chain dehydrogenase; Pro 1e-05
PRK08265 261 PRK08265, PRK08265, short chain dehydrogenase; Pro 1e-05
TIGR04316 250 TIGR04316, dhbA_paeA, 2,3-dihydro-2,3-dihydroxyben 1e-05
PRK07097 265 PRK07097, PRK07097, gluconate 5-dehydrogenase; Pro 1e-05
cd08933 261 cd08933, RDH_SDR_c, retinal dehydrogenase-like, cl 1e-05
cd05330 257 cd05330, cyclohexanol_reductase_SDR_c, cyclohexano 1e-05
COG0495 814 COG0495, LeuS, Leucyl-tRNA synthetase [Translation 1e-05
PRK06720169 PRK06720, PRK06720, hypothetical protein; Provisio 1e-05
PRK08862227 PRK08862, PRK08862, short chain dehydrogenase; Pro 1e-05
TIGR01500256 TIGR01500, sepiapter_red, sepiapterin reductase 1e-05
cd05329251 cd05329, TR_SDR_c, tropinone reductase-I and II (T 2e-05
cd05326249 cd05326, secoisolariciresinol-DH_like_SDR_c, secoi 2e-05
PRK06500 249 PRK06500, PRK06500, short chain dehydrogenase; Pro 2e-05
cd05354235 cd05354, SDR_c7, classical (c) SDR, subgroup 7 2e-05
PRK06197306 PRK06197, PRK06197, short chain dehydrogenase; Pro 2e-05
PRK08862227 PRK08862, PRK08862, short chain dehydrogenase; Pro 2e-05
PRK08643256 PRK08643, PRK08643, acetoin reductase; Validated 3e-05
PRK07774250 PRK07774, PRK07774, short chain dehydrogenase; Pro 3e-05
PRK06949258 PRK06949, PRK06949, short chain dehydrogenase; Pro 3e-05
PRK12743256 PRK12743, PRK12743, oxidoreductase; Provisional 3e-05
PRK05867253 PRK05867, PRK05867, short chain dehydrogenase; Pro 3e-05
cd05371252 cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydr 3e-05
PRK08261450 PRK08261, fabG, 3-ketoacyl-(acyl-carrier-protein) 3e-05
PRK05650 270 PRK05650, PRK05650, short chain dehydrogenase; Pro 3e-05
TIGR01500256 TIGR01500, sepiapter_red, sepiapterin reductase 3e-05
cd05362243 cd05362, THN_reductase-like_SDR_c, tetrahydroxynap 4e-05
PRK12481251 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrog 4e-05
cd05340236 cd05340, Ycik_SDR_c, Escherichia coli K-12 YCIK-li 4e-05
PRK06181 263 PRK06181, PRK06181, short chain dehydrogenase; Pro 4e-05
cd05350239 cd05350, SDR_c6, classical (c) SDR, subgroup 6 4e-05
PRK07023243 PRK07023, PRK07023, short chain dehydrogenase; Pro 4e-05
cd05366 257 cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol 5e-05
cd05352252 cd05352, MDH-like_SDR_c, mannitol dehydrogenase (M 5e-05
cd09761 242 cd09761, A3DFK9-like_SDR_c, Clostridium thermocell 5e-05
PRK08251248 PRK08251, PRK08251, short chain dehydrogenase; Pro 5e-05
PRK06720169 PRK06720, PRK06720, hypothetical protein; Provisio 5e-05
PRK12939250 PRK12939, PRK12939, short chain dehydrogenase; Pro 6e-05
cd05343250 cd05343, Mgc4172-like_SDR_c, human Mgc4172-like, c 6e-05
cd09810311 cd09810, LPOR_like_SDR_c_like, light-dependent pro 6e-05
cd05365242 cd05365, 7_alpha_HSDH_SDR_c, 7 alpha-hydroxysteroi 7e-05
PRK06114 254 PRK06114, PRK06114, short chain dehydrogenase; Pro 7e-05
PRK07825 273 PRK07825, PRK07825, short chain dehydrogenase; Pro 7e-05
PRK08690261 PRK08690, PRK08690, enoyl-(acyl carrier protein) r 7e-05
PRK12429258 PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenas 8e-05
cd05331 244 cd05331, DH-DHB-DH_SDR_c, 2,3 dihydro-2,3 dihydroz 8e-05
PRK08303305 PRK08303, PRK08303, short chain dehydrogenase; Pro 8e-05
PRK12937245 PRK12937, PRK12937, short chain dehydrogenase; Pro 9e-05
PRK06113255 PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydro 9e-05
COG0300265 COG0300, DltE, Short-chain dehydrogenases of vario 9e-05
PRK09135249 PRK09135, PRK09135, pteridine reductase; Provision 9e-05
cd05348 257 cd05348, BphB-like_SDR_c, cis-biphenyl-2,3-dihydro 9e-05
PRK06523 260 PRK06523, PRK06523, short chain dehydrogenase; Pro 1e-04
cd05357234 cd05357, PR_SDR_c, pteridine reductase (PR), class 1e-04
TIGR03971265 TIGR03971, SDR_subfam_1, oxidoreductase, SDR famil 1e-04
cd05363 254 cd05363, SDH_SDR_c, Sorbitol dehydrogenase (SDH), 1e-04
cd09763 265 cd09763, DHRS1-like_SDR_c, human dehydrogenase/red 1e-04
PRK08264238 PRK08264, PRK08264, short chain dehydrogenase; Val 1e-04
PRK07889256 PRK07889, PRK07889, enoyl-(acyl carrier protein) r 1e-04
PRK08303305 PRK08303, PRK08303, short chain dehydrogenase; Pro 1e-04
PRK05743 912 PRK05743, ileS, isoleucyl-tRNA synthetase; Reviewe 1e-04
COG0143558 COG0143, MetG, Methionyl-tRNA synthetase [Translat 1e-04
cd08944246 cd08944, SDR_c12, classical (c) SDR, subgroup 12 2e-04
PRK12824245 PRK12824, PRK12824, acetoacetyl-CoA reductase; Pro 2e-04
PRK06113 255 PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydro 2e-04
PRK07060245 PRK07060, PRK07060, short chain dehydrogenase; Pro 2e-04
pfam13561239 pfam13561, adh_short_C2, Enoyl-(Acyl carrier prote 2e-04
PRK12936245 PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-prote 2e-04
PRK12828239 PRK12828, PRK12828, short chain dehydrogenase; Pro 2e-04
cd08935 271 cd08935, mannonate_red_SDR_c, putative D-mannonate 2e-04
PLN02253280 PLN02253, PLN02253, xanthoxin dehydrogenase 2e-04
PLN02253 280 PLN02253, PLN02253, xanthoxin dehydrogenase 2e-04
cd05372250 cd05372, ENR_SDR, Enoyl acyl carrier protein (ACP) 2e-04
PRK07454241 PRK07454, PRK07454, short chain dehydrogenase; Pro 2e-04
cd05373238 cd05373, SDR_c10, classical (c) SDR, subgroup 10 2e-04
PRK08177225 PRK08177, PRK08177, short chain dehydrogenase; Pro 2e-04
cd11730206 cd11730, Tthb094_like_SDR_c, Tthb094 and related p 2e-04
cd11730206 cd11730, Tthb094_like_SDR_c, Tthb094 and related p 2e-04
PRK11893511 PRK11893, PRK11893, methionyl-tRNA synthetase; Rev 2e-04
cd00812314 cd00812, LeuRS_core, catalytic core domain of leuc 2e-04
PRK00390 805 PRK00390, leuS, leucyl-tRNA synthetase; Validated 2e-04
PRK08213259 PRK08213, PRK08213, gluconate 5-dehydrogenase; Pro 3e-04
PRK06398258 PRK06398, PRK06398, aldose dehydrogenase; Validate 3e-04
PRK07326237 PRK07326, PRK07326, short chain dehydrogenase; Pro 3e-04
PRK06124 256 PRK06124, PRK06124, gluconate 5-dehydrogenase; Pro 3e-04
PRK07890258 PRK07890, PRK07890, short chain dehydrogenase; Pro 3e-04
TIGR03325 262 TIGR03325, BphB_TodD, cis-2,3-dihydrobiphenyl-2,3- 3e-04
cd05365242 cd05365, 7_alpha_HSDH_SDR_c, 7 alpha-hydroxysteroi 4e-04
TIGR04316250 TIGR04316, dhbA_paeA, 2,3-dihydro-2,3-dihydroxyben 4e-04
TIGR01832248 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogena 4e-04
PRK12384 259 PRK12384, PRK12384, sorbitol-6-phosphate dehydroge 4e-04
PRK06200 263 PRK06200, PRK06200, 2,3-dihydroxy-2,3-dihydropheny 4e-04
PRK06505271 PRK06505, PRK06505, enoyl-(acyl carrier protein) r 4e-04
PRK08177225 PRK08177, PRK08177, short chain dehydrogenase; Pro 4e-04
cd05329251 cd05329, TR_SDR_c, tropinone reductase-I and II (T 5e-04
PRK12937245 PRK12937, PRK12937, short chain dehydrogenase; Pro 5e-04
PRK06198260 PRK06198, PRK06198, short chain dehydrogenase; Pro 5e-04
PRK12745256 PRK12745, PRK12745, 3-ketoacyl-(acyl-carrier-prote 5e-04
cd05351244 cd05351, XR_like_SDR_c, xylulose reductase-like, c 5e-04
cd05344253 cd05344, BKR_like_SDR_like, putative beta-ketoacyl 6e-04
PRK06463 255 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) 6e-04
PRK12481251 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrog 6e-04
PRK08277 278 PRK08277, PRK08277, D-mannonate oxidoreductase; Pr 7e-04
cd05331244 cd05331, DH-DHB-DH_SDR_c, 2,3 dihydro-2,3 dihydroz 7e-04
PRK12746254 PRK12746, PRK12746, short chain dehydrogenase; Pro 7e-04
PRK06947248 PRK06947, PRK06947, glucose-1-dehydrogenase; Provi 7e-04
PRK05993277 PRK05993, PRK05993, short chain dehydrogenase; Pro 7e-04
cd09762243 cd09762, HSDL2_SDR_c, human hydroxysteroid dehydro 7e-04
TIGR02685267 TIGR02685, pter_reduc_Leis, pteridine reductase 7e-04
PRK06483236 PRK06483, PRK06483, dihydromonapterin reductase; P 7e-04
cd05359242 cd05359, ChcA_like_SDR_c, 1-cyclohexenylcarbonyl_c 9e-04
PRK06484520 PRK06484, PRK06484, short chain dehydrogenase; Val 0.001
PRK06172253 PRK06172, PRK06172, short chain dehydrogenase; Pro 0.001
PRK13394262 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenas 0.001
cd08929226 cd08929, SDR_c4, classical (c) SDR, subgroup 4 0.001
PRK08265261 PRK08265, PRK08265, short chain dehydrogenase; Pro 0.001
cd08939239 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine 0.001
TIGR03206 250 TIGR03206, benzo_BadH, 2-hydroxycyclohexanecarboxy 0.001
PRK08278 273 PRK08278, PRK08278, short chain dehydrogenase; Pro 0.001
PRK09186256 PRK09186, PRK09186, flagellin modification protein 0.001
PRK09134258 PRK09134, PRK09134, short chain dehydrogenase; Pro 0.001
COG0451314 COG0451, WcaG, Nucleoside-diphosphate-sugar epimer 0.001
cd05345248 cd05345, BKR_3_SDR_c, putative beta-ketoacyl acyl 0.002
cd05341247 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta 0.002
PRK08936 261 PRK08936, PRK08936, glucose-1-dehydrogenase; Provi 0.002
PRK06841255 PRK06841, PRK06841, short chain dehydrogenase; Pro 0.002
PRK08085254 PRK08085, PRK08085, gluconate 5-dehydrogenase; Pro 0.002
PRK06701290 PRK06701, PRK06701, short chain dehydrogenase; Pro 0.002
PRK08220252 PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehy 0.002
cd05337255 cd05337, BKR_1_SDR_c, putative beta-ketoacyl acyl 0.002
PRK06128300 PRK06128, PRK06128, oxidoreductase; Provisional 0.002
PRK05867253 PRK05867, PRK05867, short chain dehydrogenase; Pro 0.002
cd05327 269 cd05327, retinol-DH_like_SDR_c_like, retinol dehyd 0.002
PRK07577234 PRK07577, PRK07577, short chain dehydrogenase; Pro 0.002
PRK09072 263 PRK09072, PRK09072, short chain dehydrogenase; Pro 0.002
PRK05693274 PRK05693, PRK05693, short chain dehydrogenase; Pro 0.002
cd00814319 cd00814, MetRS_core, catalytic core domain of meth 0.002
cd05355270 cd05355, SDR_c1, classical (c) SDR, subgroup 1 0.003
cd08940258 cd08940, HBDH_SDR_c, d-3-hydroxybutyrate dehydroge 0.003
PRK07326237 PRK07326, PRK07326, short chain dehydrogenase; Pro 0.003
PRK07856 252 PRK07856, PRK07856, short chain dehydrogenase; Pro 0.003
PRK06523260 PRK06523, PRK06523, short chain dehydrogenase; Pro 0.003
PRK08217253 PRK08217, fabG, 3-ketoacyl-(acyl-carrier-protein) 0.003
PRK07985294 PRK07985, PRK07985, oxidoreductase; Provisional 0.003
PRK06947248 PRK06947, PRK06947, glucose-1-dehydrogenase; Provi 0.003
PRK12938246 PRK12938, PRK12938, acetyacetyl-CoA reductase; Pro 0.003
PRK09291257 PRK09291, PRK09291, short chain dehydrogenase; Pro 0.003
PRK07792 306 PRK07792, fabG, 3-ketoacyl-(acyl-carrier-protein) 0.003
PRK10538 248 PRK10538, PRK10538, malonic semialdehyde reductase 0.003
TIGR00398530 TIGR00398, metG, methionyl-tRNA synthetase 0.003
PRK05884223 PRK05884, PRK05884, short chain dehydrogenase; Pro 0.003
PRK13804 961 PRK13804, ileS, isoleucyl-tRNA synthetase; Provisi 0.003
PRK08589272 PRK08589, PRK08589, short chain dehydrogenase; Val 0.004
cd05352252 cd05352, MDH-like_SDR_c, mannitol dehydrogenase (M 0.004
pfam13561239 pfam13561, adh_short_C2, Enoyl-(Acyl carrier prote 0.004
PRK08324681 PRK08324, PRK08324, short chain dehydrogenase; Val 0.004
PRK12384259 PRK12384, PRK12384, sorbitol-6-phosphate dehydroge 0.004
PRK06123248 PRK06123, PRK06123, short chain dehydrogenase; Pro 0.004
PRK08642253 PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) 0.004
PRK05717255 PRK05717, PRK05717, oxidoreductase; Validated 0.004
PRK06180277 PRK06180, PRK06180, short chain dehydrogenase; Pro 0.004
cd05325233 cd05325, carb_red_sniffer_like_SDR_c, carbonyl red 0.004
PRK07424406 PRK07424, PRK07424, bifunctional sterol desaturase 0.004
pfam09334388 pfam09334, tRNA-synt_1g, tRNA synthetases class I 0.004
>gnl|CDD|187641 cd08936, CR_SDR_c, Porcine peroxisomal carbonyl reductase like, classical (c) SDR Back     alignment and domain information
 Score =  330 bits (847), Expect = e-108
 Identities = 143/250 (57%), Positives = 183/250 (73%), Gaps = 1/250 (0%)

Query: 379 LAGKVAVVTASSDGIGFAIAKRLSTEGASVVISSRKESNVNKAVETLQKEGHQKISGVVC 438
           LA KVA+VTAS+DGIG AIA+RL+ +GA VV+SSRK+ NV++AV TLQ EG   ++G VC
Sbjct: 8   LANKVALVTASTDGIGLAIARRLAQDGAHVVVSSRKQQNVDRAVATLQGEG-LSVTGTVC 66

Query: 439 HVAKKEDRQKLFEHAEKKFGGIDILVSNAAVNPATGPVVECPENVWDKIFEVNVKSTFLL 498
           HV K EDR++L   A    GG+DILVSNAAVNP  G +++  E VWDKI +VNVK+T L+
Sbjct: 67  HVGKAEDRERLVATAVNLHGGVDILVSNAAVNPFFGNILDSTEEVWDKILDVNVKATALM 126

Query: 499 TQEVLPYIRKRNGGSIVYVSSIGGLAPFKLLGAYSVSKTALLGLTKAVAQDLASENIRVN 558
           T+ V+P + KR GGS+V VSS+    PF  LG Y+VSKTALLGLTK +A +LA  NIRVN
Sbjct: 127 TKAVVPEMEKRGGGSVVIVSSVAAFHPFPGLGPYNVSKTALLGLTKNLAPELAPRNIRVN 186

Query: 559 CLAPGITKTKFAAALYETEEAHEIAVSNVPMGRLAVPDEMGGIVAFLCSDDASYITGEVI 618
           CLAPG+ KT F++AL+  +   E     + + RL  P++  GIV+FLCS+DASYITGE +
Sbjct: 187 CLAPGLIKTSFSSALWMDKAVEESMKETLRIRRLGQPEDCAGIVSFLCSEDASYITGETV 246

Query: 619 VAAGGMQSRL 628
           V  GG  SRL
Sbjct: 247 VVGGGTPSRL 256


This subgroup contains porcine peroxisomal carbonyl reductase and similar proteins. The porcine enzyme efficiently reduces retinals. This subgroup also includes human dehydrogenase/reductase (SDR family) member 4 (DHRS4), and human DHRS4L1. DHRS4 is a peroxisomal enzyme with 3beta-hydroxysteroid dehydrogenase activity; it catalyzes the reduction of 3-keto-C19/C21-steroids into 3beta-hydroxysteroids more efficiently than it does the retinal reduction. The human DHRS4 gene cluster contains DHRS4, DHRS4L2 and DHRS4L1. DHRS4L2 and DHRS4L1 are paralogs of DHRS4, DHRS4L2 being the most recent member. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction. Length = 256

>gnl|CDD|235975 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187641 cd08936, CR_SDR_c, Porcine peroxisomal carbonyl reductase like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|180802 PRK07035, PRK07035, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|212491 cd05233, SDR_c, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235546 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|223959 COG1028, FabG, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|235506 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|235500 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|240411 PTZ00419, PTZ00419, valyl-tRNA synthetase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|235975 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187602 cd05344, BKR_like_SDR_like, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR)-like, SDR Back     alignment and domain information
>gnl|CDD|187594 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein reductase (BKR), involved in Type II FAS, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|183775 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>gnl|CDD|233590 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>gnl|CDD|237218 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|183833 PRK12939, PRK12939, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187605 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogenase (Ga5DH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|212491 cd05233, SDR_c, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235582 PRK05729, valS, valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|187620 cd05362, THN_reductase-like_SDR_c, tetrahydroxynaphthalene/trihydroxynaphthalene reductase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187616 cd05358, GlcDH_SDR_c, glucose 1 dehydrogenase (GlcDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181295 PRK08213, PRK08213, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180802 PRK07035, PRK07035, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223959 COG1028, FabG, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|187624 cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187627 cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reductase (TER) and 2,4-dienoyl-CoA reductase (DECR), atypical (a) SDR Back     alignment and domain information
>gnl|CDD|237100 PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181721 PRK09242, PRK09242, tropinone reductase; Provisional Back     alignment and domain information
>gnl|CDD|187590 cd05329, TR_SDR_c, tropinone reductase-I and II (TR-1, and TR-II)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|235546 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|235506 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187603 cd05345, BKR_3_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR), subgroup 3, classical (c) SDR Back     alignment and domain information
>gnl|CDD|180993 PRK07478, PRK07478, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187648 cd08944, SDR_c12, classical (c) SDR, subgroup 12 Back     alignment and domain information
>gnl|CDD|235712 PRK06138, PRK06138, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187600 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181491 PRK08589, PRK08589, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|223599 COG0525, ValS, Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235500 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|187617 cd05359, ChcA_like_SDR_c, 1-cyclohexenylcarbonyl_coenzyme A_reductase (ChcA)_like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|183775 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>gnl|CDD|183778 PRK12829, PRK12829, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|185677 cd00817, ValRS_core, catalytic core domain of valyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|187622 cd05364, SDR_c11, classical (c) SDR, subgroup 11 Back     alignment and domain information
>gnl|CDD|180440 PRK06172, PRK06172, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|211705 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>gnl|CDD|232969 TIGR00422, valS, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|183773 PRK12824, PRK12824, acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|181305 PRK08226, PRK08226, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187602 cd05344, BKR_like_SDR_like, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR)-like, SDR Back     alignment and domain information
>gnl|CDD|183833 PRK12939, PRK12939, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|131468 TIGR02415, 23BDH, acetoin reductases Back     alignment and domain information
>gnl|CDD|181585 PRK08936, PRK08936, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237100 PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187605 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogenase (Ga5DH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235794 PRK06398, PRK06398, aldose dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187613 cd05355, SDR_c1, classical (c) SDR, subgroup 1 Back     alignment and domain information
>gnl|CDD|180761 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|233590 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>gnl|CDD|236110 PRK07831, PRK07831, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187594 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein reductase (BKR), involved in Type II FAS, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181518 PRK08643, PRK08643, acetoin reductase; Validated Back     alignment and domain information
>gnl|CDD|237218 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|215739 pfam00133, tRNA-synt_1, tRNA synthetases class I (I, L, M and V) Back     alignment and domain information
>gnl|CDD|187626 cd05368, DHRS6_like_SDR_c, human DHRS6-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187644 cd08940, HBDH_SDR_c, d-3-hydroxybutyrate dehydrogenase (HBDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187646 cd08942, RhlG_SDR_c, RhlG and related beta-ketoacyl reductases, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187649 cd08945, PKR_SDR_c, Polyketide ketoreductase, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187587 cd05326, secoisolariciresinol-DH_like_SDR_c, secoisolariciresinol dehydrogenase (secoisolariciresinol-DH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187620 cd05362, THN_reductase-like_SDR_c, tetrahydroxynaphthalene/trihydroxynaphthalene reductase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236094 PRK07774, PRK07774, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187610 cd05352, MDH-like_SDR_c, mannitol dehydrogenase (MDH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|171821 PRK12937, PRK12937, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181295 PRK08213, PRK08213, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|135765 PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|237219 PRK12827, PRK12827, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180462 PRK06198, PRK06198, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237855 PRK14900, valS, valyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|180723 PRK06841, PRK06841, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180439 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236145 PRK08063, PRK08063, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180371 PRK06057, PRK06057, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235925 PRK07067, PRK07067, sorbitol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187623 cd05365, 7_alpha_HSDH_SDR_c, 7 alpha-hydroxysteroid dehydrogenase (7 alpha-HSDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180817 PRK07060, PRK07060, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235693 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187635 cd08930, SDR_c8, classical (c) SDR, subgroup 8 Back     alignment and domain information
>gnl|CDD|187624 cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187616 cd05358, GlcDH_SDR_c, glucose 1 dehydrogenase (GlcDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235990 PRK07326, PRK07326, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180993 PRK07478, PRK07478, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235924 PRK07063, PRK07063, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236116 PRK07856, PRK07856, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|222222 pfam13561, adh_short_C2, Enoyl-(Acyl carrier protein) reductase Back     alignment and domain information
>gnl|CDD|235712 PRK06138, PRK06138, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235990 PRK07326, PRK07326, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|188169 TIGR01829, AcAcCoA_reduct, acetoacetyl-CoA reductase Back     alignment and domain information
>gnl|CDD|236241 PRK08324, PRK08324, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|236241 PRK08324, PRK08324, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187585 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicular carbonyl reductase (PTCR)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|237188 PRK12745, PRK12745, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|235702 PRK06124, PRK06124, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187585 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicular carbonyl reductase (PTCR)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187648 cd08944, SDR_c12, classical (c) SDR, subgroup 12 Back     alignment and domain information
>gnl|CDD|171820 PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>gnl|CDD|181225 PRK08085, PRK08085, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236216 PRK08277, PRK08277, D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|184025 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187634 cd08929, SDR_c4, classical (c) SDR, subgroup 4 Back     alignment and domain information
>gnl|CDD|187603 cd05345, BKR_3_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR), subgroup 3, classical (c) SDR Back     alignment and domain information
>gnl|CDD|211705 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>gnl|CDD|187632 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187600 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181159 PRK07890, PRK07890, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187634 cd08929, SDR_c4, classical (c) SDR, subgroup 4 Back     alignment and domain information
>gnl|CDD|187647 cd08943, R1PA_ADH_SDR_c, rhamnulose-1-phosphate aldolase/alcohol dehydrogenase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|183778 PRK12829, PRK12829, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187627 cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reductase (TER) and 2,4-dienoyl-CoA reductase (DECR), atypical (a) SDR Back     alignment and domain information
>gnl|CDD|236209 PRK08265, PRK08265, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183832 PRK12935, PRK12935, acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|187632 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|237220 PRK12828, PRK12828, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236040 PRK07523, PRK07523, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|213929 TIGR04316, dhbA_paeA, 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase Back     alignment and domain information
>gnl|CDD|223377 COG0300, DltE, Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>gnl|CDD|235853 PRK06701, PRK06701, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181077 PRK07677, PRK07677, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235933 PRK07097, PRK07097, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|188170 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>gnl|CDD|236357 PRK08945, PRK08945, putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180617 PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|236190 PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187590 cd05329, TR_SDR_c, tropinone reductase-I and II (TR-1, and TR-II)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187647 cd08943, R1PA_ADH_SDR_c, rhamnulose-1-phosphate aldolase/alcohol dehydrogenase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235816 PRK06500, PRK06500, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187596 cd05337, BKR_1_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR), subgroup 1, classical (c) SDR Back     alignment and domain information
>gnl|CDD|180576 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|215509 PLN02943, PLN02943, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|223377 COG0300, DltE, Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>gnl|CDD|187584 cd05323, ADH_SDR_c_like, insect type alcohol dehydrogenase (ADH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|130890 TIGR01831, fabG_rel, 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>gnl|CDD|181491 PRK08589, PRK08589, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235693 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|169389 PRK08339, PRK08339, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237189 PRK12748, PRK12748, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187597 cd05338, DHRS1_HSDL2-like_SDR_c, human dehydrogenase/reductase (SDR family) member 1 (DHRS1) and human hydroxysteroid dehydrogenase-like protein 2 (HSDL2), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187640 cd08935, mannonate_red_SDR_c, putative D-mannonate oxidoreductase, classical (c) SDR Back     alignment and domain information
>gnl|CDD|181721 PRK09242, PRK09242, tropinone reductase; Provisional Back     alignment and domain information
>gnl|CDD|187622 cd05364, SDR_c11, classical (c) SDR, subgroup 11 Back     alignment and domain information
>gnl|CDD|180440 PRK06172, PRK06172, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236110 PRK07831, PRK07831, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187584 cd05323, ADH_SDR_c_like, insect type alcohol dehydrogenase (ADH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187597 cd05338, DHRS1_HSDL2-like_SDR_c, human dehydrogenase/reductase (SDR family) member 1 (DHRS1) and human hydroxysteroid dehydrogenase-like protein 2 (HSDL2), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|177895 PLN02253, PLN02253, xanthoxin dehydrogenase Back     alignment and domain information
>gnl|CDD|180822 PRK07069, PRK07069, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180773 PRK06949, PRK06949, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181605 PRK08993, PRK08993, 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187643 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine reductase (KDSR) and related proteins, classical (c) SDR Back     alignment and domain information
>gnl|CDD|181518 PRK08643, PRK08643, acetoin reductase; Validated Back     alignment and domain information
>gnl|CDD|180408 PRK06114, PRK06114, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181668 PRK09135, PRK09135, pteridine reductase; Provisional Back     alignment and domain information
>gnl|CDD|131468 TIGR02415, 23BDH, acetoin reductases Back     alignment and domain information
>gnl|CDD|236357 PRK08945, PRK08945, putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187644 cd08940, HBDH_SDR_c, d-3-hydroxybutyrate dehydrogenase (HBDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|237187 PRK12743, PRK12743, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|236074 PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187607 cd05349, BKR_2_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP]reductase (BKR), subgroup 2, classical (c) SDR Back     alignment and domain information
>gnl|CDD|180604 PRK06523, PRK06523, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187615 cd05357, PR_SDR_c, pteridine reductase (PR), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180818 PRK07062, PRK07062, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181131 PRK07814, PRK07814, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|226674 COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>gnl|CDD|183772 PRK12823, benD, 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187643 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine reductase (KDSR) and related proteins, classical (c) SDR Back     alignment and domain information
>gnl|CDD|236074 PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|171531 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236056 PRK07576, PRK07576, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235794 PRK06398, PRK06398, aldose dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180761 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|184025 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|226674 COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>gnl|CDD|187638 cd08933, RDH_SDR_c, retinal dehydrogenase-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|234422 TIGR03971, SDR_subfam_1, oxidoreductase, SDR family Back     alignment and domain information
>gnl|CDD|183489 PRK12384, PRK12384, sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187617 cd05359, ChcA_like_SDR_c, 1-cyclohexenylcarbonyl_coenzyme A_reductase (ChcA)_like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187587 cd05326, secoisolariciresinol-DH_like_SDR_c, secoisolariciresinol dehydrogenase (secoisolariciresinol-DH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180411 PRK06123, PRK06123, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181305 PRK08226, PRK08226, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|171821 PRK12937, PRK12937, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183773 PRK12824, PRK12824, acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|180439 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187599 cd05340, Ycik_SDR_c, Escherichia coli K-12 YCIK-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180413 PRK06128, PRK06128, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|183797 PRK12859, PRK12859, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181585 PRK08936, PRK08936, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187642 cd08937, DHB_DH-like_SDR_c, 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase (DHB DH)-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|235703 PRK06125, PRK06125, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180462 PRK06198, PRK06198, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235925 PRK07067, PRK07067, sorbitol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187601 cd05343, Mgc4172-like_SDR_c, human Mgc4172-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187601 cd05343, Mgc4172-like_SDR_c, human Mgc4172-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180723 PRK06841, PRK06841, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187621 cd05363, SDH_SDR_c, Sorbitol dehydrogenase (SDH), classical (c) SDR Back     alignment and domain information
>gnl|CDD|187609 cd05351, XR_like_SDR_c, xylulose reductase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|135631 PRK05867, PRK05867, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|212493 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187626 cd05368, DHRS6_like_SDR_c, human DHRS6-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187593 cd05332, 11beta-HSD1_like_SDR_c, 11beta-hydroxysteroid dehydrogenase type 1 (11beta-HSD1)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236094 PRK07774, PRK07774, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235924 PRK07063, PRK07063, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|135765 PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187662 cd09761, A3DFK9-like_SDR_c, Clostridium thermocellum A3DFK9-like, a putative carbohydrate or polyalcohol metabolizing SDR, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187619 cd05361, haloalcohol_DH_SDR_c-like, haloalcohol dehalogenase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187649 cd08945, PKR_SDR_c, Polyketide ketoreductase, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187610 cd05352, MDH-like_SDR_c, mannitol dehydrogenase (MDH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187630 cd05372, ENR_SDR, Enoyl acyl carrier protein (ACP) reductase (ENR), divergent SDR Back     alignment and domain information
>gnl|CDD|181297 PRK08217, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187623 cd05365, 7_alpha_HSDH_SDR_c, 7 alpha-hydroxysteroid dehydrogenase (7 alpha-HSDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187635 cd08930, SDR_c8, classical (c) SDR, subgroup 8 Back     alignment and domain information
>gnl|CDD|236145 PRK08063, PRK08063, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187593 cd05332, 11beta-HSD1_like_SDR_c, 11beta-hydroxysteroid dehydrogenase type 1 (11beta-HSD1)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181517 PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180984 PRK07454, PRK07454, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187613 cd05355, SDR_c1, classical (c) SDR, subgroup 1 Back     alignment and domain information
>gnl|CDD|181159 PRK07890, PRK07890, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180300 PRK05875, PRK05875, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187639 cd08934, CAD_SDR_c, clavulanic acid dehydrogenase (CAD), classical (c) SDR Back     alignment and domain information
>gnl|CDD|187639 cd08934, CAD_SDR_c, clavulanic acid dehydrogenase (CAD), classical (c) SDR Back     alignment and domain information
>gnl|CDD|187592 cd05331, DH-DHB-DH_SDR_c, 2,3 dihydro-2,3 dihydrozybenzoate dehydrogenases, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180984 PRK07454, PRK07454, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181225 PRK08085, PRK08085, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187598 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hydroxysteroid dehydrogenase XI-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236040 PRK07523, PRK07523, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187599 cd05340, Ycik_SDR_c, Escherichia coli K-12 YCIK-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|183718 PRK12746, PRK12746, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187598 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hydroxysteroid dehydrogenase XI-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|132250 TIGR03206, benzo_BadH, 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|183832 PRK12935, PRK12935, acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|235739 PRK06200, PRK06200, 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235726 PRK06181, PRK06181, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235933 PRK07097, PRK07097, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187646 cd08942, RhlG_SDR_c, RhlG and related beta-ketoacyl reductases, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|171820 PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>gnl|CDD|177895 PLN02253, PLN02253, xanthoxin dehydrogenase Back     alignment and domain information
>gnl|CDD|235726 PRK06181, PRK06181, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237220 PRK12828, PRK12828, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|212493 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187611 cd05353, hydroxyacyl-CoA-like_DH_SDR_c-like, (3R)-hydroxyacyl-CoA dehydrogenase-like, classical(c)-like SDRs Back     alignment and domain information
>gnl|CDD|187591 cd05330, cyclohexanol_reductase_SDR_c, cyclohexanol reductases, including levodione reductase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|237219 PRK12827, PRK12827, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237188 PRK12745, PRK12745, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|213929 TIGR04316, dhbA_paeA, 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase Back     alignment and domain information
>gnl|CDD|181188 PRK07985, PRK07985, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|181136 PRK07825, PRK07825, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180617 PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180823 PRK07074, PRK07074, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181508 PRK08628, PRK08628, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|169390 PRK08340, PRK08340, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180771 PRK06947, PRK06947, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187596 cd05337, BKR_1_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR), subgroup 1, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187614 cd05356, 17beta-HSD1_like_SDR_c, 17-beta-hydroxysteroid dehydrogenases (17beta-HSDs) types -1, -3, and -12, -like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180371 PRK06057, PRK06057, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|212492 cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187611 cd05353, hydroxyacyl-CoA-like_DH_SDR_c-like, (3R)-hydroxyacyl-CoA dehydrogenase-like, classical(c)-like SDRs Back     alignment and domain information
>gnl|CDD|236216 PRK08277, PRK08277, D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|181136 PRK07825, PRK07825, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187614 cd05356, 17beta-HSD1_like_SDR_c, 17-beta-hydroxysteroid dehydrogenases (17beta-HSDs) types -1, -3, and -12, -like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|183719 PRK12747, PRK12747, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236190 PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|212492 cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187604 cd05346, SDR_c5, classical (c) SDR, subgroup 5 Back     alignment and domain information
>gnl|CDD|187604 cd05346, SDR_c5, classical (c) SDR, subgroup 5 Back     alignment and domain information
>gnl|CDD|187606 cd05348, BphB-like_SDR_c, cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase (BphB)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187638 cd08933, RDH_SDR_c, retinal dehydrogenase-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|181668 PRK09135, PRK09135, pteridine reductase; Provisional Back     alignment and domain information
>gnl|CDD|187615 cd05357, PR_SDR_c, pteridine reductase (PR), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187629 cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydrogenase type 10 (HSD10)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|222222 pfam13561, adh_short_C2, Enoyl-(Acyl carrier protein) reductase Back     alignment and domain information
>gnl|CDD|180817 PRK07060, PRK07060, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|168204 PRK05717, PRK05717, oxidoreductase; Validated Back     alignment and domain information
>gnl|CDD|180446 PRK06180, PRK06180, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183489 PRK12384, PRK12384, sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187583 cd05322, SDH_SDR_c_like, Sorbitol 6-phosphate dehydrogenase (SDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|215720 pfam00106, adh_short, short chain dehydrogenase Back     alignment and domain information
>gnl|CDD|215720 pfam00106, adh_short, short chain dehydrogenase Back     alignment and domain information
>gnl|CDD|181349 PRK08278, PRK08278, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|188170 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>gnl|CDD|180818 PRK07062, PRK07062, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235816 PRK06500, PRK06500, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180446 PRK06180, PRK06180, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|135637 PRK05876, PRK05876, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187609 cd05351, XR_like_SDR_c, xylulose reductase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|135637 PRK05876, PRK05876, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235725 PRK06179, PRK06179, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236209 PRK08265, PRK08265, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235725 PRK06179, PRK06179, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|131680 TIGR02632, RhaD_aldol-ADH, rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|180773 PRK06949, PRK06949, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|234422 TIGR03971, SDR_subfam_1, oxidoreductase, SDR family Back     alignment and domain information
>gnl|CDD|182051 PRK09730, PRK09730, putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|132368 TIGR03325, BphB_TodD, cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>gnl|CDD|181131 PRK07814, PRK07814, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235739 PRK06200, PRK06200, 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|188169 TIGR01829, AcAcCoA_reduct, acetoacetyl-CoA reductase Back     alignment and domain information
>gnl|CDD|181044 PRK07577, PRK07577, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181417 PRK08416, PRK08416, 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236116 PRK07856, PRK07856, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187640 cd08935, mannonate_red_SDR_c, putative D-mannonate oxidoreductase, classical (c) SDR Back     alignment and domain information
>gnl|CDD|181349 PRK08278, PRK08278, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236399 PRK09186, PRK09186, flagellin modification protein A; Provisional Back     alignment and domain information
>gnl|CDD|223696 COG0623, FabI, Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>gnl|CDD|236207 PRK08261, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|235853 PRK06701, PRK06701, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187607 cd05349, BKR_2_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP]reductase (BKR), subgroup 2, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187618 cd05360, SDR_c3, classical (c) SDR, subgroup 3 Back     alignment and domain information
>gnl|CDD|187664 cd09763, DHRS1-like_SDR_c, human dehydrogenase/reductase (SDR family) member 1 (DHRS1) -like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181605 PRK08993, PRK08993, 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187618 cd05360, SDR_c3, classical (c) SDR, subgroup 3 Back     alignment and domain information
>gnl|CDD|236372 PRK09072, PRK09072, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180576 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180822 PRK07069, PRK07069, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|183772 PRK12823, benD, 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235702 PRK06124, PRK06124, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187606 cd05348, BphB-like_SDR_c, cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase (BphB)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187628 cd05370, SDR_c2, classical (c) SDR, subgroup 2 Back     alignment and domain information
>gnl|CDD|187621 cd05363, SDH_SDR_c, Sorbitol dehydrogenase (SDH), classical (c) SDR Back     alignment and domain information
>gnl|CDD|187589 cd05328, 3alpha_HSD_SDR_c, alpha hydroxysteroid dehydrogenase (3alpha_HSD), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|171822 PRK12938, PRK12938, acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|171531 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236372 PRK09072, PRK09072, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181334 PRK08263, PRK08263, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|169389 PRK08339, PRK08339, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180408 PRK06114, PRK06114, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180411 PRK06123, PRK06123, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236207 PRK08261, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180448 PRK06182, PRK06182, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180448 PRK06182, PRK06182, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|237189 PRK12748, PRK12748, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|235545 PRK05650, PRK05650, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181297 PRK08217, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187628 cd05370, SDR_c2, classical (c) SDR, subgroup 2 Back     alignment and domain information
>gnl|CDD|235545 PRK05650, PRK05650, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183714 PRK12742, PRK12742, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|187608 cd05350, SDR_c6, classical (c) SDR, subgroup 6 Back     alignment and domain information
>gnl|CDD|180823 PRK07074, PRK07074, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|131680 TIGR02632, RhaD_aldol-ADH, rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|180413 PRK06128, PRK06128, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|235608 PRK05786, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187608 cd05350, SDR_c6, classical (c) SDR, subgroup 6 Back     alignment and domain information
>gnl|CDD|187586 cd05325, carb_red_sniffer_like_SDR_c, carbonyl reductase sniffer-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187641 cd08936, CR_SDR_c, Porcine peroxisomal carbonyl reductase like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181334 PRK08263, PRK08263, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180604 PRK06523, PRK06523, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187642 cd08937, DHB_DH-like_SDR_c, 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase (DHB DH)-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187629 cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydrogenase type 10 (HSD10)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|132368 TIGR03325, BphB_TodD, cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>gnl|CDD|187631 cd05373, SDR_c10, classical (c) SDR, subgroup 10 Back     alignment and domain information
>gnl|CDD|180343 PRK05993, PRK05993, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187631 cd05373, SDR_c10, classical (c) SDR, subgroup 10 Back     alignment and domain information
>gnl|CDD|235935 PRK07109, PRK07109, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187664 cd09763, DHRS1-like_SDR_c, human dehydrogenase/reductase (SDR family) member 1 (DHRS1) -like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180343 PRK05993, PRK05993, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187586 cd05325, carb_red_sniffer_like_SDR_c, carbonyl reductase sniffer-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181508 PRK08628, PRK08628, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187612 cd05354, SDR_c7, classical (c) SDR, subgroup 7 Back     alignment and domain information
>gnl|CDD|187612 cd05354, SDR_c7, classical (c) SDR, subgroup 7 Back     alignment and domain information
>gnl|CDD|130890 TIGR01831, fabG_rel, 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>gnl|CDD|183797 PRK12859, PRK12859, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181517 PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187592 cd05331, DH-DHB-DH_SDR_c, 2,3 dihydro-2,3 dihydrozybenzoate dehydrogenases, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187583 cd05322, SDH_SDR_c_like, Sorbitol 6-phosphate dehydrogenase (SDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235935 PRK07109, PRK07109, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|185674 cd00668, Ile_Leu_Val_MetRS_core, catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases Back     alignment and domain information
>gnl|CDD|237099 PRK12428, PRK12428, 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180744 PRK06914, PRK06914, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180744 PRK06914, PRK06914, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236399 PRK09186, PRK09186, flagellin modification protein A; Provisional Back     alignment and domain information
>gnl|CDD|135631 PRK05867, PRK05867, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181188 PRK07985, PRK07985, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|180458 PRK06194, PRK06194, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180458 PRK06194, PRK06194, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|237187 PRK12743, PRK12743, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|183718 PRK12746, PRK12746, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236056 PRK07576, PRK07576, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187662 cd09761, A3DFK9-like_SDR_c, Clostridium thermocellum A3DFK9-like, a putative carbohydrate or polyalcohol metabolizing SDR, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180300 PRK05875, PRK05875, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180771 PRK06947, PRK06947, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181020 PRK07533, PRK07533, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181416 PRK08415, PRK08415, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187630 cd05372, ENR_SDR, Enoyl acyl carrier protein (ACP) reductase (ENR), divergent SDR Back     alignment and domain information
>gnl|CDD|168186 PRK05693, PRK05693, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181335 PRK08264, PRK08264, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|183719 PRK12747, PRK12747, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|168186 PRK05693, PRK05693, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181335 PRK08264, PRK08264, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235975 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|235628 PRK05855, PRK05855, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|212491 cd05233, SDR_c, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|226476 COG3967, DltE, Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|235703 PRK06125, PRK06125, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235608 PRK05786, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180766 PRK06940, PRK06940, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|168204 PRK05717, PRK05717, oxidoreductase; Validated Back     alignment and domain information
>gnl|CDD|235628 PRK05855, PRK05855, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187663 cd09762, HSDL2_SDR_c, human hydroxysteroid dehydrogenase-like protein 2 (HSDL2), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235633 PRK05872, PRK05872, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|169556 PRK08703, PRK08703, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183714 PRK12742, PRK12742, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|169390 PRK08340, PRK08340, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187663 cd09762, HSDL2_SDR_c, human hydroxysteroid dehydrogenase-like protein 2 (HSDL2), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235633 PRK05872, PRK05872, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181762 PRK09291, PRK09291, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|131732 TIGR02685, pter_reduc_Leis, pteridine reductase Back     alignment and domain information
>gnl|CDD|169556 PRK08703, PRK08703, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183716 PRK12744, PRK12744, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181120 PRK07792, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187591 cd05330, cyclohexanol_reductase_SDR_c, cyclohexanol reductases, including levodione reductase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181762 PRK09291, PRK09291, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236389 PRK09134, PRK09134, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187625 cd05367, SPR-like_SDR_c, sepiapterin reductase (SPR)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181077 PRK07677, PRK07677, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|226476 COG3967, DltE, Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|187625 cd05367, SPR-like_SDR_c, sepiapterin reductase (SPR)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236308 PRK08594, PRK08594, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180949 PRK07370, PRK07370, enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|132250 TIGR03206, benzo_BadH, 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|187619 cd05361, haloalcohol_DH_SDR_c-like, haloalcohol dehalogenase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236099 PRK07791, PRK07791, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237306 PRK13208, valS, valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|181298 PRK08219, PRK08219, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223696 COG0623, FabI, Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>gnl|CDD|235506 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181298 PRK08219, PRK08219, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235546 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|181139 PRK07832, PRK07832, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235962 PRK07201, PRK07201, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235914 PRK07041, PRK07041, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235631 PRK05866, PRK05866, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235813 PRK06482, PRK06482, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|171822 PRK12938, PRK12938, acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|183775 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>gnl|CDD|181416 PRK08415, PRK08415, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|235962 PRK07201, PRK07201, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235813 PRK06482, PRK06482, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183716 PRK12744, PRK12744, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181139 PRK07832, PRK07832, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235631 PRK05866, PRK05866, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187636 cd08931, SDR_c9, classical (c) SDR, subgroup 9 Back     alignment and domain information
>gnl|CDD|187666 cd09806, type1_17beta-HSD-like_SDR_c, human estrogenic 17beta-hydroxysteroid dehydrogenase type 1 (type 1 17beta-HSD)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187666 cd09806, type1_17beta-HSD-like_SDR_c, human estrogenic 17beta-hydroxysteroid dehydrogenase type 1 (type 1 17beta-HSD)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187636 cd08931, SDR_c9, classical (c) SDR, subgroup 9 Back     alignment and domain information
>gnl|CDD|187641 cd08936, CR_SDR_c, Porcine peroxisomal carbonyl reductase like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|182051 PRK09730, PRK09730, putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|212497 cd11731, Lin1944_like_SDR_c, Lin1944 and related proteins, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181126 PRK07806, PRK07806, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235500 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|237218 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|212497 cd11731, Lin1944_like_SDR_c, Lin1944 and related proteins, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235713 PRK06139, PRK06139, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235713 PRK06139, PRK06139, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181126 PRK07806, PRK07806, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187603 cd05345, BKR_3_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR), subgroup 3, classical (c) SDR Back     alignment and domain information
>gnl|CDD|235914 PRK07041, PRK07041, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181260 PRK08159, PRK08159, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|232953 TIGR00392, ileS, isoleucyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|169553 PRK08690, PRK08690, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181120 PRK07792, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|233590 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>gnl|CDD|235694 PRK06079, PRK06079, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187665 cd09805, type2_17beta_HSD-like_SDR_c, human 17beta-hydroxysteroid dehydrogenase type 2 (type 2 17beta-HSD)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187665 cd09805, type2_17beta_HSD-like_SDR_c, human 17beta-hydroxysteroid dehydrogenase type 2 (type 2 17beta-HSD)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181113 PRK07775, PRK07775, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223138 COG0060, IleS, Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|237100 PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187535 cd02266, SDR, Short-chain dehydrogenases/reductases (SDR) Back     alignment and domain information
>gnl|CDD|223959 COG1028, FabG, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|187602 cd05344, BKR_like_SDR_like, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR)-like, SDR Back     alignment and domain information
>gnl|CDD|183833 PRK12939, PRK12939, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236241 PRK08324, PRK08324, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|236389 PRK09134, PRK09134, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236099 PRK07791, PRK07791, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180802 PRK07035, PRK07035, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181417 PRK08416, PRK08416, 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180617 PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181113 PRK07775, PRK07775, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181044 PRK07577, PRK07577, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180766 PRK06940, PRK06940, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236210 PRK08267, PRK08267, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187594 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein reductase (BKR), involved in Type II FAS, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|211705 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>gnl|CDD|187632 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|212495 cd09807, retinol-DH_like_SDR_c, retinol dehydrogenases (retinol-DHs), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|212495 cd09807, retinol-DH_like_SDR_c, retinol dehydrogenases (retinol-DHs), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187669 cd09809, human_WWOX_like_SDR_c-like, human WWOX (WW domain-containing oxidoreductase)-like, classical (c)-like SDRs Back     alignment and domain information
>gnl|CDD|187669 cd09809, human_WWOX_like_SDR_c-like, human WWOX (WW domain-containing oxidoreductase)-like, classical (c)-like SDRs Back     alignment and domain information
>gnl|CDD|173909 cd00818, IleRS_core, catalytic core domain of isoleucyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|187617 cd05359, ChcA_like_SDR_c, 1-cyclohexenylcarbonyl_coenzyme A_reductase (ChcA)_like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187647 cd08943, R1PA_ADH_SDR_c, rhamnulose-1-phosphate aldolase/alcohol dehydrogenase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187535 cd02266, SDR, Short-chain dehydrogenases/reductases (SDR) Back     alignment and domain information
>gnl|CDD|168626 PRK06603, PRK06603, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180984 PRK07454, PRK07454, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|131732 TIGR02685, pter_reduc_Leis, pteridine reductase Back     alignment and domain information
>gnl|CDD|236308 PRK08594, PRK08594, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187593 cd05332, 11beta-HSD1_like_SDR_c, 11beta-hydroxysteroid dehydrogenase type 1 (11beta-HSD1)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236210 PRK08267, PRK08267, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187648 cd08944, SDR_c12, classical (c) SDR, subgroup 12 Back     alignment and domain information
>gnl|CDD|187613 cd05355, SDR_c1, classical (c) SDR, subgroup 1 Back     alignment and domain information
>gnl|CDD|180439 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|212493 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|180723 PRK06841, PRK06841, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235925 PRK07067, PRK07067, sorbitol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187635 cd08930, SDR_c8, classical (c) SDR, subgroup 8 Back     alignment and domain information
>gnl|CDD|182531 PRK10538, PRK10538, malonic semialdehyde reductase; Provisional Back     alignment and domain information
>gnl|CDD|182531 PRK10538, PRK10538, malonic semialdehyde reductase; Provisional Back     alignment and domain information
>gnl|CDD|166421 PLN02780, PLN02780, ketoreductase/ oxidoreductase Back     alignment and domain information
>gnl|CDD|180753 PRK06924, PRK06924, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235794 PRK06398, PRK06398, aldose dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|226674 COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>gnl|CDD|235910 PRK07024, PRK07024, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181198 PRK08017, PRK08017, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|235681 PRK06039, ileS, isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|187611 cd05353, hydroxyacyl-CoA-like_DH_SDR_c-like, (3R)-hydroxyacyl-CoA dehydrogenase-like, classical(c)-like SDRs Back     alignment and domain information
>gnl|CDD|180949 PRK07370, PRK07370, enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|166421 PLN02780, PLN02780, ketoreductase/ oxidoreductase Back     alignment and domain information
>gnl|CDD|181198 PRK08017, PRK08017, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|178331 PLN02730, PLN02730, enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>gnl|CDD|235910 PRK07024, PRK07024, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181295 PRK08213, PRK08213, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|212491 cd05233, SDR_c, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|223959 COG1028, FabG, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|187605 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogenase (Ga5DH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180993 PRK07478, PRK07478, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236145 PRK08063, PRK08063, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187598 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hydroxysteroid dehydrogenase XI-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235975 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|237218 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|235712 PRK06138, PRK06138, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187600 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235924 PRK07063, PRK07063, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180753 PRK06924, PRK06924, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235627 PRK05854, PRK05854, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187654 cd08951, DR_C-13_KR_SDR_c_like, daunorubicin C-13 ketoreductase (KR), classical (c)-like SDRs Back     alignment and domain information
>gnl|CDD|180802 PRK07035, PRK07035, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187620 cd05362, THN_reductase-like_SDR_c, tetrahydroxynaphthalene/trihydroxynaphthalene reductase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180822 PRK07069, PRK07069, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187654 cd08951, DR_C-13_KR_SDR_c_like, daunorubicin C-13 ketoreductase (KR), classical (c)-like SDRs Back     alignment and domain information
>gnl|CDD|187595 cd05334, DHPR_SDR_c_like, dihydropteridine reductase (DHPR), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187589 cd05328, 3alpha_HSD_SDR_c, alpha hydroxysteroid dehydrogenase (3alpha_HSD), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181260 PRK08159, PRK08159, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187616 cd05358, GlcDH_SDR_c, glucose 1 dehydrogenase (GlcDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180761 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180586 PRK06483, PRK06483, dihydromonapterin reductase; Provisional Back     alignment and domain information
>gnl|CDD|187584 cd05323, ADH_SDR_c_like, insect type alcohol dehydrogenase (ADH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180596 PRK06505, PRK06505, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|183778 PRK12829, PRK12829, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180371 PRK06057, PRK06057, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237219 PRK12827, PRK12827, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235776 PRK06300, PRK06300, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180440 PRK06172, PRK06172, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183773 PRK12824, PRK12824, acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|184025 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235725 PRK06179, PRK06179, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187586 cd05325, carb_red_sniffer_like_SDR_c, carbonyl reductase sniffer-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180744 PRK06914, PRK06914, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181020 PRK07533, PRK07533, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|235736 PRK06196, PRK06196, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|235500 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|187626 cd05368, DHRS6_like_SDR_c, human DHRS6-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187644 cd08940, HBDH_SDR_c, d-3-hydroxybutyrate dehydrogenase (HBDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236357 PRK08945, PRK08945, putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|237099 PRK12428, PRK12428, 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180586 PRK06483, PRK06483, dihydromonapterin reductase; Provisional Back     alignment and domain information
>gnl|CDD|181305 PRK08226, PRK08226, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187585 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicular carbonyl reductase (PTCR)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187604 cd05346, SDR_c5, classical (c) SDR, subgroup 5 Back     alignment and domain information
>gnl|CDD|180789 PRK06997, PRK06997, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|235694 PRK06079, PRK06079, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|236124 PRK07889, PRK07889, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181491 PRK08589, PRK08589, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187587 cd05326, secoisolariciresinol-DH_like_SDR_c, secoisolariciresinol dehydrogenase (secoisolariciresinol-DH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180300 PRK05875, PRK05875, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180448 PRK06182, PRK06182, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181159 PRK07890, PRK07890, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187615 cd05357, PR_SDR_c, pteridine reductase (PR), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236094 PRK07774, PRK07774, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236074 PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181187 PRK07984, PRK07984, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|235736 PRK06196, PRK06196, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|235546 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|180462 PRK06198, PRK06198, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183775 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>gnl|CDD|180993 PRK07478, PRK07478, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187622 cd05364, SDR_c11, classical (c) SDR, subgroup 11 Back     alignment and domain information
>gnl|CDD|187597 cd05338, DHRS1_HSDL2-like_SDR_c, human dehydrogenase/reductase (SDR family) member 1 (DHRS1) and human hydroxysteroid dehydrogenase-like protein 2 (HSDL2), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181334 PRK08263, PRK08263, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187595 cd05334, DHPR_SDR_c_like, dihydropteridine reductase (DHPR), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235506 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187594 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein reductase (BKR), involved in Type II FAS, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187605 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogenase (Ga5DH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|237220 PRK12828, PRK12828, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|234422 TIGR03971, SDR_subfam_1, oxidoreductase, SDR family Back     alignment and domain information
>gnl|CDD|187609 cd05351, XR_like_SDR_c, xylulose reductase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187619 cd05361, haloalcohol_DH_SDR_c-like, haloalcohol dehalogenase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180446 PRK06180, PRK06180, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187666 cd09806, type1_17beta-HSD-like_SDR_c, human estrogenic 17beta-hydroxysteroid dehydrogenase type 1 (type 1 17beta-HSD)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235627 PRK05854, PRK05854, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236110 PRK07831, PRK07831, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187626 cd05368, DHRS6_like_SDR_c, human DHRS6-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187635 cd08930, SDR_c8, classical (c) SDR, subgroup 8 Back     alignment and domain information
>gnl|CDD|183832 PRK12935, PRK12935, acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|188170 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>gnl|CDD|181668 PRK09135, PRK09135, pteridine reductase; Provisional Back     alignment and domain information
>gnl|CDD|181305 PRK08226, PRK08226, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237219 PRK12827, PRK12827, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183778 PRK12829, PRK12829, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|188169 TIGR01829, AcAcCoA_reduct, acetoacetyl-CoA reductase Back     alignment and domain information
>gnl|CDD|215452 PLN02843, PLN02843, isoleucyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|237188 PRK12745, PRK12745, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181225 PRK08085, PRK08085, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187614 cd05356, 17beta-HSD1_like_SDR_c, 17-beta-hydroxysteroid dehydrogenases (17beta-HSDs) types -1, -3, and -12, -like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235737 PRK06197, PRK06197, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181721 PRK09242, PRK09242, tropinone reductase; Provisional Back     alignment and domain information
>gnl|CDD|187622 cd05364, SDR_c11, classical (c) SDR, subgroup 11 Back     alignment and domain information
>gnl|CDD|235693 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|223377 COG0300, DltE, Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>gnl|CDD|235853 PRK06701, PRK06701, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236357 PRK08945, PRK08945, putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|168626 PRK06603, PRK06603, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187645 cd08941, 3KS_SDR_c, 3-keto steroid reductase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180817 PRK07060, PRK07060, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|171820 PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>gnl|CDD|187634 cd08929, SDR_c4, classical (c) SDR, subgroup 4 Back     alignment and domain information
>gnl|CDD|187632 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187639 cd08934, CAD_SDR_c, clavulanic acid dehydrogenase (CAD), classical (c) SDR Back     alignment and domain information
>gnl|CDD|187645 cd08941, 3KS_SDR_c, 3-keto steroid reductase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|233590 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>gnl|CDD|180761 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235693 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180617 PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|131680 TIGR02632, RhaD_aldol-ADH, rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|181324 PRK08251, PRK08251, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187627 cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reductase (TER) and 2,4-dienoyl-CoA reductase (DECR), atypical (a) SDR Back     alignment and domain information
>gnl|CDD|187646 cd08942, RhlG_SDR_c, RhlG and related beta-ketoacyl reductases, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235712 PRK06138, PRK06138, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187649 cd08945, PKR_SDR_c, Polyketide ketoreductase, classical (c) SDR Back     alignment and domain information
>gnl|CDD|215720 pfam00106, adh_short, short chain dehydrogenase Back     alignment and domain information
>gnl|CDD|187596 cd05337, BKR_1_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR), subgroup 1, classical (c) SDR Back     alignment and domain information
>gnl|CDD|168204 PRK05717, PRK05717, oxidoreductase; Validated Back     alignment and domain information
>gnl|CDD|187668 cd09808, DHRS-12_like_SDR_c-like, human dehydrogenase/reductase SDR family member (DHRS)-12/FLJ13639-like, classical (c)-like SDRs Back     alignment and domain information
>gnl|CDD|187646 cd08942, RhlG_SDR_c, RhlG and related beta-ketoacyl reductases, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181605 PRK08993, PRK08993, 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187599 cd05340, Ycik_SDR_c, Escherichia coli K-12 YCIK-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187668 cd09808, DHRS-12_like_SDR_c-like, human dehydrogenase/reductase SDR family member (DHRS)-12/FLJ13639-like, classical (c)-like SDRs Back     alignment and domain information
>gnl|CDD|187616 cd05358, GlcDH_SDR_c, glucose 1 dehydrogenase (GlcDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|211705 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>gnl|CDD|187585 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicular carbonyl reductase (PTCR)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|130890 TIGR01831, fabG_rel, 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>gnl|CDD|237187 PRK12743, PRK12743, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|187607 cd05349, BKR_2_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP]reductase (BKR), subgroup 2, classical (c) SDR Back     alignment and domain information
>gnl|CDD|181762 PRK09291, PRK09291, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|232955 TIGR00395, leuS_arch, leucyl-tRNA synthetase, archaeal and cytosolic family Back     alignment and domain information
>gnl|CDD|236190 PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235813 PRK06482, PRK06482, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187670 cd09810, LPOR_like_SDR_c_like, light-dependent protochlorophyllide reductase (LPOR)-like, classical (c)-like SDRs Back     alignment and domain information
>gnl|CDD|187624 cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|131468 TIGR02415, 23BDH, acetoin reductases Back     alignment and domain information
>gnl|CDD|235924 PRK07063, PRK07063, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236209 PRK08265, PRK08265, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|213929 TIGR04316, dhbA_paeA, 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase Back     alignment and domain information
>gnl|CDD|235933 PRK07097, PRK07097, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187638 cd08933, RDH_SDR_c, retinal dehydrogenase-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187591 cd05330, cyclohexanol_reductase_SDR_c, cyclohexanol reductases, including levodione reductase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|223569 COG0495, LeuS, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|180669 PRK06720, PRK06720, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|236342 PRK08862, PRK08862, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|233441 TIGR01500, sepiapter_red, sepiapterin reductase Back     alignment and domain information
>gnl|CDD|187590 cd05329, TR_SDR_c, tropinone reductase-I and II (TR-1, and TR-II)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187587 cd05326, secoisolariciresinol-DH_like_SDR_c, secoisolariciresinol dehydrogenase (secoisolariciresinol-DH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235816 PRK06500, PRK06500, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187612 cd05354, SDR_c7, classical (c) SDR, subgroup 7 Back     alignment and domain information
>gnl|CDD|235737 PRK06197, PRK06197, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236342 PRK08862, PRK08862, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181518 PRK08643, PRK08643, acetoin reductase; Validated Back     alignment and domain information
>gnl|CDD|236094 PRK07774, PRK07774, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180773 PRK06949, PRK06949, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237187 PRK12743, PRK12743, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|135631 PRK05867, PRK05867, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187629 cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydrogenase type 10 (HSD10)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236207 PRK08261, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|235545 PRK05650, PRK05650, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|233441 TIGR01500, sepiapter_red, sepiapterin reductase Back     alignment and domain information
>gnl|CDD|187620 cd05362, THN_reductase-like_SDR_c, tetrahydroxynaphthalene/trihydroxynaphthalene reductase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|171531 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187599 cd05340, Ycik_SDR_c, Escherichia coli K-12 YCIK-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235726 PRK06181, PRK06181, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187608 cd05350, SDR_c6, classical (c) SDR, subgroup 6 Back     alignment and domain information
>gnl|CDD|180796 PRK07023, PRK07023, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187624 cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187610 cd05352, MDH-like_SDR_c, mannitol dehydrogenase (MDH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187662 cd09761, A3DFK9-like_SDR_c, Clostridium thermocellum A3DFK9-like, a putative carbohydrate or polyalcohol metabolizing SDR, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181324 PRK08251, PRK08251, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180669 PRK06720, PRK06720, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|183833 PRK12939, PRK12939, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187601 cd05343, Mgc4172-like_SDR_c, human Mgc4172-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187670 cd09810, LPOR_like_SDR_c_like, light-dependent protochlorophyllide reductase (LPOR)-like, classical (c)-like SDRs Back     alignment and domain information
>gnl|CDD|187623 cd05365, 7_alpha_HSDH_SDR_c, 7 alpha-hydroxysteroid dehydrogenase (7 alpha-HSDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180408 PRK06114, PRK06114, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181136 PRK07825, PRK07825, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|169553 PRK08690, PRK08690, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|237100 PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187592 cd05331, DH-DHB-DH_SDR_c, 2,3 dihydro-2,3 dihydrozybenzoate dehydrogenases, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236229 PRK08303, PRK08303, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|171821 PRK12937, PRK12937, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|135765 PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|223377 COG0300, DltE, Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>gnl|CDD|181668 PRK09135, PRK09135, pteridine reductase; Provisional Back     alignment and domain information
>gnl|CDD|187606 cd05348, BphB-like_SDR_c, cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase (BphB)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180604 PRK06523, PRK06523, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187615 cd05357, PR_SDR_c, pteridine reductase (PR), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|234422 TIGR03971, SDR_subfam_1, oxidoreductase, SDR family Back     alignment and domain information
>gnl|CDD|187621 cd05363, SDH_SDR_c, Sorbitol dehydrogenase (SDH), classical (c) SDR Back     alignment and domain information
>gnl|CDD|187664 cd09763, DHRS1-like_SDR_c, human dehydrogenase/reductase (SDR family) member 1 (DHRS1) -like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181335 PRK08264, PRK08264, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|236124 PRK07889, PRK07889, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|236229 PRK08303, PRK08303, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235588 PRK05743, ileS, isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|223221 COG0143, MetG, Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|187648 cd08944, SDR_c12, classical (c) SDR, subgroup 12 Back     alignment and domain information
>gnl|CDD|183773 PRK12824, PRK12824, acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|135765 PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180817 PRK07060, PRK07060, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|222222 pfam13561, adh_short_C2, Enoyl-(Acyl carrier protein) reductase Back     alignment and domain information
>gnl|CDD|171820 PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>gnl|CDD|237220 PRK12828, PRK12828, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187640 cd08935, mannonate_red_SDR_c, putative D-mannonate oxidoreductase, classical (c) SDR Back     alignment and domain information
>gnl|CDD|177895 PLN02253, PLN02253, xanthoxin dehydrogenase Back     alignment and domain information
>gnl|CDD|177895 PLN02253, PLN02253, xanthoxin dehydrogenase Back     alignment and domain information
>gnl|CDD|187630 cd05372, ENR_SDR, Enoyl acyl carrier protein (ACP) reductase (ENR), divergent SDR Back     alignment and domain information
>gnl|CDD|180984 PRK07454, PRK07454, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187631 cd05373, SDR_c10, classical (c) SDR, subgroup 10 Back     alignment and domain information
>gnl|CDD|236173 PRK08177, PRK08177, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|212496 cd11730, Tthb094_like_SDR_c, Tthb094 and related proteins, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|212496 cd11730, Tthb094_like_SDR_c, Tthb094 and related proteins, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|237012 PRK11893, PRK11893, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|173906 cd00812, LeuRS_core, catalytic core domain of leucyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|234743 PRK00390, leuS, leucyl-tRNA synthetase; Validated Back     alignment and domain information
>gnl|CDD|181295 PRK08213, PRK08213, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235794 PRK06398, PRK06398, aldose dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235990 PRK07326, PRK07326, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235702 PRK06124, PRK06124, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181159 PRK07890, PRK07890, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|132368 TIGR03325, BphB_TodD, cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>gnl|CDD|187623 cd05365, 7_alpha_HSDH_SDR_c, 7 alpha-hydroxysteroid dehydrogenase (7 alpha-HSDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|213929 TIGR04316, dhbA_paeA, 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase Back     alignment and domain information
>gnl|CDD|188170 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>gnl|CDD|183489 PRK12384, PRK12384, sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235739 PRK06200, PRK06200, 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180596 PRK06505, PRK06505, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|236173 PRK08177, PRK08177, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187590 cd05329, TR_SDR_c, tropinone reductase-I and II (TR-1, and TR-II)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|171821 PRK12937, PRK12937, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180462 PRK06198, PRK06198, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237188 PRK12745, PRK12745, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187609 cd05351, XR_like_SDR_c, xylulose reductase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187602 cd05344, BKR_like_SDR_like, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR)-like, SDR Back     alignment and domain information
>gnl|CDD|180576 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|171531 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236216 PRK08277, PRK08277, D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|187592 cd05331, DH-DHB-DH_SDR_c, 2,3 dihydro-2,3 dihydrozybenzoate dehydrogenases, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|183718 PRK12746, PRK12746, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180771 PRK06947, PRK06947, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180343 PRK05993, PRK05993, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187663 cd09762, HSDL2_SDR_c, human hydroxysteroid dehydrogenase-like protein 2 (HSDL2), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|131732 TIGR02685, pter_reduc_Leis, pteridine reductase Back     alignment and domain information
>gnl|CDD|180586 PRK06483, PRK06483, dihydromonapterin reductase; Provisional Back     alignment and domain information
>gnl|CDD|187617 cd05359, ChcA_like_SDR_c, 1-cyclohexenylcarbonyl_coenzyme A_reductase (ChcA)_like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180440 PRK06172, PRK06172, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|184025 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187634 cd08929, SDR_c4, classical (c) SDR, subgroup 4 Back     alignment and domain information
>gnl|CDD|236209 PRK08265, PRK08265, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187643 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine reductase (KDSR) and related proteins, classical (c) SDR Back     alignment and domain information
>gnl|CDD|132250 TIGR03206, benzo_BadH, 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|181349 PRK08278, PRK08278, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236399 PRK09186, PRK09186, flagellin modification protein A; Provisional Back     alignment and domain information
>gnl|CDD|236389 PRK09134, PRK09134, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223528 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|187603 cd05345, BKR_3_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR), subgroup 3, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187600 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181585 PRK08936, PRK08936, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180723 PRK06841, PRK06841, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181225 PRK08085, PRK08085, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235853 PRK06701, PRK06701, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236190 PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187596 cd05337, BKR_1_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR), subgroup 1, classical (c) SDR Back     alignment and domain information
>gnl|CDD|180413 PRK06128, PRK06128, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|135631 PRK05867, PRK05867, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|212492 cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181044 PRK07577, PRK07577, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236372 PRK09072, PRK09072, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|168186 PRK05693, PRK05693, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|173907 cd00814, MetRS_core, catalytic core domain of methioninyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|187613 cd05355, SDR_c1, classical (c) SDR, subgroup 1 Back     alignment and domain information
>gnl|CDD|187644 cd08940, HBDH_SDR_c, d-3-hydroxybutyrate dehydrogenase (HBDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235990 PRK07326, PRK07326, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236116 PRK07856, PRK07856, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180604 PRK06523, PRK06523, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181297 PRK08217, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181188 PRK07985, PRK07985, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|180771 PRK06947, PRK06947, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|171822 PRK12938, PRK12938, acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|181762 PRK09291, PRK09291, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181120 PRK07792, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|182531 PRK10538, PRK10538, malonic semialdehyde reductase; Provisional Back     alignment and domain information
>gnl|CDD|232957 TIGR00398, metG, methionyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|135642 PRK05884, PRK05884, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237514 PRK13804, ileS, isoleucyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|181491 PRK08589, PRK08589, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187610 cd05352, MDH-like_SDR_c, mannitol dehydrogenase (MDH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|222222 pfam13561, adh_short_C2, Enoyl-(Acyl carrier protein) reductase Back     alignment and domain information
>gnl|CDD|236241 PRK08324, PRK08324, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|183489 PRK12384, PRK12384, sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180411 PRK06123, PRK06123, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181517 PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|168204 PRK05717, PRK05717, oxidoreductase; Validated Back     alignment and domain information
>gnl|CDD|180446 PRK06180, PRK06180, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187586 cd05325, carb_red_sniffer_like_SDR_c, carbonyl reductase sniffer-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236016 PRK07424, PRK07424, bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|220185 pfam09334, tRNA-synt_1g, tRNA synthetases class I (M) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 762
PRK06484520 short chain dehydrogenase; Validated 100.0
KOG1200|consensus256 100.0
PRK06484 520 short chain dehydrogenase; Validated 100.0
KOG0725|consensus270 100.0
PRK08339263 short chain dehydrogenase; Provisional 100.0
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 100.0
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 100.0
PLN02730303 enoyl-[acyl-carrier-protein] reductase 100.0
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
KOG1200|consensus256 100.0
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 100.0
PRK07063260 short chain dehydrogenase; Provisional 100.0
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK05867253 short chain dehydrogenase; Provisional 100.0
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 100.0
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 100.0
PRK06114254 short chain dehydrogenase; Provisional 100.0
PRK07478254 short chain dehydrogenase; Provisional 100.0
PRK07062265 short chain dehydrogenase; Provisional 100.0
PRK08589272 short chain dehydrogenase; Validated 100.0
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK08340259 glucose-1-dehydrogenase; Provisional 100.0
PRK08085254 gluconate 5-dehydrogenase; Provisional 100.0
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 100.0
PRK07791286 short chain dehydrogenase; Provisional 100.0
PRK08277278 D-mannonate oxidoreductase; Provisional 100.0
PRK08303305 short chain dehydrogenase; Provisional 100.0
PRK12747252 short chain dehydrogenase; Provisional 100.0
PRK08265261 short chain dehydrogenase; Provisional 100.0
PRK07985294 oxidoreductase; Provisional 100.0
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 100.0
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 100.0
KOG1207|consensus245 100.0
PRK06398258 aldose dehydrogenase; Validated 100.0
PRK06128300 oxidoreductase; Provisional 100.0
PRK06172253 short chain dehydrogenase; Provisional 100.0
PRK07035252 short chain dehydrogenase; Provisional 100.0
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 100.0
PRK07831262 short chain dehydrogenase; Provisional 100.0
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 100.0
PRK07201657 short chain dehydrogenase; Provisional 100.0
PRK06125259 short chain dehydrogenase; Provisional 100.0
PRK07523255 gluconate 5-dehydrogenase; Provisional 100.0
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 100.0
COG0300265 DltE Short-chain dehydrogenases of various substra 100.0
PRK07677252 short chain dehydrogenase; Provisional 100.0
PRK06940275 short chain dehydrogenase; Provisional 100.0
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
KOG0725|consensus270 100.0
KOG1205|consensus282 100.0
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 100.0
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 100.0
PRK09242257 tropinone reductase; Provisional 100.0
PRK08339263 short chain dehydrogenase; Provisional 100.0
PRK08643256 acetoin reductase; Validated 100.0
PRK07856252 short chain dehydrogenase; Provisional 100.0
PRK08936261 glucose-1-dehydrogenase; Provisional 100.0
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 100.0
PLN02253280 xanthoxin dehydrogenase 100.0
PRK07097265 gluconate 5-dehydrogenase; Provisional 100.0
PRK06124256 gluconate 5-dehydrogenase; Provisional 100.0
PRK06483236 dihydromonapterin reductase; Provisional 100.0
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
KOG1205|consensus282 100.0
PRK08226263 short chain dehydrogenase; Provisional 100.0
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK06523260 short chain dehydrogenase; Provisional 100.0
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK06841255 short chain dehydrogenase; Provisional 100.0
PRK07067257 sorbitol dehydrogenase; Provisional 100.0
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK07576264 short chain dehydrogenase; Provisional 100.0
PRK12743256 oxidoreductase; Provisional 100.0
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 100.0
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 100.0
PRK08862227 short chain dehydrogenase; Provisional 100.0
PRK12938246 acetyacetyl-CoA reductase; Provisional 100.0
COG0300265 DltE Short-chain dehydrogenases of various substra 100.0
PLN02730303 enoyl-[acyl-carrier-protein] reductase 100.0
PRK06949258 short chain dehydrogenase; Provisional 100.0
PRK07890258 short chain dehydrogenase; Provisional 100.0
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK05717255 oxidoreductase; Validated 100.0
PRK05867253 short chain dehydrogenase; Provisional 100.0
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 100.0
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 100.0
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 100.0
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK07063260 short chain dehydrogenase; Provisional 100.0
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK12742237 oxidoreductase; Provisional 100.0
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 100.0
PRK07814263 short chain dehydrogenase; Provisional 100.0
PRK05884223 short chain dehydrogenase; Provisional 100.0
PRK05872296 short chain dehydrogenase; Provisional 100.0
PRK06500249 short chain dehydrogenase; Provisional 100.0
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK08303305 short chain dehydrogenase; Provisional 100.0
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 100.0
PRK08589272 short chain dehydrogenase; Validated 100.0
PRK08278273 short chain dehydrogenase; Provisional 100.0
PRK07062265 short chain dehydrogenase; Provisional 100.0
PRK08628258 short chain dehydrogenase; Provisional 100.0
KOG1201|consensus300 100.0
PRK06701290 short chain dehydrogenase; Provisional 100.0
PRK07069251 short chain dehydrogenase; Validated 100.0
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK07478254 short chain dehydrogenase; Provisional 100.0
PRK09186256 flagellin modification protein A; Provisional 100.0
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 100.0
TIGR02415254 23BDH acetoin reductases. One member of this famil 100.0
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 100.0
PRK07791286 short chain dehydrogenase; Provisional 100.0
PRK06114254 short chain dehydrogenase; Provisional 100.0
PRK12744257 short chain dehydrogenase; Provisional 100.0
PRK06123248 short chain dehydrogenase; Provisional 100.0
PRK12937245 short chain dehydrogenase; Provisional 100.0
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 100.0
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 100.0
PRK05875276 short chain dehydrogenase; Provisional 100.0
KOG1199|consensus260 100.0
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK12939250 short chain dehydrogenase; Provisional 100.0
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK08213259 gluconate 5-dehydrogenase; Provisional 100.0
PRK05599246 hypothetical protein; Provisional 100.0
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK06057255 short chain dehydrogenase; Provisional 100.0
PRK06947248 glucose-1-dehydrogenase; Provisional 100.0
PRK06139330 short chain dehydrogenase; Provisional 100.0
PRK08085254 gluconate 5-dehydrogenase; Provisional 100.0
KOG1201|consensus300 100.0
PRK08277278 D-mannonate oxidoreductase; Provisional 100.0
PRK06198260 short chain dehydrogenase; Provisional 100.0
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 100.0
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 100.0
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 100.0
PRK08703239 short chain dehydrogenase; Provisional 100.0
PRK08340259 glucose-1-dehydrogenase; Provisional 100.0
PRK08265261 short chain dehydrogenase; Provisional 100.0
PRK12824245 acetoacetyl-CoA reductase; Provisional 100.0
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 100.0
PLN00015308 protochlorophyllide reductase 100.0
PRK12747252 short chain dehydrogenase; Provisional 100.0
PRK06138252 short chain dehydrogenase; Provisional 100.0
KOG4169|consensus261 100.0
PRK07985294 oxidoreductase; Provisional 100.0
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 100.0
PRK12935247 acetoacetyl-CoA reductase; Provisional 100.0
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 100.0
PRK07109334 short chain dehydrogenase; Provisional 100.0
PRK06398258 aldose dehydrogenase; Validated 100.0
PRK07523255 gluconate 5-dehydrogenase; Provisional 100.0
PRK06172253 short chain dehydrogenase; Provisional 100.0
PRK06128300 oxidoreductase; Provisional 100.0
COG1028251 FabG Dehydrogenases with different specificities ( 100.0
PRK05876275 short chain dehydrogenase; Provisional 100.0
PRK08862227 short chain dehydrogenase; Provisional 100.0
PRK09134258 short chain dehydrogenase; Provisional 100.0
PRK07035252 short chain dehydrogenase; Provisional 100.0
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 100.0
PRK07060245 short chain dehydrogenase; Provisional 100.0
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK07774250 short chain dehydrogenase; Provisional 100.0
PRK07831262 short chain dehydrogenase; Provisional 100.0
PRK06182273 short chain dehydrogenase; Validated 100.0
PRK12746254 short chain dehydrogenase; Provisional 100.0
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 100.0
KOG1207|consensus245 100.0
PRK06125259 short chain dehydrogenase; Provisional 100.0
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 100.0
PRK07097265 gluconate 5-dehydrogenase; Provisional 100.0
PRK07074257 short chain dehydrogenase; Provisional 100.0
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 100.0
PRK07832272 short chain dehydrogenase; Provisional 100.0
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK05855582 short chain dehydrogenase; Validated 100.0
PRK07577234 short chain dehydrogenase; Provisional 100.0
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 100.0
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 100.0
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 100.0
PRK06139330 short chain dehydrogenase; Provisional 100.0
PRK05876275 short chain dehydrogenase; Provisional 100.0
PLN02253280 xanthoxin dehydrogenase 100.0
PRK08643256 acetoin reductase; Validated 100.0
PRK07677252 short chain dehydrogenase; Provisional 100.0
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK06940275 short chain dehydrogenase; Provisional 100.0
PRK12827249 short chain dehydrogenase; Provisional 100.0
PRK09242257 tropinone reductase; Provisional 100.0
PRK08936261 glucose-1-dehydrogenase; Provisional 100.0
PRK09009235 C factor cell-cell signaling protein; Provisional 100.0
PRK07041230 short chain dehydrogenase; Provisional 100.0
PRK05872296 short chain dehydrogenase; Provisional 100.0
PRK07856252 short chain dehydrogenase; Provisional 100.0
PRK06924251 short chain dehydrogenase; Provisional 100.0
PRK07825273 short chain dehydrogenase; Provisional 100.0
COG0623259 FabI Enoyl-[acyl-carrier-protein] 100.0
PLN02780320 ketoreductase/ oxidoreductase 100.0
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 100.0
PRK05599246 hypothetical protein; Provisional 100.0
PRK06483236 dihydromonapterin reductase; Provisional 100.0
PRK06196315 oxidoreductase; Provisional 100.0
PRK06124256 gluconate 5-dehydrogenase; Provisional 100.0
PRK06523260 short chain dehydrogenase; Provisional 100.0
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 100.0
KOG4169|consensus261 100.0
PRK08324681 short chain dehydrogenase; Validated 100.0
PRK07454241 short chain dehydrogenase; Provisional 100.0
PRK08226263 short chain dehydrogenase; Provisional 100.0
PRK07067257 sorbitol dehydrogenase; Provisional 100.0
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 100.0
PRK06180277 short chain dehydrogenase; Provisional 100.0
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 100.0
PRK12938246 acetyacetyl-CoA reductase; Provisional 100.0
PRK08263275 short chain dehydrogenase; Provisional 100.0
PRK05993277 short chain dehydrogenase; Provisional 100.0
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK10538248 malonic semialdehyde reductase; Provisional 100.0
PRK06841255 short chain dehydrogenase; Provisional 100.0
PRK12743256 oxidoreductase; Provisional 100.0
PRK07024257 short chain dehydrogenase; Provisional 100.0
PRK05866293 short chain dehydrogenase; Provisional 100.0
PRK07890258 short chain dehydrogenase; Provisional 100.0
PRK05717255 oxidoreductase; Validated 100.0
PRK07576264 short chain dehydrogenase; Provisional 100.0
PRK06949258 short chain dehydrogenase; Provisional 100.0
PRK07806248 short chain dehydrogenase; Provisional 100.0
PRK07109334 short chain dehydrogenase; Provisional 100.0
PLN02780320 ketoreductase/ oxidoreductase 100.0
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK05650270 short chain dehydrogenase; Provisional 100.0
PRK08278273 short chain dehydrogenase; Provisional 100.0
PRK12742237 oxidoreductase; Provisional 100.0
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK06194287 hypothetical protein; Provisional 100.0
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 100.0
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK06179270 short chain dehydrogenase; Provisional 100.0
PRK07814263 short chain dehydrogenase; Provisional 100.0
PRK12829264 short chain dehydrogenase; Provisional 100.0
PRK12828239 short chain dehydrogenase; Provisional 100.0
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 100.0
PRK07578199 short chain dehydrogenase; Provisional 100.0
PRK05854313 short chain dehydrogenase; Provisional 100.0
PLN00015308 protochlorophyllide reductase 100.0
PRK06701290 short chain dehydrogenase; Provisional 100.0
PRK06197306 short chain dehydrogenase; Provisional 100.0
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK07904253 short chain dehydrogenase; Provisional 100.0
PRK06914280 short chain dehydrogenase; Provisional 100.0
PRK06500249 short chain dehydrogenase; Provisional 100.0
PRK05884223 short chain dehydrogenase; Provisional 100.0
PRK09072263 short chain dehydrogenase; Provisional 100.0
PRK09135249 pteridine reductase; Provisional 100.0
PRK12428241 3-alpha-hydroxysteroid dehydrogenase; Provisional 100.0
KOG1199|consensus260 100.0
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 100.0
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 100.0
PRK07825273 short chain dehydrogenase; Provisional 100.0
PRK08213259 gluconate 5-dehydrogenase; Provisional 100.0
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 100.0
PRK05866293 short chain dehydrogenase; Provisional 100.0
PRK05854313 short chain dehydrogenase; Provisional 100.0
TIGR02415254 23BDH acetoin reductases. One member of this famil 100.0
PRK08703239 short chain dehydrogenase; Provisional 100.0
PRK07023243 short chain dehydrogenase; Provisional 100.0
PRK08628258 short chain dehydrogenase; Provisional 100.0
PRK09186256 flagellin modification protein A; Provisional 100.0
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 100.0
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 100.0
PRK06057255 short chain dehydrogenase; Provisional 100.0
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 100.0
PRK07775274 short chain dehydrogenase; Provisional 100.0
PRK12939250 short chain dehydrogenase; Provisional 100.0
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK05855582 short chain dehydrogenase; Validated 100.0
PRK07069251 short chain dehydrogenase; Validated 100.0
PRK08267260 short chain dehydrogenase; Provisional 100.0
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK05993277 short chain dehydrogenase; Provisional 100.0
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK12744257 short chain dehydrogenase; Provisional 100.0
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 100.0
PRK06947248 glucose-1-dehydrogenase; Provisional 100.0
PRK06123248 short chain dehydrogenase; Provisional 100.0
PRK12937245 short chain dehydrogenase; Provisional 100.0
PRK07024257 short chain dehydrogenase; Provisional 100.0
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 100.0
PRK06194287 hypothetical protein; Provisional 100.0
PRK06182273 short chain dehydrogenase; Validated 100.0
COG1028251 FabG Dehydrogenases with different specificities ( 100.0
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 100.0
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 100.0
PRK07453322 protochlorophyllide oxidoreductase; Validated 99.98
PRK05875276 short chain dehydrogenase; Provisional 99.98
PRK06197306 short chain dehydrogenase; Provisional 99.98
PRK07102243 short chain dehydrogenase; Provisional 99.98
PRK08251248 short chain dehydrogenase; Provisional 99.98
PRK06181263 short chain dehydrogenase; Provisional 99.98
PRK05693274 short chain dehydrogenase; Provisional 99.98
PRK06198260 short chain dehydrogenase; Provisional 99.98
PRK07904253 short chain dehydrogenase; Provisional 99.98
PRK12935247 acetoacetyl-CoA reductase; Provisional 99.98
KOG1209|consensus289 99.97
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 99.97
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.97
PRK07832272 short chain dehydrogenase; Provisional 99.97
PRK06138252 short chain dehydrogenase; Provisional 99.97
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 99.97
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 99.97
PRK12824245 acetoacetyl-CoA reductase; Provisional 99.97
PRK05650270 short chain dehydrogenase; Provisional 99.97
PRK06196315 oxidoreductase; Provisional 99.97
PRK06180277 short chain dehydrogenase; Provisional 99.97
PRK09134258 short chain dehydrogenase; Provisional 99.97
PRK07774250 short chain dehydrogenase; Provisional 99.97
PRK06179270 short chain dehydrogenase; Provisional 99.97
PRK06482276 short chain dehydrogenase; Provisional 99.97
PRK07454241 short chain dehydrogenase; Provisional 99.97
KOG1209|consensus289 99.97
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.97
PRK09072263 short chain dehydrogenase; Provisional 99.97
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 99.97
PRK08263275 short chain dehydrogenase; Provisional 99.97
PRK07326237 short chain dehydrogenase; Provisional 99.97
PRK12746254 short chain dehydrogenase; Provisional 99.97
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 99.97
PRK08267260 short chain dehydrogenase; Provisional 99.97
PRK08251248 short chain dehydrogenase; Provisional 99.97
PRK07453322 protochlorophyllide oxidoreductase; Validated 99.97
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.97
KOG1208|consensus314 99.97
PRK05693274 short chain dehydrogenase; Provisional 99.97
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.97
PRK12827249 short chain dehydrogenase; Provisional 99.97
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.97
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 99.97
PRK06101240 short chain dehydrogenase; Provisional 99.97
PRK07074257 short chain dehydrogenase; Provisional 99.97
PRK10538248 malonic semialdehyde reductase; Provisional 99.97
PRK07201657 short chain dehydrogenase; Provisional 99.97
PRK06914280 short chain dehydrogenase; Provisional 99.97
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.97
KOG1014|consensus312 99.97
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 99.97
KOG0432|consensus 995 99.97
PRK12367245 short chain dehydrogenase; Provisional 99.97
PRK07577234 short chain dehydrogenase; Provisional 99.97
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 99.97
KOG1208|consensus314 99.97
KOG1610|consensus322 99.97
KOG1014|consensus312 99.97
PRK09009235 C factor cell-cell signaling protein; Provisional 99.97
PRK07102243 short chain dehydrogenase; Provisional 99.96
KOG1610|consensus322 99.96
PRK07775274 short chain dehydrogenase; Provisional 99.96
KOG1611|consensus249 99.96
PRK07578199 short chain dehydrogenase; Provisional 99.96
PRK06924251 short chain dehydrogenase; Provisional 99.96
PRK09291257 short chain dehydrogenase; Provisional 99.96
PRK07060245 short chain dehydrogenase; Provisional 99.96
PRK06482276 short chain dehydrogenase; Provisional 99.96
PRK06181263 short chain dehydrogenase; Provisional 99.96
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 99.96
PRK08017256 oxidoreductase; Provisional 99.96
PRK07041230 short chain dehydrogenase; Provisional 99.96
PRK08324681 short chain dehydrogenase; Validated 99.96
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.96
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.96
PRK06101240 short chain dehydrogenase; Provisional 99.96
PRK08264238 short chain dehydrogenase; Validated 99.96
KOG1611|consensus249 99.96
PRK07023243 short chain dehydrogenase; Provisional 99.96
PRK07326237 short chain dehydrogenase; Provisional 99.96
PRK08177225 short chain dehydrogenase; Provisional 99.96
PRK07806248 short chain dehydrogenase; Provisional 99.96
PRK09291257 short chain dehydrogenase; Provisional 99.96
PRK12828239 short chain dehydrogenase; Provisional 99.96
KOG1210|consensus331 99.96
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.96
PRK12829264 short chain dehydrogenase; Provisional 99.96
PRK08177225 short chain dehydrogenase; Provisional 99.95
PRK09135249 pteridine reductase; Provisional 99.95
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.95
PRK12367245 short chain dehydrogenase; Provisional 99.95
KOG1210|consensus331 99.95
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 99.95
COG0525 877 ValS Valyl-tRNA synthetase [Translation, ribosomal 99.95
KOG1204|consensus253 99.95
PRK08264238 short chain dehydrogenase; Validated 99.95
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.95
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 99.95
PRK06953222 short chain dehydrogenase; Provisional 99.95
PRK08219227 short chain dehydrogenase; Provisional 99.94
PRK08017256 oxidoreductase; Provisional 99.94
COG0623259 FabI Enoyl-[acyl-carrier-protein] 99.94
PRK12428241 3-alpha-hydroxysteroid dehydrogenase; Provisional 99.94
PRK07424406 bifunctional sterol desaturase/short chain dehydro 99.93
PRK06953222 short chain dehydrogenase; Provisional 99.93
KOG1204|consensus253 99.93
TIGR028132582 omega_3_PfaA polyketide-type polyunsaturated fatty 99.91
PRK08219227 short chain dehydrogenase; Provisional 99.91
PRK07424406 bifunctional sterol desaturase/short chain dehydro 99.9
PLN03209 576 translocon at the inner envelope of chloroplast su 99.9
smart00822180 PKS_KR This enzymatic domain is part of bacterial 99.9
smart00822180 PKS_KR This enzymatic domain is part of bacterial 99.89
PRK13656398 trans-2-enoyl-CoA reductase; Provisional 99.89
PRK13656398 trans-2-enoyl-CoA reductase; Provisional 99.85
PRK06720169 hypothetical protein; Provisional 99.85
PRK06720169 hypothetical protein; Provisional 99.84
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 99.83
PRK05729 874 valS valyl-tRNA synthetase; Reviewed 99.82
PLN02260668 probable rhamnose biosynthetic enzyme 99.81
PLN03209576 translocon at the inner envelope of chloroplast su 99.81
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 99.81
PLN02943 958 aminoacyl-tRNA ligase 99.81
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 99.8
PLN02381 1066 valyl-tRNA synthetase 99.79
KOG1478|consensus341 99.79
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 99.78
KOG1478|consensus341 99.77
TIGR00422 861 valS valyl-tRNA synthetase. The valyl-tRNA synthet 99.77
PRK14900 1052 valS valyl-tRNA synthetase; Provisional 99.77
PTZ00419 995 valyl-tRNA synthetase-like protein; Provisional 99.77
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 99.77
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 99.76
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 99.75
PLN02653340 GDP-mannose 4,6-dehydratase 99.74
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 99.73
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 99.7
PLN02653340 GDP-mannose 4,6-dehydratase 99.67
PLN02583297 cinnamoyl-CoA reductase 99.66
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 99.65
PRK06039 975 ileS isoleucyl-tRNA synthetase; Reviewed 99.65
PLN02583297 cinnamoyl-CoA reductase 99.64
PLN00198338 anthocyanidin reductase; Provisional 99.63
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 99.63
PLN02650351 dihydroflavonol-4-reductase 99.62
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 99.62
PTZ00427 1205 isoleucine-tRNA ligase, putative; Provisional 99.61
PLN00198338 anthocyanidin reductase; Provisional 99.61
PLN02896353 cinnamyl-alcohol dehydrogenase 99.6
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 99.6
PLN02572442 UDP-sulfoquinovose synthase 99.6
PLN02214342 cinnamoyl-CoA reductase 99.6
PLN02896353 cinnamyl-alcohol dehydrogenase 99.59
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 99.59
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 99.58
PRK13208 800 valS valyl-tRNA synthetase; Reviewed 99.58
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 99.58
PLN02214342 cinnamoyl-CoA reductase 99.57
PF00133601 tRNA-synt_1: tRNA synthetases class I (I, L, M and 99.57
PLN02572442 UDP-sulfoquinovose synthase 99.56
TIGR01746367 Thioester-redct thioester reductase domain. It has 99.56
PLN02650351 dihydroflavonol-4-reductase 99.56
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 99.55
PLN02240352 UDP-glucose 4-epimerase 99.54
PLN02240352 UDP-glucose 4-epimerase 99.54
PRK10675338 UDP-galactose-4-epimerase; Provisional 99.54
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 99.53
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 99.53
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 99.52
TIGR00392 861 ileS isoleucyl-tRNA synthetase. The isoleucyl tRNA 99.52
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 99.52
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 99.51
PRK10675338 UDP-galactose-4-epimerase; Provisional 99.49
PRK05743 912 ileS isoleucyl-tRNA synthetase; Reviewed 99.48
PLN02686367 cinnamoyl-CoA reductase 99.48
PRK13804 961 ileS isoleucyl-tRNA synthetase; Provisional 99.48
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 99.47
PLN02882 1159 aminoacyl-tRNA ligase 99.47
PLN02843 974 isoleucyl-tRNA synthetase 99.46
PLN02686367 cinnamoyl-CoA reductase 99.45
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 99.45
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 99.44
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 99.41
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 99.37
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
Probab=100.00  E-value=6.8e-79  Score=704.41  Aligned_cols=503  Identities=27%  Similarity=0.457  Sum_probs=420.2

Q ss_pred             CCCCEEEEECCcchHHHHHHHHHHHcCCEEEEEcCChhhHHHHHHHHHHcCCCeEEEEEccCCCHHHHHHHHHHHHHhcC
Q psy942           10 LTGKVAVVTASSDGIGFAIAKRLSAEGASVVISSRKESNVNKAVETLQKEGHQKISGVVCHVAKKEDRQKLFEHAEKKFG   89 (762)
Q Consensus        10 l~gkvalVTGas~GIG~aia~~la~~Ga~Vvi~~r~~~~l~~~~~~l~~~g~~~~~~~~~Dvsd~~~v~~~~~~~~~~~G   89 (762)
                      ++||+++||||++|||+++|+.|+++|++|++++|+.++++++.+++   +. ++..+++|++|+++++++++.+.++||
T Consensus         3 ~~~k~~lITGas~gIG~aia~~l~~~G~~V~~~~r~~~~~~~~~~~~---~~-~~~~~~~D~~~~~~~~~~~~~~~~~~g   78 (520)
T PRK06484          3 AQSRVVLVTGAAGGIGRAACQRFARAGDQVVVADRNVERARERADSL---GP-DHHALAMDVSDEAQIREGFEQLHREFG   78 (520)
T ss_pred             CCCeEEEEECCCcHHHHHHHHHHHHCCCEEEEEeCCHHHHHHHHHHh---CC-ceeEEEeccCCHHHHHHHHHHHHHHhC
Confidence            57899999999999999999999999999999999998887766655   32 466789999999999999999999999


Q ss_pred             CccEEEEcCCCCC-CCCCCCCCCHHHHHHHHHHHhHHHHHHHHHHHHHHHcCCCc-EEEEecCcccccCCCCChHHHHHH
Q psy942           90 GIDILVSNAAVNP-ATGPVVECPENVWDKIFEVNVKSTFLLTQEVLPYIRKRNGG-SIVYVSSIGGLAPFKLLGAYSVSK  167 (762)
Q Consensus        90 ~iDiLVnNAG~~~-~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~p~m~~~~~G-~IVnisS~~~~~~~~~~~~Y~asK  167 (762)
                      ++|+||||||+.. ...++.+.+.++|++++++|+.++++++|+++|+|++++.| +||||||.++..+.++..+|+++|
T Consensus        79 ~iD~li~nag~~~~~~~~~~~~~~~~~~~~~~~n~~~~~~l~~~~~~~~~~~~~g~~iv~isS~~~~~~~~~~~~Y~asK  158 (520)
T PRK06484         79 RIDVLVNNAGVTDPTMTATLDTTLEEFARLQAINLTGAYLVAREALRLMIEQGHGAAIVNVASGAGLVALPKRTAYSASK  158 (520)
T ss_pred             CCCEEEECCCcCCCCCcccccCCHHHHHHHHHHhhHHHHHHHHHHHHHHHhcCCCCeEEEECCcccCCCCCCCchHHHHH
Confidence            9999999999732 23567899999999999999999999999999999876655 999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhCCCCeEEEEEecCcccCcchhhhHHHhhhhhcCCCccccCCCCCcchhhhcCCCCCCCCchhhhcc
Q psy942          168 TALLGLTKAVAQDLASENIRVNCLAPGITKTKFAAAKKEVKKKETNDEPIVYTSNTAPGEMKDVLGPLPSSYSPQYVEAA  247 (762)
Q Consensus       168 aal~~lt~~lA~Ela~~gIrVN~V~PG~v~T~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~m~s~Y~p~~ve~~  247 (762)
                      +|+.+|+|+|+.|+.++|||||+|+||+|+|++.........       .         ........+            
T Consensus       159 aal~~l~~~la~e~~~~~i~v~~i~Pg~v~t~~~~~~~~~~~-------~---------~~~~~~~~~------------  210 (520)
T PRK06484        159 AAVISLTRSLACEWAAKGIRVNAVLPGYVRTQMVAELERAGK-------L---------DPSAVRSRI------------  210 (520)
T ss_pred             HHHHHHHHHHHHHhhhhCeEEEEEccCCcCchhhhhhcccch-------h---------hhHHHHhcC------------
Confidence            999999999999999999999999999999998643210000       0         000000000            


Q ss_pred             ccccccccCCCCCccccccccccCCCCcccccCCChhhHHHHHHhccccccccccccccceeecceEeeCCCCCCCCchh
Q psy942          248 WYPWWEKQGFFKPEYGRKSIGEKNPKGKFVMVIPPPNVTGTLHLGHALTNAVEDSITRWNRMKGKTTLWNPGCDHAGIAT  327 (762)
Q Consensus       248 w~~~w~~~~~~~~~~~r~~~g~~~~~~~~~i~lpp~~vtg~l~~g~s~~~~~~d~~~r~~~~~G~~~~~~~G~dhagia~  327 (762)
                                  + .+|  ++.            |.+++..+++..+....         +++|..+.+++|..--    
T Consensus       211 ------------~-~~~--~~~------------~~~va~~v~~l~~~~~~---------~~~G~~~~~~gg~~~~----  250 (520)
T PRK06484        211 ------------P-LGR--LGR------------PEEIAEAVFFLASDQAS---------YITGSTLVVDGGWTVY----  250 (520)
T ss_pred             ------------C-CCC--CcC------------HHHHHHHHHHHhCcccc---------CccCceEEecCCeecc----
Confidence                        0 112  233            88999999998887665         8899998888874210    


Q ss_pred             hHHHHhhhchhcccccccccchhHHHHHHHHhhhhccccccccccccccccCCCCEEEEeCCCChHHHHHHHHHHHCCCE
Q psy942          328 QVVVEKKLWREEKKTRHEIGREKFIEKVWEWKKEVFSTSTKIMSTAVNASRLAGKVAVVTASSDGIGFAIAKRLSTEGAS  407 (762)
Q Consensus       328 q~~v~~~l~~~~~~~~~~~~r~~f~~~v~~~~~~~~s~~~~~M~~~~~~~~l~gkvalVTGas~GIG~aiA~~la~~Ga~  407 (762)
                               ...+.   ..                ..  +..     ....+.||++|||||++|||+++|+.|+++|++
T Consensus       251 ---------~~~~~---~~----------------~~--~~~-----~~~~~~~k~~lItGas~gIG~~~a~~l~~~G~~  295 (520)
T PRK06484        251 ---------GGSGP---AS----------------TA--QAP-----SPLAESPRVVAITGGARGIGRAVADRFAAAGDR  295 (520)
T ss_pred             ---------ccccC---CC----------------Cc--cCC-----CCcccCCCEEEEECCCcHHHHHHHHHHHHCCCE
Confidence                     00000   00                00  000     012357999999999999999999999999999


Q ss_pred             EEEEcCCcccHHHHHHHHHHcCCCeEEEEEecCCCHHHHHHHHHHHHHHcCCccEEEEcCCCCCCCCCCCCCCHHHHHHH
Q psy942          408 VVISSRKESNVNKAVETLQKEGHQKISGVVCHVAKKEDRQKLFEHAEKKFGGIDILVSNAAVNPATGPVVECPENVWDKI  487 (762)
Q Consensus       408 Vvl~~r~~~~l~~~~~~l~~~g~~~~~~~~~Dv~~~~~~~~~v~~~~~~fG~iDiLVNNAG~~~~~~~~~~~~~~~~~~~  487 (762)
                      |++++|+.+.++++.+++   +. ++..+.+|++|+++++++++++.++||+||+||||||+.....++.+.++++|+++
T Consensus       296 V~~~~r~~~~~~~~~~~~---~~-~~~~~~~D~~~~~~~~~~~~~~~~~~g~id~li~nAg~~~~~~~~~~~~~~~~~~~  371 (520)
T PRK06484        296 LLIIDRDAEGAKKLAEAL---GD-EHLSVQADITDEAAVESAFAQIQARWGRLDVLVNNAGIAEVFKPSLEQSAEDFTRV  371 (520)
T ss_pred             EEEEeCCHHHHHHHHHHh---CC-ceeEEEccCCCHHHHHHHHHHHHHHcCCCCEEEECCCCcCCCCChhhCCHHHHHHH
Confidence            999999988887776554   22 46678999999999999999999999999999999998533467889999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHcCCCcEEEEecCcccccCCCCChHHHHHHHHHHHHHHHHHHHhCCCCeEEEEEeCCCcCC
Q psy942          488 FEVNVKSTFLLTQEVLPYIRKRNGGSIVYVSSIGGLAPFKLLGAYSVSKTALLGLTKAVAQDLASENIRVNCLAPGITKT  567 (762)
Q Consensus       488 ~~vNl~g~~~~~~~~~p~m~~~~~G~IVnisS~ag~~~~~~~~~Y~asKaal~~ltrslA~Ela~~gIrVN~V~PG~v~T  567 (762)
                      +++|+.|+++++|+++|+|  ++.|+|||+||.++..+.++..+|++||+|+.+|+|+|+.|++++|||||+|+||+|+|
T Consensus       372 ~~~n~~~~~~~~~~~~~~~--~~~g~iv~isS~~~~~~~~~~~~Y~asKaal~~l~~~la~e~~~~gI~vn~v~PG~v~t  449 (520)
T PRK06484        372 YDVNLSGAFACARAAARLM--SQGGVIVNLGSIASLLALPPRNAYCASKAAVTMLSRSLACEWAPAGIRVNTVAPGYIET  449 (520)
T ss_pred             HHhCcHHHHHHHHHHHHHh--ccCCEEEEECchhhcCCCCCCchhHHHHHHHHHHHHHHHHHhhhhCeEEEEEEeCCccC
Confidence            9999999999999999999  34699999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhhhcC-CHHHHHHHhhCCCCCCCCCHHHHHHHHHHHcCCCCCCccccEEEeCCCcc
Q psy942          568 KFAAALYE-TEEAHEIAVSNVPMGRLAVPDEMGGIVAFLCSDDASYITGEVIVAAGGMQ  625 (762)
Q Consensus       568 ~~~~~~~~-~~~~~~~~~~~~pl~r~~~pedvA~~v~fL~S~~a~~itG~~i~vdGG~~  625 (762)
                      +|...... .+...+...+..|++|+++|+|||++++||+|+.++|+||++|.+|||+.
T Consensus       450 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dia~~~~~l~s~~~~~~~G~~i~vdgg~~  508 (520)
T PRK06484        450 PAVLALKASGRADFDSIRRRIPLGRLGDPEEVAEAIAFLASPAASYVNGATLTVDGGWT  508 (520)
T ss_pred             chhhhhccccHHHHHHHHhcCCCCCCcCHHHHHHHHHHHhCccccCccCcEEEECCCcc
Confidence            98754322 12233445667899999999999999999999999999999999999975



>KOG1200|consensus Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>KOG0725|consensus Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG1200|consensus Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>KOG1207|consensus Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG0725|consensus Back     alignment and domain information
>KOG1205|consensus Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG1205|consensus Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1201|consensus Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1199|consensus Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>KOG1201|consensus Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG4169|consensus Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>KOG1207|consensus Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>KOG4169|consensus Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>KOG1199|consensus Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>KOG1209|consensus Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1209|consensus Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG1208|consensus Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG1014|consensus Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>KOG0432|consensus Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>KOG1208|consensus Back     alignment and domain information
>KOG1610|consensus Back     alignment and domain information
>KOG1014|consensus Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1610|consensus Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1611|consensus Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>KOG1611|consensus Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1210|consensus Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1210|consensus Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>COG0525 ValS Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1204|consensus Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1204|consensus Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PRK05729 valS valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PLN02943 aminoacyl-tRNA ligase Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02381 valyl-tRNA synthetase Back     alignment and domain information
>KOG1478|consensus Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>KOG1478|consensus Back     alignment and domain information
>TIGR00422 valS valyl-tRNA synthetase Back     alignment and domain information
>PRK14900 valS valyl-tRNA synthetase; Provisional Back     alignment and domain information
>PTZ00419 valyl-tRNA synthetase-like protein; Provisional Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PRK06039 ileS isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PTZ00427 isoleucine-tRNA ligase, putative; Provisional Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PRK13208 valS valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PF00133 tRNA-synt_1: tRNA synthetases class I (I, L, M and V); InterPro: IPR002300 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR00392 ileS isoleucyl-tRNA synthetase Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PRK05743 ileS isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK13804 ileS isoleucyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02882 aminoacyl-tRNA ligase Back     alignment and domain information
>PLN02843 isoleucyl-tRNA synthetase Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query762
2zat_A260 Crystal Structure Of A Mammalian Reductase Length = 9e-69
2zat_A 260 Crystal Structure Of A Mammalian Reductase Length = 1e-11
3o4r_A261 Crystal Structure Of Human DehydrogenaseREDUCTASE ( 1e-68
3o4r_A 261 Crystal Structure Of Human DehydrogenaseREDUCTASE ( 2e-11
1vl8_A267 Crystal Structure Of Gluconate 5-dehydrogenase (tm0 7e-34
2pnf_A248 Structure Of Aquifex Aeolicus Fabg 3-oxoacyl-(acyl- 2e-32
2pnf_A248 Structure Of Aquifex Aeolicus Fabg 3-oxoacyl-(acyl- 9e-05
1gax_A 862 Crystal Structure Of Thermus Thermophilus Valyl-Trn 2e-32
2hq1_A247 Crystal Structure Of Orf 1438 A Putative GlucoseRIB 2e-31
2hq1_A247 Crystal Structure Of Orf 1438 A Putative GlucoseRIB 3e-04
3emk_A246 2.5a Crystal Structure Of GlucoseRIBITOL DEHYDROGEN 4e-31
3emk_A246 2.5a Crystal Structure Of GlucoseRIBITOL DEHYDROGEN 3e-04
3enn_A249 2.1a Crystal Structure Of GlucoseRIBITOL DEHYDROGEN 4e-31
3enn_A249 2.1a Crystal Structure Of GlucoseRIBITOL DEHYDROGEN 3e-04
3tzk_A251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 4e-30
3tzk_A251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 6e-05
3rsh_A251 Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein)reduc 1e-29
3rsh_A251 Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein)reduc 1e-04
3ai1_A263 The Crystal Structure Of L-Sorbose Reductase From G 1e-29
3u09_A251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 2e-29
3u09_A251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 3e-04
3tzh_A251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 2e-29
3tzh_A251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 1e-04
3tzc_A251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 3e-29
3tzc_A251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 1e-04
3ai3_A263 The Crystal Structure Of L-Sorbose Reductase From G 5e-29
1rwb_A261 Cooperative Effect Of Two Surface Amino Acid Mutati 8e-29
2ew8_A249 Crystal Structure Of The (s)-specific 1-phenylethan 1e-28
3grp_A266 2.1 Angstrom Crystal Structure Of 3-Ketoacyl-(Acyl- 2e-28
3grp_A266 2.1 Angstrom Crystal Structure Of 3-Ketoacyl-(Acyl- 6e-05
1gee_A261 Crystal Structure Of Glucose Dehydrogenase Mutant Q 2e-28
1gco_A261 Crystal Structure Of Glucose Dehydrogenase Complexe 2e-28
1g6k_A261 Crystal Structure Of Glucose Dehydrogenase Mutant E 3e-28
1xq1_A266 X-Ray Structure Of Putative Tropinone Reducatse Fro 3e-28
1x1e_A239 Crystal Structure Of Tt0495 Protein From Thermus Th 3e-28
1x1e_A239 Crystal Structure Of Tt0495 Protein From Thermus Th 2e-04
1i01_A244 Crystal Structure Of Beta-Ketoacyl [acyl Carrier Pr 9e-28
2uvd_A246 The Crystal Structure Of A 3-Oxoacyl-(Acyl Carrier 1e-27
2uvd_A246 The Crystal Structure Of A 3-Oxoacyl-(Acyl Carrier 4e-04
1ae1_A273 Tropinone Reductase-I Complex With Nadp Length = 27 2e-27
1q7c_A244 The Structure Of Betaketoacyl-[acp] Reductase Y151f 2e-27
3op4_A248 Crystal Structure Of Putative 3-Ketoacyl-(Acyl-Carr 2e-27
3f9i_A249 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 3e-27
1o5i_A249 Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protei 6e-27
2c07_A285 Oxoacyl-Acp Reductase Of Plasmodium Falciparum Leng 9e-27
2c07_A285 Oxoacyl-Acp Reductase Of Plasmodium Falciparum Leng 6e-04
3vtz_A269 Structure Of Thermoplasma Volcanium Aldohexose Dehy 1e-26
3vtz_A 269 Structure Of Thermoplasma Volcanium Aldohexose Dehy 3e-04
3ak4_A263 Crystal Structure Of Nadh-Dependent Quinuclidinone 2e-26
3ak4_A263 Crystal Structure Of Nadh-Dependent Quinuclidinone 4e-07
3ay6_A269 Crystal Structure Of Bacillus Megaterium Glucose De 3e-26
3ay7_A269 Crystal Structure Of Bacillus Megaterium Glucose De 3e-26
3aus_A269 Crystal Structure Of Bacillus Megaterium Glucose De 3e-26
4fn4_A254 Short-chain Nad(h)-dependent Dehydrogenase/reductas 3e-26
4fn4_A 254 Short-chain Nad(h)-dependent Dehydrogenase/reductas 9e-05
3u5t_A267 The Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Pr 4e-26
3u5t_A267 The Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Pr 4e-04
3sju_A279 Hedamycin Polyketide Ketoreductase Bound To Nadph L 4e-26
3ftp_A270 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 1e-25
4dbz_A281 Crystal Structure Of V151l Actinorhodin Polyketide 1e-25
2rh4_A277 Actinorhodin Ketoreductase, Actkr, With Nadph And I 2e-25
1w4z_A281 Structure Of Actinorhodin Polyketide (Actiii) Reduc 2e-25
4dc1_A281 Crystal Structure Of Y202f Actinorhodin Polyketide 2e-25
1x7g_A261 Actinorhodin Polyketide Ketoreductase, Act Kr, With 3e-25
2cf2_E226 Architecture Of Mammalian Fatty Acid Synthase Lengt 3e-25
4dc0_A281 Crystal Structure Of F189w Actinorhodin Polyketide 5e-25
3pk0_A262 Crystal Structure Of Short-Chain DehydrogenaseREDUC 5e-25
1xhl_A297 Crystal Structure Of Putative Tropinone Reductase-I 7e-25
3o38_A266 Crystal Structure Of A Short Chain Dehydrogenase Fr 9e-25
3gvc_A277 Crystal Structure Of Probable Short-Chain Dehydroge 9e-25
4afn_A269 Crystal Structure Of 3-ketoacyl-(acyl-carrier-prote 1e-24
3a28_C258 Crystal Structure Of L-2,3-Butanediol Dehydrogenase 1e-24
3a28_C258 Crystal Structure Of L-2,3-Butanediol Dehydrogenase 3e-04
1zem_A262 Crystal Structure Of Nad+-Bound Xylitol Dehydrogena 3e-24
1zem_A262 Crystal Structure Of Nad+-Bound Xylitol Dehydrogena 3e-04
3sj7_A252 Structure Of Beta-Ketoacetyl-Coa Reductase (Fabg) F 3e-24
2q2q_A255 Structure Of D-3-Hydroxybutyrate Dehydrogenase From 3e-24
2rhr_B277 P94l Actinorhodin Ketordeuctase Mutant, With Nadph 4e-24
2cfc_A250 Structural Basis For Stereo Selectivity In The (R)- 4e-24
3csd_B281 Actinorhodin Polyketide Ketoreductase Mutant P94l B 4e-24
4dqx_A277 Crystal Structure Of A Short Chain Dehydrogenase Fr 5e-24
1wmb_A260 Crystal Structure Of Nad Dependent D-3-Hydroxybutyl 5e-24
1yxm_A303 Crystal Structure Of Peroxisomal Trans 2-Enoyl Coa 7e-24
3qiv_A253 Crystal Structure Of A Putative Short-Chain Dehydro 9e-24
2ae2_A260 Tropinone Reductase-Ii Complexed With Nadp+ And Pse 9e-24
4fgs_A273 Crystal Structure Of A Probable Dehydrogenase Prote 9e-24
1ipe_A259 Tropinone Reductase-Ii Complexed With Nadph Length 1e-23
3lyl_A247 Structure Of 3-Oxoacyl-Acylcarrier Protein Reductas 1e-23
3uf0_A273 Crystal Structure Of A Putative Nad(P) Dependent Gl 1e-23
3tzq_B271 Crystal Structure Of A Short-Chain Type Dehydrogena 1e-23
2ztm_A260 T190s Mutant Of D-3-Hydroxybutyrate Dehydrogenase L 1e-23
3imf_A257 1.99 Angstrom Resolution Crystal Structure Of A Sho 1e-23
3i4f_A264 Structure Of Putative 3-oxoacyl-reductase From Baci 2e-23
1geg_A256 Cryatal Structure Analysis Of Meso-2,3-Butanediol D 2e-23
2ztu_A260 T190a Mutant Of D-3-Hydroxybutyrate Dehydrogenase C 3e-23
2z1n_A260 Crystal Structure Of Ape0912 From Aeropyrum Pernix 3e-23
3awd_A260 Crystal Structure Of Gox2181 Length = 260 3e-23
1ahi_A255 7 Alpha-Hydroxysteroid Dehydrogenase Complexed With 6e-23
3tox_A280 Crystal Structure Of A Short Chain Dehydrogenase In 1e-22
1zjy_A251 Structure Of R-Specific Alcohol Dehydrogenase (Muta 1e-22
1spx_A278 Crystal Structure Of Glucose Dehydrogenase Of Caeno 1e-22
1nxq_A251 Crystal Structure Of R-Alcohol Dehydrogenase (Radh) 1e-22
3n74_A261 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 1e-22
3n74_A 261 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 5e-04
4g81_D255 Crystal Structure Of A Hexonate Dehydrogenase Ortho 2e-22
3nug_A247 Crystal Structure Of Wild Type Tetrameric Pyridoxal 2e-22
3osu_A246 Crystal Structure Of The 3-Oxoacyl-Acyl Carrier Pro 2e-22
2nm0_A253 Crystal Structure Of Sco1815: A Beta-Ketoacyl-Acyl 2e-22
4ibo_A271 Crystal Structure Of A Putative Gluconate Dehydroge 2e-22
2b4q_A276 Pseudomonas Aeruginosa RhlgNADP ACTIVE-Site Complex 2e-22
3cxr_A291 Crystal Structure Of Gluconate 5-Dehydrogase From S 3e-22
2ph3_A245 Crystal Structure Of 3-oxoacyl-[acyl Carrier Protei 3e-22
1uzl_A247 Maba From Mycobacterium Tuberculosis Length = 247 4e-22
1edo_A244 The X-Ray Structure Of Beta-Keto Acyl Carrier Prote 1e-21
2ntn_A267 Crystal Structure Of Maba-c60v/g139a/s144l Length = 1e-21
1uzm_A247 Maba From Mycobacterium Tuberculosis Length = 247 1e-21
1xkq_A280 Crystal Structure Of Short-Chain DehydrogenaseREDUC 1e-21
2dtd_A264 Structure Of Thermoplasma Acidophilum Aldohexose De 1e-21
2yz7_A260 X-Ray Analyses Of 3-Hydroxybutyrate Dehydrogenase F 2e-21
3icc_A255 Crystal Structure Of A Putative 3-Oxoacyl-(Acyl Car 2e-21
3gk3_A269 Crystal Structure Of Acetoacetyl-Coa Reductase From 2e-21
3ndr_A247 Crystal Structure Of Tetrameric Pyridoxal 4-Dehydro 3e-21
2d1y_A256 Crystal Structure Of Tt0321 From Thermus Thermophil 3e-21
3r1i_A276 Crystal Structure Of A Short-Chain Type Dehydrogena 4e-21
3r1i_A276 Crystal Structure Of A Short-Chain Type Dehydrogena 3e-04
4iiu_A267 Crystal Structure Of A Putative 3-Oxoacyl-[acyl-Car 5e-21
2zk7_A257 Structure Of A C-Terminal Deletion Mutant Of Thermo 7e-21
3gaf_A256 2.2a Crystal Structure Of 7-Alpha-Hydroxysteroid De 8e-21
2hsd_A253 The Refined Three-Dimensional Structure Of 3alpha,2 1e-20
4dml_A269 3-Oxoacyl-[acyl-Carrier-Protein] Reductase From Syn 1e-20
1ja9_A274 Crystal Structure Of 1,3,6,8-Tetrahydroxynaphthalen 2e-20
3v2g_A271 Crystal Structure Of A DehydrogenaseREDUCTASE FROM 4e-20
3oic_A258 Crystal Structure Of Enoyl-Acp Reductases Iii (Fabl 5e-20
1doh_A283 Structure Of Trihydroxynaphthalene Reductase In Com 5e-20
1ybv_A283 Structure Of Trihydroxynaphthalene Reductase In Com 6e-20
3i3o_A291 2.06 Angstrom Resolution Crystal Structure Of A Sho 7e-20
3v2h_A281 The Crystal Structure Of D-Beta-Hydroxybutyrate Deh 9e-20
3t4x_A267 Short Chain DehydrogenaseREDUCTASE FAMILY OXIDOREDU 1e-19
3is3_A270 Crystal Structure Of 17beta-Hydroxysteroid Dehydrog 1e-19
1hdc_A254 Mechanism Of Inhibition Of 3alpha,20beta-Hydroxyste 2e-19
4eso_A255 Crystal Structure Of A Putative Oxidoreductase Prot 3e-19
3vc7_A254 Crystal Structure Of A Putative Oxidoreductase From 3e-19
3itd_A270 Crystal Structure Of An Inactive 17beta-Hydroxyster 4e-19
4iin_A271 Crystal Structure Of A Putative 3-Oxoacyl-[acyl-Car 4e-19
4imr_A275 Crystal Structure Of 3-oxoacyl (acyl-carrier-protei 5e-19
3r3s_A294 Structure Of The Ygha Oxidoreductase From Salmonell 5e-19
3g1t_A258 Crystal Structure Of Short Chain Dehydrogenase From 6e-19
4b79_A242 The Aeropath Project And Pseudomonas Aeruginosa Hig 7e-19
3ijr_A291 2.05 Angstrom Resolution Crystal Structure Of A Sho 8e-19
2pd6_A264 Structure Of Human Hydroxysteroid Dehydrogenase Typ 1e-18
3rkr_A262 Crystal Structure Of A Metagenomic Short-Chain Oxid 1e-18
1uls_A245 Crystal Structure Of Tt0140 From Thermus Thermophil 1e-18
4hp8_A247 Crystal Structure Of A Putative 2-Deoxy-D-Gluconate 2e-18
2ag5_A246 Crystal Structure Of Human Dhrs6 Length = 246 2e-18
2ag5_A246 Crystal Structure Of Human Dhrs6 Length = 246 9e-04
3tjr_A301 Crystal Structure Of A Rv0851c Ortholog Short Chain 2e-18
3rih_A293 Crystal Structure Of A Putative Short Chain Dehydro 2e-18
1k2w_A256 Crystal Structure Of Sorbitol Dehydrogenase From R. 3e-18
1yde_A270 Crystal Structure Of Human Retinal Short-Chain Dehy 5e-18
4egf_A266 Crystal Structure Of A L-Xylulose Reductase From My 5e-18
3afm_A258 Crystal Structure Of Aldose Reductase A1-R Responsi 7e-18
3afm_A 258 Crystal Structure Of Aldose Reductase A1-R Responsi 1e-04
3f5q_A262 Crystal Structure Of Putative Short Chain Dehydroge 7e-18
1nff_A260 Crystal Structure Of Rv2002 Gene Product From Mycob 9e-18
2a4k_A263 3-Oxoacyl-[acyl Carrier Protein] Reductase From The 1e-17
3ctm_A279 Crystal Structure Of A Carbonyl Reductase From Cand 2e-17
2fwm_X250 Crystal Structure Of E. Coli Enta, A 2,3-Dihydrodih 3e-17
1xg5_A279 Structure Of Human Putative Dehydrogenase Mgc4172 I 7e-17
3f5s_A255 Crystal Structure Of Putatitve Short Chain Dehydrog 9e-17
3ezl_A256 Crystal Structure Of Acetyacetyl-Coa Reductase From 1e-16
3oec_A317 Crystal Structure Of Carveol Dehydrogenase From Myc 1e-16
1nfr_A260 Rv2002 Gene Product From Mycobacterium Tuberculosis 1e-16
3gdf_A267 Crystal Structure Of The Nadp-Dependent Mannitol De 2e-16
2wdz_A254 Crystal Structure Of The Short Chain Dehydrogenase 2e-16
3f1l_A252 The 0.95 A Structure Of An Oxidoreductase, Ycik Fro 2e-16
1iy8_A267 Crystal Structure Of Levodione Reductase Length = 2 3e-16
3edm_A259 Crystal Structure Of A Short Chain Dehydrogenase Fr 5e-16
3v8b_A283 Crystal Structure Of A 3-Ketoacyl-Acp Reductase Fro 1e-15
3v8b_A 283 Crystal Structure Of A 3-Ketoacyl-Acp Reductase Fro 1e-04
3iah_A256 Crystal Structure Of Short Chain Dehydrogenase (yci 2e-15
3kvo_A346 Crystal Structure Of The Catalytic Domain Of Human 2e-15
4iqg_C271 Crystal Structure Of Bpro0239 Oxidoreductase From P 2e-15
1h5q_A265 Mannitol Dehydrogenase From Agaricus Bisporus Lengt 3e-15
3tfo_A264 Crystal Structure Of A Putative 3-Oxoacyl-(Acyl-Car 3e-15
4e6p_A259 Crystal Structure Of A Probable Sorbitol Dehydrogen 3e-15
3ioy_A319 Structure Of Putative Short-Chain Dehydrogenase (Sa 4e-15
3s55_A281 Crystal Structure Of A Putative Short-Chain Dehydro 4e-15
3ucx_A264 The Structure Of A Short Chain Dehydrogenase From M 5e-15
2y93_A281 Crystal Structure Of Cis-Biphenyl-2,3-Dihydrodiol-2 5e-15
1w6u_A302 Structure Of Human Decr Ternary Complex Length = 30 6e-15
2p91_A285 Crystal Structure Of Enoyl-[acyl-Carrier-Protein] R 7e-15
4e3z_A272 Crystal Structure Of A Oxidoreductase From Rhizobiu 7e-15
4fc6_A277 Studies On Dcr Shed New Light On Peroxisomal Beta-O 9e-15
2gdz_A267 Crystal Structure Of 15-Hydroxyprostaglandin Dehydr 2e-14
3ksu_A262 Crystal Structure Of Short-Chain Dehydrogenase From 2e-14
3d3w_B245 Structure Of L-Xylulose Reductase With Bound Coenzy 2e-14
1w73_A302 Binary Structure Of Human Decr Solved By Semet Sad. 5e-14
3v1t_C462 Crystal Structure Of A Putative Ketoacyl Reductase 6e-14
3lls_A475 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 7e-14
4fw8_A454 Crystal Structure Of Fabg4 Complexed With Coenzyme 7e-14
2ehd_A234 Crystal Structure Analysis Of Oxidoreductase Length 8e-14
3m1l_A432 Crystal Strucutre Of A C-Terminal Trunacted Mutant 8e-14
3d3w_A244 Structure Of L-Xylulose Reductase With Bound Coenzy 9e-14
3q6i_A446 Crystal Structure Of Fabg4 And Coenzyme Binary Comp 9e-14
1pr9_A244 Human L-Xylulose Reductase Holoenzyme Length = 244 9e-14
3e9q_A273 Crystal Structure Of The Short Chain Dehydrogenase 1e-13
3oml_A 613 Structure Of Full-Length Peroxisomal Multifunctiona 2e-13
3oml_A 613 Structure Of Full-Length Peroxisomal Multifunctiona 5e-06
1hxh_A253 Comamonas Testosteroni 3beta17BETA HYDROXYSTEROID D 3e-13
3f1k_A252 Crystal Structure Of Ycik From E. Coli, An Oxidored 3e-13
3i1j_A247 Structure Of A Putative Short Chain Dehydrogenase F 3e-13
3bmc_A288 Structure Of Pteridine Reductase 1 (Ptr1) From Tryp 4e-13
3bmc_B288 Structure Of Pteridine Reductase 1 (Ptr1) From Tryp 4e-13
3un1_A260 Crystal Structure Of An Oxidoreductase From Sinorhi 4e-13
3svt_A281 Structure Of A Short-Chain Type DehydrogenaseREDUCT 6e-13
3svt_A281 Structure Of A Short-Chain Type DehydrogenaseREDUCT 5e-04
3pgx_A280 Crystal Structure Of A Putative Carveol Dehydrogena 6e-13
3u0b_A454 Crystal Structure Of An Oxidoreductase From Mycobac 8e-13
2et6_A604 (3r)-Hydroxyacyl-Coa Dehydrogenase Domain Of Candid 9e-13
2wd7_A268 Pteridine Reductase 1 (Ptr1) From Trypanosoma Bruce 9e-13
2bgk_A278 X-Ray Structure Of Apo-Secoisolariciresinol Dehydro 1e-12
3uxy_A266 The Crystal Structure Of Short Chain Dehydrogenase 1e-12
3rku_A287 Substrate Fingerprint And The Structure Of Nadp+ De 1e-12
3p19_A266 Improved Nadph-Dependent Blue Fluorescent Protein L 2e-12
2yw9_A261 Crystal Structure Of Tt0143 From Thermus Thermophil 3e-12
1ulu_A261 Crystal Structure Of Tt0143 From Thermus Thermophil 4e-12
1cyd_A244 Carbonyl Reductase Complexed With Nadph And 2-Propa 6e-12
1bdb_A277 Cis-Biphenyl-2,3-Dihydrodiol-2,3-Dehydrogenase From 6e-12
3jq7_A288 Crystal Structure Of Pteridine Reductase 1 (Ptr1) F 7e-12
3jq7_B288 Crystal Structure Of Pteridine Reductase 1 (Ptr1) F 8e-12
3sc4_A285 Crystal Structure Of A Short Chain Dehydrogenase (A 1e-11
3sc4_A285 Crystal Structure Of A Short Chain Dehydrogenase (A 3e-11
3nyw_A250 Crystal Structure Of A Betaketoacyl-[acp] Reductase 1e-11
3lf1_A265 Apo Structure Of The Short Chain Oxidoreductase Q9h 2e-11
1mxh_A276 Crystal Structure Of Substrate Complex Of Putative 2e-11
2wd7_B268 Pteridine Reductase 1 (Ptr1) From Trypanosoma Bruce 2e-11
2c7v_A268 Structure Of Trypanosoma Brucei Pteridine Reductase 2e-11
1pwx_A254 Crystal Structure Of The Haloalcohol Dehalogenase H 2e-11
1mxf_A276 Crystal Structure Of Inhibitor Complex Of Putative 3e-11
3t7c_A299 Crystal Structure Of Carveol Dehydrogenase From Myc 3e-11
3ged_A247 Fingerprint And Structural Analysis Of A Apo Scor E 4e-11
1e3w_A261 Rat Brain 3-Hydroxyacyl-Coa Dehydrogenase Binary Co 4e-11
3grk_A293 Crystal Structure Of Short Chain Dehydrogenase Redu 6e-11
4dry_A281 The Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Pr 6e-11
4dry_A281 The Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Pr 2e-10
1u7t_A261 Crystal Structure Of AbadHSD10 WITH A BOUND INHIBIT 6e-11
1e3s_A261 Rat Brain 3-Hydroxyacyl-Coa Dehydrogenase Binary Co 7e-11
1e6w_A260 Rat Brain 3-Hydroxyacyl-Coa Dehydrogenase Binary Co 1e-10
2o23_A265 The Structure Of Wild-Type Human Hadh2 (17beta-Hydr 1e-10
3uwr_A286 Crystal Structure Of Carveol Dehydrogenase From Myc 2e-10
1so8_A261 Abeta-bound Human Abad Structure [also Known As 3-h 2e-10
4bb6_A292 Free-Wilson And Structural Approaches To Co-Optimis 3e-10
4hfr_A272 Human 11beta-Hydroxysteroid Dehydrogenase Type 1 In 3e-10
4bb5_A292 Free-Wilson And Structural Approaches To Co-Optimis 4e-10
3e03_A274 Crystal Structure Of A Putative Dehydrogenase From 4e-10
3sx2_A278 Crystal Structure Of A Putative 3-Ketoacyl-(Acyl-Ca 4e-10
3tsc_A277 Crystal Structure Of Short Chain Dehydrogenase Map_ 5e-10
1gz6_A319 (3r)-Hydroxyacyl-Coa Dehydrogenase Fragment Of Rat 5e-10
1gz6_A319 (3r)-Hydroxyacyl-Coa Dehydrogenase Fragment Of Rat 7e-10
3ppi_A281 Crystal Structure Of 3-Hydroxyacyl-Coa Dehydrogenas 5e-10
2ilt_A275 Human 11-Beta-Hydroxysteroid Dehydrogenase (Hsd1) W 6e-10
2rbe_A275 The Discovery Of 2-Anilinothiazolones As 11beta-Hsd 7e-10
2bel_A283 Structure Of Human 11-Beta-Hydroxysteroid Dehydroge 7e-10
1zbq_A327 Crystal Structure Of Human 17-beta-hydroxysteroid D 7e-10
1zbq_A327 Crystal Structure Of Human 17-beta-hydroxysteroid D 8e-10
2irw_A264 Human 11-Beta-Hydroxysteroid Dehydrogenase (Hsd1) W 7e-10
1xu7_A286 Crystal Structure Of The Interface Open Conformatio 7e-10
3d5q_A272 Crystal Structure Of 11b-Hsd1 In Complex With Triaz 7e-10
3pdj_A273 Crystal Structure Of Human 11-Beta-Hydroxysteroid D 8e-10
3ch6_A286 Crystal Structure Of 11beta-Hsd1 Double Mutant (L26 8e-10
2qq5_A260 Crystal Structure Of Human Sdr Family Member 1 Leng 1e-09
4ixt_A254 Structure Of A 37-fold Mutant Of Halohydrin Dehalog 2e-09
4e4y_A244 The Crystal Structure Of A Short Chain Dehydrogenas 3e-09
4eit_A276 Crystal Structure Of An Enoyl-(Acyl Carrier Protein 5e-09
3kzv_A254 The Crystal Structure Of A Cytoplasmic Protein With 6e-09
4da9_A280 Crystal Structure Of Putative Short-Chain Dehydroge 9e-09
3qlj_A322 Crystal Structure Of A Short Chain Dehydrogenase Fr 9e-09
1zmo_A244 Apo Structure Of Haloalcohol Dehalogenase Hhea Of A 1e-08
1fjh_A257 The Crystal Structure Of 3-Alpha-Hydroxysteroid Deh 1e-08
2bd0_A244 Chlorobium Tepidum Sepiapterin Reductase Complexed 1e-08
3tl3_A257 Structure Of A Short-Chain Type DehydrogenaseREDUCT 2e-08
3gmd_A264 Structure-Based Design Of 7-Azaindole-Pyrrolidines 2e-08
1eno_A312 Brassica Napus Enoyl Acp ReductaseNAD BINARY COMPLE 2e-08
1d7o_A297 Crystal Structure Of Brassica Napus Enoyl Acyl Carr 2e-08
3m1a_A281 The Crystal Structure Of A Short-Chain Dehydrogenas 3e-08
3nrc_A280 Crystal Stucture Of The Francisella Tularensis Enoy 3e-08
3uve_A286 Crystal Structure Of Carveol Dehydrogenase ((+)-Tra 3e-08
2jjy_A268 Crystal Structure Of Francisella Tularensis Enoyl R 3e-08
2jap_A247 Clavulanic Acid Dehydrogenase: Structural And Bioch 3e-08
1y5m_A276 The Crystal Structure Of Murine 11b-Hydroxysteroid 3e-08
4gkb_A258 Crystal Structure Of A Short Chain Dehydrogenase Ho 3e-08
1yb1_A272 Crystal Structure Of Human 17-Beta-Hydroxysteroid D 4e-08
2nwq_A272 Short Chain Dehydrogenase From Pseudomonas Aerugino 5e-08
1cwu_A296 Brassica Napus Enoyl Acp Reductase A138g Mutant Com 6e-08
3o26_A311 The Structure Of Salutaridine Reductase From Papave 1e-07
3asu_A248 Crystal Structure Of Serine Dehydrogenase From Esch 1e-07
2jah_A247 Biochemical And Structural Analysis Of The Clavulan 2e-07
2pd3_A275 Crystal Structure Of The Helicobacter Pylori Enoyl- 3e-07
3k2e_A296 Crystal Structure Of Enoyl-(Acyl-Carrier-Protein) R 4e-07
4h15_A261 Crystal Structure Of A Short Chain Alcohol Dehydrog 5e-07
1p33_A289 Pteridine Reductase From Leishmania Tarentolae Comp 5e-07
2qio_A256 X-Ray Structure Of Enoyl-Acyl Carrier Protein Reduc 1e-06
1n5d_A288 Crystal Structure Of Porcine Testicular Carbonyl Re 1e-06
3ojf_A257 Crystal Structure Of The Bacillus Cereus Enoyl-Acyl 1e-06
4ali_A282 Crystal Structure Of S. Aureus Fabi In Complex With 1e-06
3gnt_A256 Crystal Structure Of The Staphylococcus Aureus Enoy 2e-06
4all_A277 Crystal Structure Of S. Aureus Fabi In Complex With 2e-06
3gns_A260 Crystal Structure Of The Staphylococcus Aureus Enoy 2e-06
1e7w_A291 One Active Site, Two Modes Of Reduction Correlate T 4e-06
1w0c_A307 Inhibition Of Leishmania Major Pteridine Reductase 4e-06
4dyv_A272 Crystal Structure Of A Short-Chain DehydrogenaseRED 4e-06
2qhx_A328 Structure Of Pteridine Reductase From Leishmania Ma 4e-06
1e92_A288 Pteridine Reductase 1 From Leishmania Major Complex 4e-06
2hrb_A274 Crystal Structure Of Human Carbonyl Reductase 3, Co 4e-06
3e9n_A245 Crystal Structure Of A Putative Short-Chain Dehydro 5e-06
3tn7_A257 Crystal Structure Of Short-Chain Alcohol Dehydrogen 5e-06
3l77_A235 X-Ray Structure Alcohol Dehydrogenase From Archaeon 5e-06
4fs3_A256 Crystal Structure Of Staphylococcus Aureus Enoyl-Ac 6e-06
3g49_A277 N-(Pyridin-2-Yl) Arylsulfonamide Inhibitors Of 11b- 8e-06
3g49_A277 N-(Pyridin-2-Yl) Arylsulfonamide Inhibitors Of 11b- 8e-06
3dwf_A276 Crystal Structure Of The Guinea Pig 11beta-Hydroxys 9e-06
3dwf_A276 Crystal Structure Of The Guinea Pig 11beta-Hydroxys 9e-06
3lz6_A263 Guinea Pig 11beta Hydroxysteroid Dehydrogenase With 9e-06
3lz6_A263 Guinea Pig 11beta Hydroxysteroid Dehydrogenase With 9e-06
3oif_A266 Crystal Structure Of Enoyl-Acp Reductases I (Fabi) 9e-06
2v0c_A 878 Leucyl-Trna Synthetase From Thermus Thermophilus Co 1e-05
1obh_A 878 Leucyl-Trna Synthetase From Thermus Thermophilus Co 1e-05
1xse_A295 Crystal Structure Of Guinea Pig 11beta-Hydroxystero 1e-05
1xse_A295 Crystal Structure Of Guinea Pig 11beta-Hydroxystero 1e-05
1iol_A327 Estrogenic 17-beta Hydroxysteroid Dehydrogenase Com 1e-05
2xox_A288 Crystal Structure Of Pteridine Reductase (Ptr1) Fro 2e-05
1wz2_A 967 The Crystal Structure Of Leucyl-Trna Synthetase And 3e-05
1qu2_A 917 Insights Into Editing From An Ile-Trna Synthetase S 3e-05
1fds_A327 Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 C 3e-05
1fdw_A327 Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 M 3e-05
1a27_A289 Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 C 3e-05
1fdu_A327 Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 M 3e-05
1equ_A327 Type 1 17-Beta Hydroxysteroid Dehydrogenase Equilin 3e-05
3ek2_A271 Crystal Structure Of Eonyl-(Acyl Carrier Protein) R 3e-05
1wkb_A 810 Crystal Structure Of Leucyl-Trna Synthetase From Th 3e-05
1jzq_A 821 Isoleucyl-Trna Synthetase Complexed With Isoleucyl- 4e-05
3pjd_A270 Structure Of Enr G93a Mutant-Nad+-Triclosan Complex 4e-05
3pje_A270 Structure Of Enr G93s Mutant-Nad+-Triclosan Complex 5e-05
3pjf_A270 Structure Of Enr G93v Mutant-Nad+-Triclosan Complex 5e-05
2o2s_A315 The Structure Of T. Gondii Enoyl Acyl Carrier Prote 7e-05
2dkn_A255 Crystal Structure Of The 3-alpha-hydroxysteroid Deh 8e-05
1dfg_A261 X-Ray Structure Of Escherichia Coli Enoyl Reductase 1e-04
1qsg_A265 Crystal Structure Of Enoyl Reductase Inhibition By 1e-04
1c14_A262 Crystal Structure Of E Coli Enoyl Reductase-nad+-tr 1e-04
3tpc_A257 Crystal Structure Of A Hypothtical Protein Sma1452 1e-04
3h7a_A252 Crystal Structure Of Short-Chain Dehydrogenase From 1e-04
3h7a_A252 Crystal Structure Of Short-Chain Dehydrogenase From 3e-04
2o50_A315 The Crystal Structure Of Toxoplasma Gondii Enoyl Ac 2e-04
2pfg_A276 Crystal Structure Of Human Cbr1 In Complex With Big 2e-04
1wma_A276 Crystal Structure Of Human Cbr1 In Complex With Hyd 2e-04
3uce_A223 Crystal Structure Of A Small-Chain Dehydrogenase In 2e-04
3pxx_A287 Crystal Structure Of Carveol Dehydrogenase From Myc 3e-04
>pdb|2ZAT|A Chain A, Crystal Structure Of A Mammalian Reductase Length = 260 Back     alignment and structure

Iteration: 1

Score = 258 bits (659), Expect = 9e-69, Method: Compositional matrix adjust. Identities = 133/250 (53%), Positives = 170/250 (68%), Gaps = 1/250 (0%) Query: 379 LAGKVAVVTASSDGIGFAIAKRLSTEGASVVISSRKESNVNKAVETLQKEGHQKISGVVC 438 L KVA+VTAS+DGIG AIA+RL+ +GA VV+SSRK+ NV++ V TLQ EG ++G VC Sbjct: 12 LENKVALVTASTDGIGLAIARRLAQDGAHVVVSSRKQENVDRTVATLQGEG-LSVTGTVC 70 Query: 439 HVAKKEDRQKLFEHAEKKFGGIDILVSNAAVNPATGPVVECPENVWDKIFEVNVKSTFLL 498 HV K EDR++L A GG+DILVSNAAVNP G +++ E VWDKI VNVK+T L+ Sbjct: 71 HVGKAEDRERLVAMAVNLHGGVDILVSNAAVNPFFGNIIDATEEVWDKILHVNVKATVLM 130 Query: 499 TQEVLPYIRKRNXXXXXXXXXXXXLAPFKLLGAYSVSKTALLGLTKAVAQDLASENIRVN 558 T+ V+P + KR PF LG Y+VSKTALLGLTK +A +LA NIRVN Sbjct: 131 TKAVVPEMEKRGGGSVLIVSSVGAYHPFPNLGPYNVSKTALLGLTKNLAVELAPRNIRVN 190 Query: 559 CLAPGITKTKFAAALYETEEAHEIAVSNVPMGRLAVPDEMGGIVAFLCSDDASYITGEVI 618 CLAPG+ KT F+ L+ + E ++ + RL P++ GIV+FLCS+DASYITGE + Sbjct: 191 CLAPGLIKTNFSQVLWMDKARKEYMKESLRIRRLGNPEDCAGIVSFLCSEDASYITGETV 250 Query: 619 VAAGGMQSRL 628 V GG SRL Sbjct: 251 VVGGGTASRL 260
>pdb|2ZAT|A Chain A, Crystal Structure Of A Mammalian Reductase Length = 260 Back     alignment and structure
>pdb|3O4R|A Chain A, Crystal Structure Of Human DehydrogenaseREDUCTASE (SDR FAMILY) MEMBER 4 (Dhrs4) Length = 261 Back     alignment and structure
>pdb|3O4R|A Chain A, Crystal Structure Of Human DehydrogenaseREDUCTASE (SDR FAMILY) MEMBER 4 (Dhrs4) Length = 261 Back     alignment and structure
>pdb|1VL8|A Chain A, Crystal Structure Of Gluconate 5-dehydrogenase (tm0441) From Thermotoga Maritima At 2.07 A Resolution Length = 267 Back     alignment and structure
>pdb|2PNF|A Chain A, Structure Of Aquifex Aeolicus Fabg 3-oxoacyl-(acyl-carrier Protein) Reductase Length = 248 Back     alignment and structure
>pdb|2PNF|A Chain A, Structure Of Aquifex Aeolicus Fabg 3-oxoacyl-(acyl-carrier Protein) Reductase Length = 248 Back     alignment and structure
>pdb|1GAX|A Chain A, Crystal Structure Of Thermus Thermophilus Valyl-Trna Synthetase Complexed With Trna(Val) And Valyl-Adenylate Analogue Length = 862 Back     alignment and structure
>pdb|2HQ1|A Chain A, Crystal Structure Of Orf 1438 A Putative GlucoseRIBITOL Dehydrogenase From Clostridium Thermocellum Length = 247 Back     alignment and structure
>pdb|2HQ1|A Chain A, Crystal Structure Of Orf 1438 A Putative GlucoseRIBITOL Dehydrogenase From Clostridium Thermocellum Length = 247 Back     alignment and structure
>pdb|3EMK|A Chain A, 2.5a Crystal Structure Of GlucoseRIBITOL DEHYDROGENASE From Brucella Melitensis Length = 246 Back     alignment and structure
>pdb|3EMK|A Chain A, 2.5a Crystal Structure Of GlucoseRIBITOL DEHYDROGENASE From Brucella Melitensis Length = 246 Back     alignment and structure
>pdb|3ENN|A Chain A, 2.1a Crystal Structure Of GlucoseRIBITOL DEHYDROGENASE FROM BRUCELLA Melitensis (P43212) Length = 249 Back     alignment and structure
>pdb|3ENN|A Chain A, 2.1a Crystal Structure Of GlucoseRIBITOL DEHYDROGENASE FROM BRUCELLA Melitensis (P43212) Length = 249 Back     alignment and structure
>pdb|3TZK|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(G92a) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|3TZK|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(G92a) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|3RSH|A Chain A, Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein)reductase (Fabg) From Vibrio Cholerae O1 Complexed With Nadp+ (Space Group P62) Length = 251 Back     alignment and structure
>pdb|3RSH|A Chain A, Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein)reductase (Fabg) From Vibrio Cholerae O1 Complexed With Nadp+ (Space Group P62) Length = 251 Back     alignment and structure
>pdb|3AI1|A Chain A, The Crystal Structure Of L-Sorbose Reductase From Gluconobacter Frateurii Complexed With Nadph And L-Sorbose Reveals The Structure Bases Of Its Catalytic Mechanism And High Substrate Selectivity Length = 263 Back     alignment and structure
>pdb|3U09|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(G92d) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|3U09|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(G92d) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|3TZH|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(F187a) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|3TZH|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(F187a) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|3TZC|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(Y155f) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|3TZC|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(Y155f) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|3AI3|A Chain A, The Crystal Structure Of L-Sorbose Reductase From Gluconobacter Frateurii Complexed With Nadph And L-Sorbose Length = 263 Back     alignment and structure
>pdb|1RWB|A Chain A, Cooperative Effect Of Two Surface Amino Acid Mutations (Q252l And E170k) Of Glucose Dehydrogenase From Bacillus Megaterium Iwg3 For The Stabilization Of Oligomeric State Length = 261 Back     alignment and structure
>pdb|2EW8|A Chain A, Crystal Structure Of The (s)-specific 1-phenylethanol Dehydrogenase Of The Denitrifying Bacterium Strain Ebn1 Length = 249 Back     alignment and structure
>pdb|3GRP|A Chain A, 2.1 Angstrom Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Bartonella Henselae Length = 266 Back     alignment and structure
>pdb|3GRP|A Chain A, 2.1 Angstrom Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Bartonella Henselae Length = 266 Back     alignment and structure
>pdb|1GEE|A Chain A, Crystal Structure Of Glucose Dehydrogenase Mutant Q252l Complexed With Nad+ Length = 261 Back     alignment and structure
>pdb|1GCO|A Chain A, Crystal Structure Of Glucose Dehydrogenase Complexed With Nad+ Length = 261 Back     alignment and structure
>pdb|1G6K|A Chain A, Crystal Structure Of Glucose Dehydrogenase Mutant E96a Complexed With Nad+ Length = 261 Back     alignment and structure
>pdb|1XQ1|A Chain A, X-Ray Structure Of Putative Tropinone Reducatse From Arabidopsis Thaliana Gene At1g07440 Length = 266 Back     alignment and structure
>pdb|1X1E|A Chain A, Crystal Structure Of Tt0495 Protein From Thermus Thermophilus Hb8 Length = 239 Back     alignment and structure
>pdb|1X1E|A Chain A, Crystal Structure Of Tt0495 Protein From Thermus Thermophilus Hb8 Length = 239 Back     alignment and structure
>pdb|1I01|A Chain A, Crystal Structure Of Beta-Ketoacyl [acyl Carrier Protein] Reductase From E. Coli. Length = 244 Back     alignment and structure
>pdb|2UVD|A Chain A, The Crystal Structure Of A 3-Oxoacyl-(Acyl Carrier Protein) Reductase From Bacillus Anthracis (Ba3989) Length = 246 Back     alignment and structure
>pdb|2UVD|A Chain A, The Crystal Structure Of A 3-Oxoacyl-(Acyl Carrier Protein) Reductase From Bacillus Anthracis (Ba3989) Length = 246 Back     alignment and structure
>pdb|1AE1|A Chain A, Tropinone Reductase-I Complex With Nadp Length = 273 Back     alignment and structure
>pdb|1Q7C|A Chain A, The Structure Of Betaketoacyl-[acp] Reductase Y151f Mutant In Complex With Nadph Fragment Length = 244 Back     alignment and structure
>pdb|3OP4|A Chain A, Crystal Structure Of Putative 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Vibrio Cholerae O1 Biovar Eltor Str. N16961 In Complex With Nadp+ Length = 248 Back     alignment and structure
>pdb|3F9I|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase Rickettsia Prowazekii Length = 249 Back     alignment and structure
>pdb|1O5I|A Chain A, Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protein) Reductase (Tm1169) From Thermotoga Maritima At 2.50 A Resolution Length = 249 Back     alignment and structure
>pdb|2C07|A Chain A, Oxoacyl-Acp Reductase Of Plasmodium Falciparum Length = 285 Back     alignment and structure
>pdb|2C07|A Chain A, Oxoacyl-Acp Reductase Of Plasmodium Falciparum Length = 285 Back     alignment and structure
>pdb|3VTZ|A Chain A, Structure Of Thermoplasma Volcanium Aldohexose Dehydrogenase Length = 269 Back     alignment and structure
>pdb|3VTZ|A Chain A, Structure Of Thermoplasma Volcanium Aldohexose Dehydrogenase Length = 269 Back     alignment and structure
>pdb|3AK4|A Chain A, Crystal Structure Of Nadh-Dependent Quinuclidinone Reductase From Agrobacterium Tumefaciens Length = 263 Back     alignment and structure
>pdb|3AK4|A Chain A, Crystal Structure Of Nadh-Dependent Quinuclidinone Reductase From Agrobacterium Tumefaciens Length = 263 Back     alignment and structure
>pdb|3AY6|A Chain A, Crystal Structure Of Bacillus Megaterium Glucose Dehydrogenase 4 A258f Mutant In Complex With Nadh And D-Glucose Length = 269 Back     alignment and structure
>pdb|3AY7|A Chain A, Crystal Structure Of Bacillus Megaterium Glucose Dehydrogenase 4 G259a Mutant Length = 269 Back     alignment and structure
>pdb|3AUS|A Chain A, Crystal Structure Of Bacillus Megaterium Glucose Dehydrogenase 4 In Ligand-Free Form Length = 269 Back     alignment and structure
>pdb|4FN4|A Chain A, Short-chain Nad(h)-dependent Dehydrogenase/reductase From Sulfolobus Acidocaldarius Length = 254 Back     alignment and structure
>pdb|4FN4|A Chain A, Short-chain Nad(h)-dependent Dehydrogenase/reductase From Sulfolobus Acidocaldarius Length = 254 Back     alignment and structure
>pdb|3U5T|A Chain A, The Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protein] Reductase From Sinorhizobium Meliloti Length = 267 Back     alignment and structure
>pdb|3U5T|A Chain A, The Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protein] Reductase From Sinorhizobium Meliloti Length = 267 Back     alignment and structure
>pdb|3SJU|A Chain A, Hedamycin Polyketide Ketoreductase Bound To Nadph Length = 279 Back     alignment and structure
>pdb|3FTP|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Burkholderia Pseudomallei At 2.05 A Resolution Length = 270 Back     alignment and structure
>pdb|4DBZ|A Chain A, Crystal Structure Of V151l Actinorhodin Polyketide Ketoreductase With Nadph Length = 281 Back     alignment and structure
>pdb|2RH4|A Chain A, Actinorhodin Ketoreductase, Actkr, With Nadph And Inhibitor Emodin Length = 277 Back     alignment and structure
>pdb|1W4Z|A Chain A, Structure Of Actinorhodin Polyketide (Actiii) Reductase Length = 281 Back     alignment and structure
>pdb|4DC1|A Chain A, Crystal Structure Of Y202f Actinorhodin Polyketide Ketoreductase With Nadph Length = 281 Back     alignment and structure
>pdb|1X7G|A Chain A, Actinorhodin Polyketide Ketoreductase, Act Kr, With Nadp Bound Length = 261 Back     alignment and structure
>pdb|2CF2|E Chain E, Architecture Of Mammalian Fatty Acid Synthase Length = 226 Back     alignment and structure
>pdb|4DC0|A Chain A, Crystal Structure Of F189w Actinorhodin Polyketide Ketoreductase With Nadph Length = 281 Back     alignment and structure
>pdb|3PK0|A Chain A, Crystal Structure Of Short-Chain DehydrogenaseREDUCTASE SDR FROM Mycobacterium Smegmatis Length = 262 Back     alignment and structure
>pdb|1XHL|A Chain A, Crystal Structure Of Putative Tropinone Reductase-Ii From Caenorhabditis Elegans With Cofactor And Substrate Length = 297 Back     alignment and structure
>pdb|3O38|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase From Mycobacterium Smegmatis Length = 266 Back     alignment and structure
>pdb|3GVC|A Chain A, Crystal Structure Of Probable Short-Chain Dehydrogenase- Reductase From Mycobacterium Tuberculosis Length = 277 Back     alignment and structure
>pdb|4AFN|A Chain A, Crystal Structure Of 3-ketoacyl-(acyl-carrier-protein) Reductase (fabg) From Pseudomonas Aeruginosa At 2.3a Resolution Length = 269 Back     alignment and structure
>pdb|3A28|C Chain C, Crystal Structure Of L-2,3-Butanediol Dehydrogenase Length = 258 Back     alignment and structure
>pdb|3A28|C Chain C, Crystal Structure Of L-2,3-Butanediol Dehydrogenase Length = 258 Back     alignment and structure
>pdb|1ZEM|A Chain A, Crystal Structure Of Nad+-Bound Xylitol Dehydrogenase Length = 262 Back     alignment and structure
>pdb|1ZEM|A Chain A, Crystal Structure Of Nad+-Bound Xylitol Dehydrogenase Length = 262 Back     alignment and structure
>pdb|3SJ7|A Chain A, Structure Of Beta-Ketoacetyl-Coa Reductase (Fabg) From Staphylococcus Aureus Complex With Nadph Length = 252 Back     alignment and structure
>pdb|2Q2Q|A Chain A, Structure Of D-3-Hydroxybutyrate Dehydrogenase From Pseudomonas Putida Length = 255 Back     alignment and structure
>pdb|2RHR|B Chain B, P94l Actinorhodin Ketordeuctase Mutant, With Nadph And Inhibitor Emodin Length = 277 Back     alignment and structure
>pdb|2CFC|A Chain A, Structural Basis For Stereo Selectivity In The (R)- And (S)- Hydroxypropylethane Thiosulfonate Dehydrogenases Length = 250 Back     alignment and structure
>pdb|3CSD|B Chain B, Actinorhodin Polyketide Ketoreductase Mutant P94l Bound To Nadph And The Inhibitor Emodin Length = 281 Back     alignment and structure
>pdb|4DQX|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase From Rhizobium Etli Cfn 42 Length = 277 Back     alignment and structure
>pdb|1WMB|A Chain A, Crystal Structure Of Nad Dependent D-3-Hydroxybutylate Dehydrogenase Length = 260 Back     alignment and structure
>pdb|1YXM|A Chain A, Crystal Structure Of Peroxisomal Trans 2-Enoyl Coa Reductase Length = 303 Back     alignment and structure
>pdb|3QIV|A Chain A, Crystal Structure Of A Putative Short-Chain Dehydrogenase Or 3- Oxoacyl-[acyl-Carrier-Protein] Reductase From Mycobacterium Paratuberculosis Atcc Baa-968 K-10 Length = 253 Back     alignment and structure
>pdb|2AE2|A Chain A, Tropinone Reductase-Ii Complexed With Nadp+ And Pseudotropine Length = 260 Back     alignment and structure
>pdb|4FGS|A Chain A, Crystal Structure Of A Probable Dehydrogenase Protein Length = 273 Back     alignment and structure
>pdb|1IPE|A Chain A, Tropinone Reductase-Ii Complexed With Nadph Length = 259 Back     alignment and structure
>pdb|3LYL|A Chain A, Structure Of 3-Oxoacyl-Acylcarrier Protein Reductase, Fabg From Francisella Tularensis Length = 247 Back     alignment and structure
>pdb|3UF0|A Chain A, Crystal Structure Of A Putative Nad(P) Dependent Gluconate 5- Dehydrogenase From Beutenbergia Cavernae(Efi Target Efi-502044) With Bound Nadp (Low Occupancy) Length = 273 Back     alignment and structure
>pdb|3TZQ|B Chain B, Crystal Structure Of A Short-Chain Type DehydrogenaseREDUCTASE FROM Mycobacterium Marinum Length = 271 Back     alignment and structure
>pdb|2ZTM|A Chain A, T190s Mutant Of D-3-Hydroxybutyrate Dehydrogenase Length = 260 Back     alignment and structure
>pdb|3IMF|A Chain A, 1.99 Angstrom Resolution Crystal Structure Of A Short Chain Dehydrogenase From Bacillus Anthracis Str. 'ames Ancestor' Length = 257 Back     alignment and structure
>pdb|3I4F|A Chain A, Structure Of Putative 3-oxoacyl-reductase From Bacillus Thuringiensis Length = 264 Back     alignment and structure
>pdb|1GEG|A Chain A, Cryatal Structure Analysis Of Meso-2,3-Butanediol Dehydrogenase Length = 256 Back     alignment and structure
>pdb|2ZTU|A Chain A, T190a Mutant Of D-3-Hydroxybutyrate Dehydrogenase Complexed With Nad+ Length = 260 Back     alignment and structure
>pdb|2Z1N|A Chain A, Crystal Structure Of Ape0912 From Aeropyrum Pernix K1 Length = 260 Back     alignment and structure
>pdb|3AWD|A Chain A, Crystal Structure Of Gox2181 Length = 260 Back     alignment and structure
>pdb|1AHI|A Chain A, 7 Alpha-Hydroxysteroid Dehydrogenase Complexed With Nadh And 7-Oxo Glycochenodeoxycholic Acid Length = 255 Back     alignment and structure
>pdb|3TOX|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase In Complex With Nad(P) From Sinorhizobium Meliloti 1021 Length = 280 Back     alignment and structure
>pdb|1ZJY|A Chain A, Structure Of R-Specific Alcohol Dehydrogenase (Mutant G37d) From Lactobacillus Brevis In Complex With Phenylethanol And Nadh Length = 251 Back     alignment and structure
>pdb|1SPX|A Chain A, Crystal Structure Of Glucose Dehydrogenase Of Caenorhabditis Elegans In The Apo-Form Length = 278 Back     alignment and structure
>pdb|1NXQ|A Chain A, Crystal Structure Of R-Alcohol Dehydrogenase (Radh) (Apoenyzme) From Lactobacillus Brevis Length = 251 Back     alignment and structure
>pdb|3N74|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reduc Brucella Melitensis Length = 261 Back     alignment and structure
>pdb|3N74|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reduc Brucella Melitensis Length = 261 Back     alignment and structure
>pdb|4G81|D Chain D, Crystal Structure Of A Hexonate Dehydrogenase Ortholog (Target Efi- 506402 From Salmonella Enterica, Unliganded Structure Length = 255 Back     alignment and structure
>pdb|3NUG|A Chain A, Crystal Structure Of Wild Type Tetrameric Pyridoxal 4-Dehydrogenase From Mesorhizobium Loti Length = 247 Back     alignment and structure
>pdb|3OSU|A Chain A, Crystal Structure Of The 3-Oxoacyl-Acyl Carrier Protein Reductase, Fabg, From Staphylococcus Aureus Length = 246 Back     alignment and structure
>pdb|2NM0|A Chain A, Crystal Structure Of Sco1815: A Beta-Ketoacyl-Acyl Carrier Protein Reductase From Streptomyces Coelicolor A3(2) Length = 253 Back     alignment and structure
>pdb|4IBO|A Chain A, Crystal Structure Of A Putative Gluconate Dehydrogenase From Agrobacterium Tumefaciens (Target Efi-506446) Length = 271 Back     alignment and structure
>pdb|2B4Q|A Chain A, Pseudomonas Aeruginosa RhlgNADP ACTIVE-Site Complex Length = 276 Back     alignment and structure
>pdb|3CXR|A Chain A, Crystal Structure Of Gluconate 5-Dehydrogase From Streptococcus Suis Type 2 Length = 291 Back     alignment and structure
>pdb|2PH3|A Chain A, Crystal Structure Of 3-oxoacyl-[acyl Carrier Protein] Reductase Ttha0415 From Thermus Thermophilus Length = 245 Back     alignment and structure
>pdb|1UZL|A Chain A, Maba From Mycobacterium Tuberculosis Length = 247 Back     alignment and structure
>pdb|1EDO|A Chain A, The X-Ray Structure Of Beta-Keto Acyl Carrier Protein Reductase From Brassica Napus Complexed With Nadp+ Length = 244 Back     alignment and structure
>pdb|2NTN|A Chain A, Crystal Structure Of Maba-c60v/g139a/s144l Length = 267 Back     alignment and structure
>pdb|1UZM|A Chain A, Maba From Mycobacterium Tuberculosis Length = 247 Back     alignment and structure
>pdb|1XKQ|A Chain A, Crystal Structure Of Short-Chain DehydrogenaseREDUCTASE OF Unknown Function From Caenorhabditis Elegans With Cofactor Length = 280 Back     alignment and structure
>pdb|2DTD|A Chain A, Structure Of Thermoplasma Acidophilum Aldohexose Dehydrogenase (aldt) In Ligand-free Form Length = 264 Back     alignment and structure
>pdb|2YZ7|A Chain A, X-Ray Analyses Of 3-Hydroxybutyrate Dehydrogenase From Alcaligenes Faecalis Length = 260 Back     alignment and structure
>pdb|3ICC|A Chain A, Crystal Structure Of A Putative 3-Oxoacyl-(Acyl Carrier Protein) Reductase From Bacillus Anthracis At 1.87 A Resolution Length = 255 Back     alignment and structure
>pdb|3GK3|A Chain A, Crystal Structure Of Acetoacetyl-Coa Reductase From Burkholderia Pseudomallei 1710b Length = 269 Back     alignment and structure
>pdb|3NDR|A Chain A, Crystal Structure Of Tetrameric Pyridoxal 4-Dehydrogenase From Mesorhizobium Loti Length = 247 Back     alignment and structure
>pdb|2D1Y|A Chain A, Crystal Structure Of Tt0321 From Thermus Thermophilus Hb8 Length = 256 Back     alignment and structure
>pdb|3R1I|A Chain A, Crystal Structure Of A Short-Chain Type DehydrogenaseREDUCTASE FROM Mycobacterium Marinum Length = 276 Back     alignment and structure
>pdb|3R1I|A Chain A, Crystal Structure Of A Short-Chain Type DehydrogenaseREDUCTASE FROM Mycobacterium Marinum Length = 276 Back     alignment and structure
>pdb|4IIU|A Chain A, Crystal Structure Of A Putative 3-Oxoacyl-[acyl-Carrier Protein]reductase From Escherichia Coli Strain Cft073 Complexed With Nadp+ At 2.1 A Resolution Length = 267 Back     alignment and structure
>pdb|2ZK7|A Chain A, Structure Of A C-Terminal Deletion Mutant Of Thermoplasma Acidophilum Aldohexose Dehydrogenase (Aldt) Length = 257 Back     alignment and structure
>pdb|3GAF|A Chain A, 2.2a Crystal Structure Of 7-Alpha-Hydroxysteroid Dehydrogenase From Brucella Melitensis Length = 256 Back     alignment and structure
>pdb|2HSD|A Chain A, The Refined Three-Dimensional Structure Of 3alpha,20beta- Hydroxysteroid Dehydrogenase And Possible Roles Of The Residues Conserved In Short-Chain Dehydrogenases Length = 253 Back     alignment and structure
>pdb|4DML|A Chain A, 3-Oxoacyl-[acyl-Carrier-Protein] Reductase From Synechococcus Elongatus Pcc 7942 Length = 269 Back     alignment and structure
>pdb|1JA9|A Chain A, Crystal Structure Of 1,3,6,8-Tetrahydroxynaphthalene Reductase In Complex With Nadph And Pyroquilon Length = 274 Back     alignment and structure
>pdb|3V2G|A Chain A, Crystal Structure Of A DehydrogenaseREDUCTASE FROM SINORHIZOBIUM Meliloti 1021 Length = 271 Back     alignment and structure
>pdb|3OIC|A Chain A, Crystal Structure Of Enoyl-Acp Reductases Iii (Fabl) From B. Subtilis (Apo Form) Length = 258 Back     alignment and structure
>pdb|1DOH|A Chain A, Structure Of Trihydroxynaphthalene Reductase In Complex With Nadph And 4-nitro-inden-1-one Length = 283 Back     alignment and structure
>pdb|1YBV|A Chain A, Structure Of Trihydroxynaphthalene Reductase In Complex With Nadph And An Active Site Inhibitor Length = 283 Back     alignment and structure
>pdb|3I3O|A Chain A, 2.06 Angstrom Resolution Crystal Structure Of A Short Chain Dehydrogenase From Bacillus Anthracis Str. 'ames Ancestor' In Complex With Nad-acetone Length = 291 Back     alignment and structure
>pdb|3V2H|A Chain A, The Crystal Structure Of D-Beta-Hydroxybutyrate Dehydrogenase From Sinorhizobium Meliloti Length = 281 Back     alignment and structure
>pdb|3T4X|A Chain A, Short Chain DehydrogenaseREDUCTASE FAMILY OXIDOREDUCTASE FROM Bacillus Anthracis Str. Ames Ancestor Length = 267 Back     alignment and structure
>pdb|3IS3|A Chain A, Crystal Structure Of 17beta-Hydroxysteroid Dehydrogenase (Apo Form) From Fungus Cochliobolus Lunatus Length = 270 Back     alignment and structure
>pdb|1HDC|A Chain A, Mechanism Of Inhibition Of 3alpha,20beta-Hydroxysteroid Dehydrogenase By A Licorice-Derived Steroidal Inhibitor Length = 254 Back     alignment and structure
>pdb|4ESO|A Chain A, Crystal Structure Of A Putative Oxidoreductase Protein From Sinorhizobium Meliloti 1021 In Complex With Nadp Length = 255 Back     alignment and structure
>pdb|3VC7|A Chain A, Crystal Structure Of A Putative Oxidoreductase From Sinorhizobium Meliloti 1021 Length = 254 Back     alignment and structure
>pdb|3ITD|A Chain A, Crystal Structure Of An Inactive 17beta-Hydroxysteroid Dehydrogenase (Y167f Mutated Form) From Fungus Cochliobolus Lunatus Length = 270 Back     alignment and structure
>pdb|4IIN|A Chain A, Crystal Structure Of A Putative 3-Oxoacyl-[acyl-Carrier Protein]reductase From Helicobacter Pylori 26695 Complexed With Nad+ Length = 271 Back     alignment and structure
>pdb|4IMR|A Chain A, Crystal Structure Of 3-oxoacyl (acyl-carrier-protein) Reductase (target Efi-506442) From Agrobacterium Tumefaciens C58 With Nadp Bound Length = 275 Back     alignment and structure
>pdb|3R3S|A Chain A, Structure Of The Ygha Oxidoreductase From Salmonella Enterica Length = 294 Back     alignment and structure
>pdb|3G1T|A Chain A, Crystal Structure Of Short Chain Dehydrogenase From Salmonella Enterica Subsp. Enterica Serovar Typhi Str. Ct18 Length = 258 Back     alignment and structure
>pdb|4B79|A Chain A, The Aeropath Project And Pseudomonas Aeruginosa High-throughput Crystallographic Studies For Assessment Of Potential Targets In Early Stage Drug Discovery. Length = 242 Back     alignment and structure
>pdb|3IJR|A Chain A, 2.05 Angstrom Resolution Crystal Structure Of A Short Chain Dehydrogenase From Bacillus Anthracis Str. 'ames Ancestor' In Complex With Nad+ Length = 291 Back     alignment and structure
>pdb|2PD6|A Chain A, Structure Of Human Hydroxysteroid Dehydrogenase Type 8, Hsd17b8 Length = 264 Back     alignment and structure
>pdb|3RKR|A Chain A, Crystal Structure Of A Metagenomic Short-Chain Oxidoreductase (Sdr) In Complex With Nadp Length = 262 Back     alignment and structure
>pdb|1ULS|A Chain A, Crystal Structure Of Tt0140 From Thermus Thermophilus Hb8 Length = 245 Back     alignment and structure
>pdb|4HP8|A Chain A, Crystal Structure Of A Putative 2-Deoxy-D-Gluconate 3-Dehydrogenase From Agrobacterium Tumefaciens (Target Efi-506435) With Bound Nadp Length = 247 Back     alignment and structure
>pdb|2AG5|A Chain A, Crystal Structure Of Human Dhrs6 Length = 246 Back     alignment and structure
>pdb|2AG5|A Chain A, Crystal Structure Of Human Dhrs6 Length = 246 Back     alignment and structure
>pdb|3TJR|A Chain A, Crystal Structure Of A Rv0851c Ortholog Short Chain Dehydrogenase From Mycobacterium Paratuberculosis Length = 301 Back     alignment and structure
>pdb|3RIH|A Chain A, Crystal Structure Of A Putative Short Chain Dehydrogenase Or Reductase From Mycobacterium Abscessus Length = 293 Back     alignment and structure
>pdb|1K2W|A Chain A, Crystal Structure Of Sorbitol Dehydrogenase From R. Sphaeroides Length = 256 Back     alignment and structure
>pdb|1YDE|A Chain A, Crystal Structure Of Human Retinal Short-Chain DehydrogenaseREDUCTASE 3 Length = 270 Back     alignment and structure
>pdb|4EGF|A Chain A, Crystal Structure Of A L-Xylulose Reductase From Mycobacterium Smegmatis Length = 266 Back     alignment and structure
>pdb|3AFM|A Chain A, Crystal Structure Of Aldose Reductase A1-R Responsible For Alginate Metabolism Length = 258 Back     alignment and structure
>pdb|3AFM|A Chain A, Crystal Structure Of Aldose Reductase A1-R Responsible For Alginate Metabolism Length = 258 Back     alignment and structure
>pdb|3F5Q|A Chain A, Crystal Structure Of Putative Short Chain Dehydrogenase From Escherichia Coli Cft073 Length = 262 Back     alignment and structure
>pdb|1NFF|A Chain A, Crystal Structure Of Rv2002 Gene Product From Mycobacterium Tuberculosis Length = 260 Back     alignment and structure
>pdb|2A4K|A Chain A, 3-Oxoacyl-[acyl Carrier Protein] Reductase From Thermus Thermophilus Tt0137 Length = 263 Back     alignment and structure
>pdb|3CTM|A Chain A, Crystal Structure Of A Carbonyl Reductase From Candida Parapsilosis With Anti-Prelog Stereo-Specificity Length = 279 Back     alignment and structure
>pdb|2FWM|X Chain X, Crystal Structure Of E. Coli Enta, A 2,3-Dihydrodihydroxy Benzoate Dehydrogenase Length = 250 Back     alignment and structure
>pdb|1XG5|A Chain A, Structure Of Human Putative Dehydrogenase Mgc4172 In Complex With Nadp Length = 279 Back     alignment and structure
>pdb|3F5S|A Chain A, Crystal Structure Of Putatitve Short Chain Dehydrogenase From Shigella Flexneri 2a Str. 301 Length = 255 Back     alignment and structure
>pdb|3EZL|A Chain A, Crystal Structure Of Acetyacetyl-Coa Reductase From Burkholderia Pseudomallei 1710b Length = 256 Back     alignment and structure
>pdb|3OEC|A Chain A, Crystal Structure Of Carveol Dehydrogenase From Mycobacterium Thermoresistibile Length = 317 Back     alignment and structure
>pdb|1NFR|A Chain A, Rv2002 Gene Product From Mycobacterium Tuberculosis Length = 260 Back     alignment and structure
>pdb|3GDF|A Chain A, Crystal Structure Of The Nadp-Dependent Mannitol Dehydrogenase From Cladosporium Herbarum. Length = 267 Back     alignment and structure
>pdb|2WDZ|A Chain A, Crystal Structure Of The Short Chain Dehydrogenase Galactitol-Dehydrogenase (Gatdh) Of Rhodobacter Sphaeroides In Complex With Nad+ And 1,2-Pentandiol Length = 254 Back     alignment and structure
>pdb|3F1L|A Chain A, The 0.95 A Structure Of An Oxidoreductase, Ycik From E.Coli Length = 252 Back     alignment and structure
>pdb|1IY8|A Chain A, Crystal Structure Of Levodione Reductase Length = 267 Back     alignment and structure
>pdb|3EDM|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase From Agrobacterium Tumefaciens Length = 259 Back     alignment and structure
>pdb|3V8B|A Chain A, Crystal Structure Of A 3-Ketoacyl-Acp Reductase From Sinorhizobium Meliloti 1021 Length = 283 Back     alignment and structure
>pdb|3V8B|A Chain A, Crystal Structure Of A 3-Ketoacyl-Acp Reductase From Sinorhizobium Meliloti 1021 Length = 283 Back     alignment and structure
>pdb|3IAH|A Chain A, Crystal Structure Of Short Chain Dehydrogenase (ycik) From Salmonella Enterica Subsp. Enterica Serovar Typhimurium Str. Lt2 In Complex With Nadp And Acetate. Length = 256 Back     alignment and structure
>pdb|3KVO|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Hydroxysteroid Dehydrogenase Like 2 (Hsdl2) Length = 346 Back     alignment and structure
>pdb|4IQG|C Chain C, Crystal Structure Of Bpro0239 Oxidoreductase From Polaromonas Sp. Js666 In Nadp Bound Form Length = 271 Back     alignment and structure
>pdb|1H5Q|A Chain A, Mannitol Dehydrogenase From Agaricus Bisporus Length = 265 Back     alignment and structure
>pdb|3TFO|A Chain A, Crystal Structure Of A Putative 3-Oxoacyl-(Acyl-Carrier-Protein) Reductase From Sinorhizobium Meliloti Length = 264 Back     alignment and structure
>pdb|4E6P|A Chain A, Crystal Structure Of A Probable Sorbitol Dehydrogenase (Target Psi- 012078) From Sinorhizobium Meliloti 1021 Length = 259 Back     alignment and structure
>pdb|3IOY|A Chain A, Structure Of Putative Short-Chain Dehydrogenase (Saro_0793) From Novosphingobium Aromaticivorans Length = 319 Back     alignment and structure
>pdb|3S55|A Chain A, Crystal Structure Of A Putative Short-Chain DehydrogenaseREDUCTASE From Mycobacterium Abscessus Bound To Nad Length = 281 Back     alignment and structure
>pdb|3UCX|A Chain A, The Structure Of A Short Chain Dehydrogenase From Mycobacterium Smegmatis Length = 264 Back     alignment and structure
>pdb|2Y93|A Chain A, Crystal Structure Of Cis-Biphenyl-2,3-Dihydrodiol-2,3- Dehydrogenase (Bphb)from Pandoraea Pnomenusa Strain B-356. Length = 281 Back     alignment and structure
>pdb|1W6U|A Chain A, Structure Of Human Decr Ternary Complex Length = 302 Back     alignment and structure
>pdb|2P91|A Chain A, Crystal Structure Of Enoyl-[acyl-Carrier-Protein] Reductase (Nadh) From Aquifex Aeolicus Vf5 Length = 285 Back     alignment and structure
>pdb|4E3Z|A Chain A, Crystal Structure Of A Oxidoreductase From Rhizobium Etli Cfn 42 Length = 272 Back     alignment and structure
>pdb|4FC6|A Chain A, Studies On Dcr Shed New Light On Peroxisomal Beta-Oxidation: Crystal Structure Of The Ternary Complex Of Pdcr Length = 277 Back     alignment and structure
>pdb|2GDZ|A Chain A, Crystal Structure Of 15-Hydroxyprostaglandin Dehydrogenase Type1, Complexed With Nad+ Length = 267 Back     alignment and structure
>pdb|3KSU|A Chain A, Crystal Structure Of Short-Chain Dehydrogenase From Oenococcus Oeni Psu-1 Length = 262 Back     alignment and structure
>pdb|1W73|A Chain A, Binary Structure Of Human Decr Solved By Semet Sad. Length = 302 Back     alignment and structure
>pdb|3V1T|C Chain C, Crystal Structure Of A Putative Ketoacyl Reductase (Fabg4) From Mycobacterium Tuberculosis H37rv At 1.9 Angstrom Resolution Length = 462 Back     alignment and structure
>pdb|3LLS|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Mycobacterium Tuberculosis Length = 475 Back     alignment and structure
>pdb|4FW8|A Chain A, Crystal Structure Of Fabg4 Complexed With Coenzyme Nadh Length = 454 Back     alignment and structure
>pdb|2EHD|A Chain A, Crystal Structure Analysis Of Oxidoreductase Length = 234 Back     alignment and structure
>pdb|3M1L|A Chain A, Crystal Strucutre Of A C-Terminal Trunacted Mutant Of A Putative Ketoacyl Reductase (Fabg4) From Mycobacterium Tuberculosis H37rv At 2.5 Angstrom Resolution Length = 432 Back     alignment and structure
>pdb|3D3W|A Chain A, Structure Of L-Xylulose Reductase With Bound Coenzyme, Phosphate And Hydroxide Length = 244 Back     alignment and structure
>pdb|3Q6I|A Chain A, Crystal Structure Of Fabg4 And Coenzyme Binary Complex Length = 446 Back     alignment and structure
>pdb|1PR9|A Chain A, Human L-Xylulose Reductase Holoenzyme Length = 244 Back     alignment and structure
>pdb|3E9Q|A Chain A, Crystal Structure Of The Short Chain Dehydrogenase From Shigella Flexneri Length = 273 Back     alignment and structure
>pdb|3OML|A Chain A, Structure Of Full-Length Peroxisomal Multifunctional Enzyme Type 2 From Drosophila Melanogaster Length = 613 Back     alignment and structure
>pdb|3OML|A Chain A, Structure Of Full-Length Peroxisomal Multifunctional Enzyme Type 2 From Drosophila Melanogaster Length = 613 Back     alignment and structure
>pdb|1HXH|A Chain A, Comamonas Testosteroni 3beta17BETA HYDROXYSTEROID Dehydrogenase Length = 253 Back     alignment and structure
>pdb|3F1K|A Chain A, Crystal Structure Of Ycik From E. Coli, An Oxidoreductase, Complexed With Nadp+ At 2.6a Resolution Length = 252 Back     alignment and structure
>pdb|3I1J|A Chain A, Structure Of A Putative Short Chain Dehydrogenase From Pseudomonas Syringae Length = 247 Back     alignment and structure
>pdb|3BMC|A Chain A, Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma Brucei In Ternary Complex With Cofactor (Nadp+) And Substrate (Folate) Length = 288 Back     alignment and structure
>pdb|3BMC|B Chain B, Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma Brucei In Ternary Complex With Cofactor (Nadp+) And Substrate (Folate) Length = 288 Back     alignment and structure
>pdb|3UN1|A Chain A, Crystal Structure Of An Oxidoreductase From Sinorhizobium Meliloti 1021 Length = 260 Back     alignment and structure
>pdb|3SVT|A Chain A, Structure Of A Short-Chain Type DehydrogenaseREDUCTASE FROM Mycobacterium Ulcerans Length = 281 Back     alignment and structure
>pdb|3SVT|A Chain A, Structure Of A Short-Chain Type DehydrogenaseREDUCTASE FROM Mycobacterium Ulcerans Length = 281 Back     alignment and structure
>pdb|3PGX|A Chain A, Crystal Structure Of A Putative Carveol Dehydrogenase From Mycobacterium Paratuberculosis Bound To Nicotinamide Adenine Dinucleotide Length = 280 Back     alignment and structure
>pdb|3U0B|A Chain A, Crystal Structure Of An Oxidoreductase From Mycobacterium Smegmatis Length = 454 Back     alignment and structure
>pdb|2ET6|A Chain A, (3r)-Hydroxyacyl-Coa Dehydrogenase Domain Of Candida Tropicalis Peroxisomal Multifunctional Enzyme Type 2 Length = 604 Back     alignment and structure
>pdb|2WD7|A Chain A, Pteridine Reductase 1 (Ptr1) From Trypanosoma Brucei In Complex With Nadp And Ddd00066750 Length = 268 Back     alignment and structure
>pdb|2BGK|A Chain A, X-Ray Structure Of Apo-Secoisolariciresinol Dehydrogenase Length = 278 Back     alignment and structure
>pdb|3UXY|A Chain A, The Crystal Structure Of Short Chain Dehydrogenase From Rhodobacter Sphaeroides Length = 266 Back     alignment and structure
>pdb|3RKU|A Chain A, Substrate Fingerprint And The Structure Of Nadp+ Dependent Serine Dehydrogenase From Saccharomyces Cerevisiae Complexed With Nadp+ Length = 287 Back     alignment and structure
>pdb|3P19|A Chain A, Improved Nadph-Dependent Blue Fluorescent Protein Length = 266 Back     alignment and structure
>pdb|2YW9|A Chain A, Crystal Structure Of Tt0143 From Thermus Thermophilus Hb8 Length = 261 Back     alignment and structure
>pdb|1ULU|A Chain A, Crystal Structure Of Tt0143 From Thermus Thermophilus Hb8 Length = 261 Back     alignment and structure
>pdb|1CYD|A Chain A, Carbonyl Reductase Complexed With Nadph And 2-Propanol Length = 244 Back     alignment and structure
>pdb|1BDB|A Chain A, Cis-Biphenyl-2,3-Dihydrodiol-2,3-Dehydrogenase From Pseudomonas Sp. Lb400 Length = 277 Back     alignment and structure
>pdb|3JQ7|A Chain A, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma Brucei In Ternary Complex With Cofactor (Nadp+) And Inhibitor 6- Phenylpteridine-2,4,7-Triamine (Dx2) Length = 288 Back     alignment and structure
>pdb|3JQ7|B Chain B, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma Brucei In Ternary Complex With Cofactor (Nadp+) And Inhibitor 6- Phenylpteridine-2,4,7-Triamine (Dx2) Length = 288 Back     alignment and structure
>pdb|3SC4|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase (A0qtm2 Homolog) Mycobacterium Thermoresistibile Length = 285 Back     alignment and structure
>pdb|3SC4|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase (A0qtm2 Homolog) Mycobacterium Thermoresistibile Length = 285 Back     alignment and structure
>pdb|3NYW|A Chain A, Crystal Structure Of A Betaketoacyl-[acp] Reductase (Fabg) From Bacteroides Thetaiotaomicron Length = 250 Back     alignment and structure
>pdb|3LF1|A Chain A, Apo Structure Of The Short Chain Oxidoreductase Q9hya2 From Pseudomonas Aeruginosa Pao1 Containing An Atypical Catalytic Center Length = 265 Back     alignment and structure
>pdb|1MXH|A Chain A, Crystal Structure Of Substrate Complex Of Putative Pteridine Reductase 2 (Ptr2) From Trypanosoma Cruzi Length = 276 Back     alignment and structure
>pdb|2WD7|B Chain B, Pteridine Reductase 1 (Ptr1) From Trypanosoma Brucei In Complex With Nadp And Ddd00066750 Length = 268 Back     alignment and structure
>pdb|2C7V|A Chain A, Structure Of Trypanosoma Brucei Pteridine Reductase (Ptr1) In Ternary Complex With Cofactor And The Antifolate Methotrexate Length = 268 Back     alignment and structure
>pdb|1PWX|A Chain A, Crystal Structure Of The Haloalcohol Dehalogenase Hhec Complexed With Bromide Length = 254 Back     alignment and structure
>pdb|1MXF|A Chain A, Crystal Structure Of Inhibitor Complex Of Putative Pteridine Reductase 2 (Ptr2) From Trypanosoma Cruzi Length = 276 Back     alignment and structure
>pdb|3T7C|A Chain A, Crystal Structure Of Carveol Dehydrogenase From Mycobacterium Avium Bound To Nad Length = 299 Back     alignment and structure
>pdb|3GED|A Chain A, Fingerprint And Structural Analysis Of A Apo Scor Enzyme From Clostridium Thermocellum Length = 247 Back     alignment and structure
>pdb|1E3W|A Chain A, Rat Brain 3-Hydroxyacyl-Coa Dehydrogenase Binary Complex With Nadh And 3-Keto Butyrate Length = 261 Back     alignment and structure
>pdb|3GRK|A Chain A, Crystal Structure Of Short Chain Dehydrogenase Reductase Sdr Glucose-Ribitol Dehydrogenase From Brucella Melitensis Length = 293 Back     alignment and structure
>pdb|4DRY|A Chain A, The Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protein] Reductase From Rhizobium Meliloti Length = 281 Back     alignment and structure
>pdb|4DRY|A Chain A, The Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protein] Reductase From Rhizobium Meliloti Length = 281 Back     alignment and structure
>pdb|1U7T|A Chain A, Crystal Structure Of AbadHSD10 WITH A BOUND INHIBITOR Length = 261 Back     alignment and structure
>pdb|1E3S|A Chain A, Rat Brain 3-Hydroxyacyl-Coa Dehydrogenase Binary Complex With Nadh Length = 261 Back     alignment and structure
>pdb|1E6W|A Chain A, Rat Brain 3-Hydroxyacyl-Coa Dehydrogenase Binary Complex With Nadh And Estradiol Length = 260 Back     alignment and structure
>pdb|2O23|A Chain A, The Structure Of Wild-Type Human Hadh2 (17beta-Hydroxysteroid Dehydrogenase Type 10) Bound To Nad+ At 1.2 A Length = 265 Back     alignment and structure
>pdb|3UWR|A Chain A, Crystal Structure Of Carveol Dehydrogenase From Mycobacterium Avium Strain 104 Length = 286 Back     alignment and structure
>pdb|1SO8|A Chain A, Abeta-bound Human Abad Structure [also Known As 3-hydroxyacyl-coa Dehydrogenase Type Ii (type Ii Hadh), Endoplasmic Reticulum- Associated Amyloid Beta-peptide Binding Protein (erab)] Length = 261 Back     alignment and structure
>pdb|4BB6|A Chain A, Free-Wilson And Structural Approaches To Co-Optimising Human And Rodent Isoform Potency For 11b-Hydroxysteroid Dehydrogenase Type 1 11b-Hsd1 Inhibitors Length = 292 Back     alignment and structure
>pdb|4HFR|A Chain A, Human 11beta-Hydroxysteroid Dehydrogenase Type 1 In Complex With An Orally Bioavailable Acidic Inhibitor Azd4017. Length = 272 Back     alignment and structure
>pdb|4BB5|A Chain A, Free-Wilson And Structural Approaches To Co-Optimising Human And Rodent Isoform Potency For 11b-Hydroxysteroid Dehydrogenase Type 1 11b-Hsd1 Inhibitors Length = 292 Back     alignment and structure
>pdb|3E03|A Chain A, Crystal Structure Of A Putative Dehydrogenase From Xanthomonas Campestris Length = 274 Back     alignment and structure
>pdb|3SX2|A Chain A, Crystal Structure Of A Putative 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Mycobacterium Paratuberculosis In Complex With Nad Length = 278 Back     alignment and structure
>pdb|3TSC|A Chain A, Crystal Structure Of Short Chain Dehydrogenase Map_2410 From Mycobacterium Paratuberculosis Bound To Nad Length = 277 Back     alignment and structure
>pdb|1GZ6|A Chain A, (3r)-Hydroxyacyl-Coa Dehydrogenase Fragment Of Rat Peroxisomal Multifunctional Enzyme Type 2 Length = 319 Back     alignment and structure
>pdb|1GZ6|A Chain A, (3r)-Hydroxyacyl-Coa Dehydrogenase Fragment Of Rat Peroxisomal Multifunctional Enzyme Type 2 Length = 319 Back     alignment and structure
>pdb|3PPI|A Chain A, Crystal Structure Of 3-Hydroxyacyl-Coa Dehydrogenase Type-2 From Mycobacterium Avium Length = 281 Back     alignment and structure
>pdb|2ILT|A Chain A, Human 11-Beta-Hydroxysteroid Dehydrogenase (Hsd1) With Nadp And Adamantane Sulfone Inhibitor Length = 275 Back     alignment and structure
>pdb|2RBE|A Chain A, The Discovery Of 2-Anilinothiazolones As 11beta-Hsd1 Inhibitors Length = 275 Back     alignment and structure
>pdb|2BEL|A Chain A, Structure Of Human 11-Beta-Hydroxysteroid Dehydrogenase In Complex With Nadp And Carbenoxolone Length = 283 Back     alignment and structure
>pdb|1ZBQ|A Chain A, Crystal Structure Of Human 17-beta-hydroxysteroid Dehydrogenase Type 4 In Complex With Nad Length = 327 Back     alignment and structure
>pdb|1ZBQ|A Chain A, Crystal Structure Of Human 17-beta-hydroxysteroid Dehydrogenase Type 4 In Complex With Nad Length = 327 Back     alignment and structure
>pdb|2IRW|A Chain A, Human 11-Beta-Hydroxysteroid Dehydrogenase (Hsd1) With Nadp And Adamantane Ether Inhibitor Length = 264 Back     alignment and structure
>pdb|1XU7|A Chain A, Crystal Structure Of The Interface Open Conformation Of Tetrameric 11b-hsd1 Length = 286 Back     alignment and structure
>pdb|3D5Q|A Chain A, Crystal Structure Of 11b-Hsd1 In Complex With Triazole Inhibitor Length = 272 Back     alignment and structure
>pdb|3PDJ|A Chain A, Crystal Structure Of Human 11-Beta-Hydroxysteroid Dehydrogenase 1 (11b-Hsd1) In Complex With 4,4-Disubstituted Cyclohexylbenzamide Inhibitor Length = 273 Back     alignment and structure
>pdb|3CH6|A Chain A, Crystal Structure Of 11beta-Hsd1 Double Mutant (L262r, F278e) Complexed With (3,3-Dimethylpiperidin-1-Yl)(6-(3- Fluoro-4-Methylphenyl)pyridin-2-Yl)methanone Length = 286 Back     alignment and structure
>pdb|2QQ5|A Chain A, Crystal Structure Of Human Sdr Family Member 1 Length = 260 Back     alignment and structure
>pdb|4IXT|A Chain A, Structure Of A 37-fold Mutant Of Halohydrin Dehalogenase (hhec) Bound To Ethyl (r)-4-cyano-3-hydroxybutyrate Length = 254 Back     alignment and structure
>pdb|4E4Y|A Chain A, The Crystal Structure Of A Short Chain Dehydrogenase Family Protein From Francisella Tularensis Subsp. Tularensis Schu S4 Length = 244 Back     alignment and structure
>pdb|4EIT|A Chain A, Crystal Structure Of An Enoyl-(Acyl Carrier Protein) Reductase From Bartonella Henselae Length = 276 Back     alignment and structure
>pdb|3KZV|A Chain A, The Crystal Structure Of A Cytoplasmic Protein With Unknown Function From Saccharomyces Cerevisiae Length = 254 Back     alignment and structure
>pdb|4DA9|A Chain A, Crystal Structure Of Putative Short-Chain DehydrogenaseREDUCTASE FROM Sinorhizobium Meliloti 1021 Length = 280 Back     alignment and structure
>pdb|3QLJ|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase From Mycobacterium Avium Length = 322 Back     alignment and structure
>pdb|1ZMO|A Chain A, Apo Structure Of Haloalcohol Dehalogenase Hhea Of Arthrobacter Sp. Ad2 Length = 244 Back     alignment and structure
>pdb|1FJH|A Chain A, The Crystal Structure Of 3-Alpha-Hydroxysteroid Dehydrogenase From Comamonas Testosteroni, A Member Of The Short Chain DehydrogenaseREDUCTASE FAMILY Length = 257 Back     alignment and structure
>pdb|2BD0|A Chain A, Chlorobium Tepidum Sepiapterin Reductase Complexed With Nadp And Sepiapterin Length = 244 Back     alignment and structure
>pdb|3TL3|A Chain A, Structure Of A Short-Chain Type DehydrogenaseREDUCTASE FROM Mycobacterium Ulcerans Length = 257 Back     alignment and structure
>pdb|3GMD|A Chain A, Structure-Based Design Of 7-Azaindole-Pyrrolidines As Inhibitors Of 11beta-Hydroxysteroid-Dehydrogenase Type I Length = 264 Back     alignment and structure
>pdb|1ENO|A Chain A, Brassica Napus Enoyl Acp ReductaseNAD BINARY COMPLEX AT PH 8.0 AND Room Temperature Length = 312 Back     alignment and structure
>pdb|1D7O|A Chain A, Crystal Structure Of Brassica Napus Enoyl Acyl Carrier Protein Reductase Complexed With Nad And Triclosan Length = 297 Back     alignment and structure
>pdb|3M1A|A Chain A, The Crystal Structure Of A Short-Chain Dehydrogenase From Streptomyces Avermitilis To 2a Length = 281 Back     alignment and structure
>pdb|3NRC|A Chain A, Crystal Stucture Of The Francisella Tularensis Enoyl-Acyl Carrier Protein Reductase (Fabi) In Complex With Nad+ And Triclosan Length = 280 Back     alignment and structure
>pdb|3UVE|A Chain A, Crystal Structure Of Carveol Dehydrogenase ((+)-Trans-Carveol Dehydrogenase) From Mycobacterium Avium Length = 286 Back     alignment and structure
>pdb|2JJY|A Chain A, Crystal Structure Of Francisella Tularensis Enoyl Reductase (Ftfabi) With Bound Nad Length = 268 Back     alignment and structure
>pdb|2JAP|A Chain A, Clavulanic Acid Dehydrogenase: Structural And Biochemical Analysis Of The Final Step In The Biosynthesis Of The Beta- Lactamase Inhibitor Clavulanic Acid Length = 247 Back     alignment and structure
>pdb|1Y5M|A Chain A, The Crystal Structure Of Murine 11b-Hydroxysteroid Dehydrogenase: An Important Therapeutic Target For Diabetes Length = 276 Back     alignment and structure
>pdb|4GKB|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase Homolog (Target Efi- 505321) From Burkholderia Multivorans, Unliganded Structure Length = 258 Back     alignment and structure
>pdb|1YB1|A Chain A, Crystal Structure Of Human 17-Beta-Hydroxysteroid Dehydrogenase Type Xi Length = 272 Back     alignment and structure
>pdb|2NWQ|A Chain A, Short Chain Dehydrogenase From Pseudomonas Aeruginosa Length = 272 Back     alignment and structure
>pdb|1CWU|A Chain A, Brassica Napus Enoyl Acp Reductase A138g Mutant Complexed With Nad+ And Thienodiazaborine Length = 296 Back     alignment and structure
>pdb|3O26|A Chain A, The Structure Of Salutaridine Reductase From Papaver Somniferum Length = 311 Back     alignment and structure
>pdb|3ASU|A Chain A, Crystal Structure Of Serine Dehydrogenase From Escherichia Coli Length = 248 Back     alignment and structure
>pdb|2JAH|A Chain A, Biochemical And Structural Analysis Of The Clavulanic Acid Dehydeogenase (Cad) From Streptomyces Clavuligerus Length = 247 Back     alignment and structure
>pdb|2PD3|A Chain A, Crystal Structure Of The Helicobacter Pylori Enoyl-Acyl Carrier Protein Reductase In Complex With Hydroxydiphenyl Ether Compounds, Triclosan And Diclosan Length = 275 Back     alignment and structure
>pdb|3K2E|A Chain A, Crystal Structure Of Enoyl-(Acyl-Carrier-Protein) Reductase From Anaplasma Phagocytophilum At 1.9a Resolution Length = 296 Back     alignment and structure
>pdb|4H15|A Chain A, Crystal Structure Of A Short Chain Alcohol Dehydrogenase-Related Dehydrogenase (Target Id Nysgrc-011812) From Sinorhizobium Meliloti 1021 In Space Group P21 Length = 261 Back     alignment and structure
>pdb|1P33|A Chain A, Pteridine Reductase From Leishmania Tarentolae Complex With Nadph And Mtx Length = 289 Back     alignment and structure
>pdb|2QIO|A Chain A, X-Ray Structure Of Enoyl-Acyl Carrier Protein Reductase From Bacillus Anthracis With Triclosan Length = 256 Back     alignment and structure
>pdb|1N5D|A Chain A, Crystal Structure Of Porcine Testicular Carbonyl Reductase 20beta-Hydroxysteroid Dehydrogenase Length = 288 Back     alignment and structure
>pdb|3OJF|A Chain A, Crystal Structure Of The Bacillus Cereus Enoyl-Acyl Carrier Protein Reductase With Nadp+ And Indole Naphthyridinone (Complex Form) Length = 257 Back     alignment and structure
>pdb|4ALI|A Chain A, Crystal Structure Of S. Aureus Fabi In Complex With Nadp And Triclosan (P1) Length = 282 Back     alignment and structure
>pdb|3GNT|A Chain A, Crystal Structure Of The Staphylococcus Aureus Enoyl-Acyl Carrier Protein Reductase (Fabi) In Apo Form (Two Molecules In Au) Length = 256 Back     alignment and structure
>pdb|4ALL|A Chain A, Crystal Structure Of S. Aureus Fabi In Complex With Nadp And Triclosan (P212121) Length = 277 Back     alignment and structure
>pdb|3GNS|A Chain A, Crystal Structure Of The Staphylococcus Aureus Enoyl-Acyl Carrier Protein Reductase (Fabi) In Apo Form (One Molecule In Au) Length = 260 Back     alignment and structure
>pdb|1E7W|A Chain A, One Active Site, Two Modes Of Reduction Correlate The Mechanism Of Leishmania Pteridine Reductase With Pterin Metabolism And Antifolate Drug Resistance In Trpanosomes Length = 291 Back     alignment and structure
>pdb|1W0C|A Chain A, Inhibition Of Leishmania Major Pteridine Reductase (Ptr1) By 2,4,6-Triaminoquinazoline; Structure Of The Nadp Ternary Complex. Length = 307 Back     alignment and structure
>pdb|4DYV|A Chain A, Crystal Structure Of A Short-Chain DehydrogenaseREDUCTASE SDR FROM Xanthobacter Autotrophicus Py2 Length = 272 Back     alignment and structure
>pdb|2QHX|A Chain A, Structure Of Pteridine Reductase From Leishmania Major Complexed With A Ligand Length = 328 Back     alignment and structure
>pdb|1E92|A Chain A, Pteridine Reductase 1 From Leishmania Major Complexed With Nadp+ And Dihydrobiopterin Length = 288 Back     alignment and structure
>pdb|2HRB|A Chain A, Crystal Structure Of Human Carbonyl Reductase 3, Complexed With Nadp+ Length = 274 Back     alignment and structure
>pdb|3E9N|A Chain A, Crystal Structure Of A Putative Short-Chain DehydrogenaseREDUCTASE FROM CORYNEBACTERIUM GLUTAMICUM Length = 245 Back     alignment and structure
>pdb|3TN7|A Chain A, Crystal Structure Of Short-Chain Alcohol Dehydrogenase From Hyperthermophilic Archaeon Thermococcus Sibiricus Complexed With 5- Hydroxy-Nadp Length = 257 Back     alignment and structure
>pdb|3L77|A Chain A, X-Ray Structure Alcohol Dehydrogenase From Archaeon Thermococcus Sibiricus Complexed With 5-Hydroxy-Nadp Length = 235 Back     alignment and structure
>pdb|4FS3|A Chain A, Crystal Structure Of Staphylococcus Aureus Enoyl-Acp Reductase In Complex With Nadp And Afn-1252 Length = 256 Back     alignment and structure
>pdb|3G49|A Chain A, N-(Pyridin-2-Yl) Arylsulfonamide Inhibitors Of 11b-Hydroxysteroid Dehydrogenase Type 1: Discovery Of Pf-915275 Length = 277 Back     alignment and structure
>pdb|3G49|A Chain A, N-(Pyridin-2-Yl) Arylsulfonamide Inhibitors Of 11b-Hydroxysteroid Dehydrogenase Type 1: Discovery Of Pf-915275 Length = 277 Back     alignment and structure
>pdb|3DWF|A Chain A, Crystal Structure Of The Guinea Pig 11beta-Hydroxysteroid Dehydrogenase Type 1 Mutant F278e Length = 276 Back     alignment and structure
>pdb|3DWF|A Chain A, Crystal Structure Of The Guinea Pig 11beta-Hydroxysteroid Dehydrogenase Type 1 Mutant F278e Length = 276 Back     alignment and structure
>pdb|3LZ6|A Chain A, Guinea Pig 11beta Hydroxysteroid Dehydrogenase With Pf-877423 Length = 263 Back     alignment and structure
>pdb|3LZ6|A Chain A, Guinea Pig 11beta Hydroxysteroid Dehydrogenase With Pf-877423 Length = 263 Back     alignment and structure
>pdb|3OIF|A Chain A, Crystal Structure Of Enoyl-Acp Reductases I (Fabi) From B. Subtilis (Complex With Nad And Tcl) Length = 266 Back     alignment and structure
>pdb|2V0C|A Chain A, Leucyl-Trna Synthetase From Thermus Thermophilus Complexed With A Sulphamoyl Analogue Of Leucyl-Adenylate In The Synthetic Site And An Adduct Of Amp With 5-Fluoro-1,3- Dihydro-1-Hydroxy-2,1-Benzoxaborole (An2690) In The Editing Site Length = 878 Back     alignment and structure
>pdb|1OBH|A Chain A, Leucyl-Trna Synthetase From Thermus Thermophilus Complexed With A Pre-Transfer Editing Substrate Analogue In Both Synthetic Active Site And Editing Site Length = 878 Back     alignment and structure
>pdb|1XSE|A Chain A, Crystal Structure Of Guinea Pig 11beta-Hydroxysteroid Dehydrogenase Type 1 Length = 295 Back     alignment and structure
>pdb|1XSE|A Chain A, Crystal Structure Of Guinea Pig 11beta-Hydroxysteroid Dehydrogenase Type 1 Length = 295 Back     alignment and structure
>pdb|1IOL|A Chain A, Estrogenic 17-beta Hydroxysteroid Dehydrogenase Complexed 17-beta- Estradiol Length = 327 Back     alignment and structure
>pdb|2XOX|A Chain A, Crystal Structure Of Pteridine Reductase (Ptr1) From Leishmania Donovani Length = 288 Back     alignment and structure
>pdb|1WZ2|A Chain A, The Crystal Structure Of Leucyl-Trna Synthetase And Trna(Leucine) Complex Length = 967 Back     alignment and structure
>pdb|1QU2|A Chain A, Insights Into Editing From An Ile-Trna Synthetase Structure With Trna(Ile) And Mupirocin Length = 917 Back     alignment and structure
>pdb|1FDS|A Chain A, Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 Complexed With 17- Beta-Estradiol Length = 327 Back     alignment and structure
>pdb|1FDW|A Chain A, Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 Mutant H221q Complexed With Estradiol Length = 327 Back     alignment and structure
>pdb|1A27|A Chain A, Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 C-Terminal Deletion Mutant Complexed With Estradiol And Nadp+ Length = 289 Back     alignment and structure
>pdb|1FDU|A Chain A, Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 Mutant H221l Complexed With Estradiol And Nadp+ Length = 327 Back     alignment and structure
>pdb|1EQU|A Chain A, Type 1 17-Beta Hydroxysteroid Dehydrogenase Equilin Complexed With Nadp+ Length = 327 Back     alignment and structure
>pdb|3EK2|A Chain A, Crystal Structure Of Eonyl-(Acyl Carrier Protein) Reductase From Burkholderia Pseudomallei 1719b Length = 271 Back     alignment and structure
>pdb|1WKB|A Chain A, Crystal Structure Of Leucyl-Trna Synthetase From The Archaeon Pyrococcus Horikoshii Reveals A Novel Editing Domain Orientation Length = 810 Back     alignment and structure
>pdb|1JZQ|A Chain A, Isoleucyl-Trna Synthetase Complexed With Isoleucyl- Adenylate Analogue Length = 821 Back     alignment and structure
>pdb|3PJD|A Chain A, Structure Of Enr G93a Mutant-Nad+-Triclosan Complex Length = 270 Back     alignment and structure
>pdb|3PJE|A Chain A, Structure Of Enr G93s Mutant-Nad+-Triclosan Complex Length = 270 Back     alignment and structure
>pdb|3PJF|A Chain A, Structure Of Enr G93v Mutant-Nad+-Triclosan Complex Length = 270 Back     alignment and structure
>pdb|2O2S|A Chain A, The Structure Of T. Gondii Enoyl Acyl Carrier Protein Reductase In Complex With Nad And Triclosan Length = 315 Back     alignment and structure
>pdb|2DKN|A Chain A, Crystal Structure Of The 3-alpha-hydroxysteroid Dehydrogenase From Pseudomonas Sp. B-0831 Complexed With Nadh Length = 255 Back     alignment and structure
>pdb|1DFG|A Chain A, X-Ray Structure Of Escherichia Coli Enoyl Reductase With Bound Nad And Benzo-Diazaborine Length = 261 Back     alignment and structure
>pdb|1QSG|A Chain A, Crystal Structure Of Enoyl Reductase Inhibition By Triclosan Length = 265 Back     alignment and structure
>pdb|1C14|A Chain A, Crystal Structure Of E Coli Enoyl Reductase-nad+-triclosan Complex Length = 262 Back     alignment and structure
>pdb|3TPC|A Chain A, Crystal Structure Of A Hypothtical Protein Sma1452 From Sinorhizobium Meliloti 1021 Length = 257 Back     alignment and structure
>pdb|3H7A|A Chain A, Crystal Structure Of Short-Chain Dehydrogenase From Rhodopseudomonas Palustris Length = 252 Back     alignment and structure
>pdb|3H7A|A Chain A, Crystal Structure Of Short-Chain Dehydrogenase From Rhodopseudomonas Palustris Length = 252 Back     alignment and structure
>pdb|2O50|A Chain A, The Crystal Structure Of Toxoplasma Gondii Enoyl Acyl Carrier Protein Reductase Length = 315 Back     alignment and structure
>pdb|2PFG|A Chain A, Crystal Structure Of Human Cbr1 In Complex With Bigf2 Length = 276 Back     alignment and structure
>pdb|1WMA|A Chain A, Crystal Structure Of Human Cbr1 In Complex With Hydroxy-pp Length = 276 Back     alignment and structure
>pdb|3UCE|A Chain A, Crystal Structure Of A Small-Chain Dehydrogenase In Complex With Nadph Length = 223 Back     alignment and structure
>pdb|3PXX|A Chain A, Crystal Structure Of Carveol Dehydrogenase From Mycobacterium Avium Bound To Nicotinamide Adenine Dinucleotide Length = 287 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query762
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 1e-127
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 5e-95
2zat_A 260 Dehydrogenase/reductase SDR family member 4; alpha 6e-28
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 9e-16
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 7e-99
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 5e-73
3svt_A 281 Short-chain type dehydrogenase/reductase; ssgcid, 5e-21
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 2e-13
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 6e-95
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 3e-74
3ai3_A 263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 6e-20
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 2e-11
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 7e-95
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 3e-71
1ae1_A 273 Tropinone reductase-I; oxidoreductase, tropane alk 1e-20
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 4e-11
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 2e-93
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 1e-70
2ae2_A 260 Protein (tropinone reductase-II); oxidoreductase, 2e-20
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 4e-11
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 2e-90
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 8e-69
3ucx_A 264 Short chain dehydrogenase; ssgcid, seattle structu 2e-19
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 1e-11
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 6e-89
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 6e-66
1fmc_A 255 7 alpha-hydroxysteroid dehydrogenase; short-chain 2e-19
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 1e-10
1xq1_A266 Putative tropinone reducatse; structural genomics, 4e-87
1xq1_A266 Putative tropinone reducatse; structural genomics, 2e-64
1xq1_A 266 Putative tropinone reducatse; structural genomics, 5e-19
1xq1_A266 Putative tropinone reducatse; structural genomics, 4e-10
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 1e-85
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 6e-62
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 8e-18
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 5e-11
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 2e-85
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 9e-64
4fn4_A 254 Short chain dehydrogenase; NADH-binding, rossmann 1e-19
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 3e-10
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 6e-85
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 2e-63
1iy8_A 267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 6e-19
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 5e-10
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 8e-85
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 5e-61
3awd_A 260 GOX2181, putative polyol dehydrogenase; oxidoreduc 3e-19
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 3e-09
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 9e-85
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 6e-63
2z1n_A 260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 2e-16
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 3e-09
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 2e-84
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 8e-64
3lf2_A 265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 3e-18
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 8e-11
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 2e-84
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 3e-64
3v8b_A 283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 1e-20
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 1e-10
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 3e-84
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 3e-60
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 3e-18
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 5e-10
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 4e-84
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 3e-61
3n74_A 261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 2e-18
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 3e-10
4dqx_A277 Probable oxidoreductase protein; structural genomi 4e-84
4dqx_A277 Probable oxidoreductase protein; structural genomi 4e-62
4dqx_A 277 Probable oxidoreductase protein; structural genomi 9e-20
4dqx_A277 Probable oxidoreductase protein; structural genomi 9e-11
3tox_A280 Short chain dehydrogenase; structural genomics, PS 5e-84
3tox_A280 Short chain dehydrogenase; structural genomics, PS 7e-63
3tox_A 280 Short chain dehydrogenase; structural genomics, PS 9e-19
3tox_A280 Short chain dehydrogenase; structural genomics, PS 2e-10
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 2e-83
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 3e-64
1zem_A 262 Xylitol dehydrogenase; rossmann fold, dinucleotide 2e-19
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 1e-09
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 2e-83
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 2e-61
3gaf_A 256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 5e-18
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 4e-10
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 3e-83
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 4e-60
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 3e-16
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 2e-09
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 6e-83
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 5e-61
3gvc_A 277 Oxidoreductase, probable short-chain type dehydrog 2e-18
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 9e-11
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 9e-83
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 1e-61
4e6p_A 259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 1e-17
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 5e-10
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 2e-82
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 2e-57
1gee_A 261 Glucose 1-dehydrogenase; short-chain dehydrogenase 1e-16
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 3e-09
1xkq_A280 Short-chain reductase family member (5D234); parra 2e-82
1xkq_A280 Short-chain reductase family member (5D234); parra 2e-62
1xkq_A 280 Short-chain reductase family member (5D234); parra 1e-16
1xkq_A280 Short-chain reductase family member (5D234); parra 5e-11
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 2e-82
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 3e-61
4fgs_A 273 Probable dehydrogenase protein; PSI-biology, nysgr 3e-17
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 2e-09
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 2e-82
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 7e-58
3oid_A 258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 2e-19
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 2e-09
1spx_A278 Short-chain reductase family member (5L265); paral 2e-82
1spx_A278 Short-chain reductase family member (5L265); paral 4e-63
1spx_A 278 Short-chain reductase family member (5L265); paral 2e-17
1spx_A278 Short-chain reductase family member (5L265); paral 7e-11
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 4e-82
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 3e-60
3uxy_A 266 Short-chain dehydrogenase/reductase SDR; structura 3e-19
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 3e-11
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 5e-82
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 2e-61
3ak4_A 263 NADH-dependent quinuclidinone reductase; SDR, (R)- 6e-17
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 2e-09
1xhl_A297 Short-chain dehydrogenase/reductase family member 7e-82
1xhl_A297 Short-chain dehydrogenase/reductase family member 2e-62
1xhl_A 297 Short-chain dehydrogenase/reductase family member 5e-17
1xhl_A297 Short-chain dehydrogenase/reductase family member 7e-11
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 9e-82
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 4e-60
3tzq_B 271 Short-chain type dehydrogenase/reductase; ssgcid, 1e-18
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 2e-10
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 3e-81
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 3e-67
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 8e-21
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 9e-12
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 5e-81
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 7e-59
2d1y_A 256 Hypothetical protein TT0321; strucrtural genomics, 1e-18
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 2e-10
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 6e-81
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 2e-61
1yde_A 270 Retinal dehydrogenase/reductase 3; oxidoreductase, 4e-19
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 1e-10
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 7e-81
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 3e-63
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 7e-20
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 3e-11
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 1e-80
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 3e-59
2dtx_A 264 Glucose 1-dehydrogenase related protein; rossmann 3e-19
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 3e-09
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 4e-80
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 1e-58
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 6e-18
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 4e-09
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 6e-80
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 6e-58
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 8e-19
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 4e-09
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 9e-80
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 1e-57
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 6e-15
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 1e-10
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 1e-79
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 4e-56
1zmo_A 244 Halohydrin dehalogenase; haloalcohol dehalogenase, 2e-20
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 2e-10
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 1e-79
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 3e-59
3vtz_A 269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 3e-19
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 3e-09
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 2e-79
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 3e-58
2ag5_A 246 DHRS6, dehydrogenase/reductase (SDR family) member 1e-19
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 5e-11
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 2e-79
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 1e-62
3t4x_A 267 Oxidoreductase, short chain dehydrogenase/reducta; 4e-16
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 5e-09
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 5e-79
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 4e-59
1geg_A 256 Acetoin reductase; SDR family, oxidoreductase; HET 1e-16
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 4e-09
4e4y_A244 Short chain dehydrogenase family protein; structur 8e-79
4e4y_A244 Short chain dehydrogenase family protein; structur 5e-58
4e4y_A 244 Short chain dehydrogenase family protein; structur 2e-18
4e4y_A244 Short chain dehydrogenase family protein; structur 8e-11
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 1e-78
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 2e-58
3a28_C 258 L-2.3-butanediol dehydrogenase; chiral substrate r 9e-17
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 4e-09
4eso_A255 Putative oxidoreductase; NADP, structural genomics 2e-78
4eso_A255 Putative oxidoreductase; NADP, structural genomics 8e-60
4eso_A 255 Putative oxidoreductase; NADP, structural genomics 3e-16
4eso_A255 Putative oxidoreductase; NADP, structural genomics 2e-09
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 3e-78
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 2e-57
1zk4_A 251 R-specific alcohol dehydrogenase; short chain redu 1e-16
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 2e-07
3imf_A257 Short chain dehydrogenase; structural genomics, in 4e-78
3imf_A257 Short chain dehydrogenase; structural genomics, in 7e-56
3imf_A 257 Short chain dehydrogenase; structural genomics, in 4e-15
3imf_A257 Short chain dehydrogenase; structural genomics, in 2e-06
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 6e-78
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 3e-56
4fc7_A 277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 5e-16
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 7e-08
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 1e-77
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 9e-57
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 8e-15
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 1e-08
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 2e-77
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 5e-55
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 2e-17
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 2e-10
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 2e-77
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 7e-58
1hdc_A 254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 3e-17
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 9e-10
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 9e-77
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 1e-54
2wsb_A 254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 2e-17
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 3e-09
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 1e-76
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 2e-54
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 3e-17
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 3e-10
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 3e-76
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 3e-62
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 4e-17
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 6e-10
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 4e-76
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 1e-55
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 8e-17
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 4e-07
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 5e-76
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 2e-57
3zv4_A 281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 8e-18
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 2e-08
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 6e-76
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 1e-55
4g81_D 255 Putative hexonate dehydrogenase; enzyme function i 3e-15
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 1e-08
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 1e-75
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 3e-57
3v2h_A 281 D-beta-hydroxybutyrate dehydrogenase; structural g 4e-18
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 6e-09
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 2e-75
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 3e-56
3ksu_A 262 3-oxoacyl-acyl carrier protein reductase; structur 2e-15
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 3e-08
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 2e-75
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 2e-56
2q2v_A 255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 1e-17
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 1e-08
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 3e-75
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 3e-54
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 2e-15
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 3e-09
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 3e-75
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 5e-54
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 2e-15
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 1e-07
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 4e-75
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 3e-57
2bgk_A 278 Rhizome secoisolariciresinol dehydrogenase; oxidor 8e-17
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 1e-10
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 4e-75
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 8e-55
1zmt_A 254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 1e-18
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 1e-08
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 5e-75
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 5e-53
1o5i_A 249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 2e-16
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 5e-08
1nff_A260 Putative oxidoreductase RV2002; directed evolution 6e-75
1nff_A260 Putative oxidoreductase RV2002; directed evolution 2e-56
1nff_A 260 Putative oxidoreductase RV2002; directed evolution 2e-16
1nff_A260 Putative oxidoreductase RV2002; directed evolution 3e-10
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 8e-75
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 2e-54
1vl8_A 267 Gluconate 5-dehydrogenase; TM0441, structural geno 4e-16
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 2e-08
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 9e-75
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 1e-55
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 4e-15
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 1e-08
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 1e-74
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 5e-54
3is3_A 270 17BETA-hydroxysteroid dehydrogenase; short chain d 3e-15
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 9e-09
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 2e-74
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 5e-55
1hxh_A 253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 2e-16
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 1e-08
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 3e-74
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 1e-54
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 7e-16
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 2e-09
3edm_A259 Short chain dehydrogenase; structural genomics, ox 4e-74
3edm_A259 Short chain dehydrogenase; structural genomics, ox 1e-53
3edm_A 259 Short chain dehydrogenase; structural genomics, ox 4e-17
3edm_A259 Short chain dehydrogenase; structural genomics, ox 1e-07
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 6e-74
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 9e-54
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 4e-15
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 6e-09
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 1e-73
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 9e-53
3pk0_A 262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 3e-16
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 1e-07
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 2e-73
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 9e-54
1g0o_A 283 Trihydroxynaphthalene reductase; protein-NADPH-act 3e-15
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 6e-09
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 2e-73
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 1e-53
2fwm_X 250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 4e-17
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 4e-09
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 3e-73
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 6e-53
1ja9_A 274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 2e-15
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 7e-09
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 7e-73
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 8e-50
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 6e-16
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 5e-09
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 8e-73
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 3e-55
1x1t_A 260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 2e-17
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 6e-09
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 1e-72
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 2e-49
2ekp_A 239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 4e-17
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 4e-09
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 4e-72
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 2e-52
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 5e-16
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 6e-09
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 4e-72
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 1e-50
2a4k_A 263 3-oxoacyl-[acyl carrier protein] reductase; reduct 4e-14
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 6e-09
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 4e-72
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 1e-51
4da9_A 280 Short-chain dehydrogenase/reductase; structural ge 1e-13
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 3e-09
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 7e-72
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 1e-50
1h5q_A 265 NADP-dependent mannitol dehydrogenase; oxidoreduct 1e-13
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 9e-08
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 7e-72
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 4e-52
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 5e-16
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 3e-09
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 2e-71
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 2e-59
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 2e-18
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 4e-08
3rih_A293 Short chain dehydrogenase or reductase; structural 3e-71
3rih_A293 Short chain dehydrogenase or reductase; structural 1e-50
3rih_A 293 Short chain dehydrogenase or reductase; structural 5e-15
3rih_A293 Short chain dehydrogenase or reductase; structural 2e-07
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 4e-70
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 1e-53
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 8e-18
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 9e-10
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 5e-70
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 2e-49
3sju_A 279 Keto reductase; short-chain dehydrogenase, oxidore 4e-13
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 9e-07
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 6e-70
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 6e-49
2rhc_B 277 Actinorhodin polyketide ketoreductase; oxidoreduct 7e-13
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 9e-07
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 6e-70
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 9e-57
2qq5_A 260 DHRS1, dehydrogenase/reductase SDR family member 1 2e-16
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 1e-10
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 2e-69
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 2e-58
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 4e-17
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 1e-09
3cxt_A291 Dehydrogenase with different specificities; rossma 2e-69
3cxt_A291 Dehydrogenase with different specificities; rossma 2e-52
3cxt_A 291 Dehydrogenase with different specificities; rossma 1e-14
3cxt_A291 Dehydrogenase with different specificities; rossma 5e-08
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 2e-69
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 4e-49
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 2e-16
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 4e-07
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 2e-69
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 3e-48
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 4e-15
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 5e-06
3e03_A274 Short chain dehydrogenase; structural genomics, PS 3e-69
3e03_A274 Short chain dehydrogenase; structural genomics, PS 5e-55
3e03_A 274 Short chain dehydrogenase; structural genomics, PS 9e-16
3e03_A274 Short chain dehydrogenase; structural genomics, PS 2e-08
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 3e-69
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 2e-56
3kzv_A 254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 6e-18
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 2e-06
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 1e-68
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 3e-53
2gdz_A 267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 3e-13
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 1e-07
3gem_A260 Short chain dehydrogenase; structural genomics, AP 1e-68
3gem_A260 Short chain dehydrogenase; structural genomics, AP 4e-52
3gem_A260 Short chain dehydrogenase; structural genomics, AP 3e-16
3gem_A260 Short chain dehydrogenase; structural genomics, AP 6e-09
3tsc_A277 Putative oxidoreductase; structural genomics, seat 2e-68
3tsc_A277 Putative oxidoreductase; structural genomics, seat 4e-51
3tsc_A 277 Putative oxidoreductase; structural genomics, seat 1e-15
3tsc_A277 Putative oxidoreductase; structural genomics, seat 4e-10
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 5e-68
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 2e-49
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 8e-13
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 5e-09
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 5e-68
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 1e-48
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 1e-13
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 1e-07
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 2e-67
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 2e-54
3sc4_A 285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 2e-15
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 8e-08
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 2e-67
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 2e-46
3i4f_A 264 3-oxoacyl-[acyl-carrier protein] reductase; struct 5e-11
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 2e-07
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 2e-67
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 2e-49
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 1e-12
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 3e-09
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 7e-67
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 4e-50
3pgx_A 280 Carveol dehydrogenase; structural genomics, seattl 3e-15
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 8e-10
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 1e-66
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 6e-46
1uls_A 245 Putative 3-oxoacyl-acyl carrier protein reductase; 8e-13
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 2e-07
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 4e-65
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 8e-52
3t7c_A 299 Carveol dehydrogenase; structural genomics, seattl 7e-17
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 1e-09
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 7e-65
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 4e-45
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 1e-11
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 3e-07
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 1e-64
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 4e-45
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 1e-11
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 2e-07
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 1e-64
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 3e-52
3uve_A 286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 6e-17
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 8e-10
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 2e-64
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 7e-45
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 2e-11
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 3e-07
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 2e-64
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 3e-44
2pd6_A 264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 2e-09
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 2e-07
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 2e-64
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 5e-47
3dii_A 247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 2e-15
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 3e-07
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 2e-64
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 1e-44
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 1e-11
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 2e-07
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 3e-64
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 5e-54
1sby_A 254 Alcohol dehydrogenase; ternary complex, NAD, trifl 9e-13
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 2e-08
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 4e-64
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 1e-44
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 1e-11
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 2e-07
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 5e-64
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 3e-52
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 7e-14
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 4e-07
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 6e-64
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 1e-46
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 9e-16
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 1e-06
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 1e-63
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 4e-44
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 4e-12
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 3e-07
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 1e-63
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 4e-43
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 1e-11
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 8e-07
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 3e-63
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 1e-43
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 7e-12
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 3e-07
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 3e-63
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 2e-43
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 1e-11
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 6e-07
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 4e-63
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 8e-43
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 1e-11
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 3e-07
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 6e-63
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 1e-44
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 5e-11
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 1e-08
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 6e-63
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 1e-44
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 6e-11
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 7e-09
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 8e-63
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 3e-43
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 1e-11
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 3e-07
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 2e-62
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 4e-43
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 2e-11
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 3e-07
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 2e-62
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 2e-41
2dkn_A 255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 4e-11
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 1e-10
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 4e-62
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 3e-57
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 1e-15
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 3e-09
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 4e-62
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 5e-42
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 3e-11
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 6e-07
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 8e-62
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 9e-42
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 4e-11
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 6e-07
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 9e-62
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 1e-40
1fjh_A 257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 3e-12
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 4e-11
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 2e-61
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 2e-47
3s55_A 281 Putative short-chain dehydrogenase/reductase; stru 4e-16
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 7e-09
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 3e-61
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 3e-51
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 4e-16
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 4e-08
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 2e-60
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 5e-46
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 2e-14
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 4e-11
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 2e-60
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 8e-42
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 4e-12
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 4e-07
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 6e-60
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 1e-47
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 5e-16
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 6e-08
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 8e-60
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 2e-47
3oec_A 317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 5e-15
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 8e-09
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 9e-60
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 4e-43
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 4e-12
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 4e-08
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 1e-59
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 5e-52
3h7a_A 252 Short chain dehydrogenase; oxidoreductase, PSI-2, 1e-16
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 3e-05
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 1e-59
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 1e-51
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 2e-16
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 8e-08
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 1e-59
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 2e-40
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 3e-11
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 3e-07
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 2e-59
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 2e-45
3sx2_A 278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 4e-13
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 3e-09
1gax_A 862 Valrs, valyl-tRNA synthetase; protein-RNA complex, 6e-59
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 6e-58
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 2e-51
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 9e-15
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 2e-06
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 5e-57
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 3e-55
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 5e-15
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 3e-08
3tjr_A301 Short chain dehydrogenase; structural genomics, se 2e-55
3tjr_A301 Short chain dehydrogenase; structural genomics, se 1e-53
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 5e-12
3tjr_A301 Short chain dehydrogenase; structural genomics, se 3e-09
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 3e-55
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 1e-38
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 7e-12
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 3e-06
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 2e-52
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 5e-52
1xu9_A 286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 2e-13
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 4e-04
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 2e-52
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 5e-40
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 3e-09
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 6e-07
1ooe_A236 Dihydropteridine reductase; structural genomics, P 3e-52
1ooe_A236 Dihydropteridine reductase; structural genomics, P 1e-44
1ooe_A236 Dihydropteridine reductase; structural genomics, P 5e-16
1ooe_A236 Dihydropteridine reductase; structural genomics, P 1e-07
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 1e-50
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 3e-50
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 2e-10
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 9e-08
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 1e-49
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 4e-48
3e9n_A 245 Putative short-chain dehydrogenase/reductase; stru 6e-14
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 2e-06
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 2e-48
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 3e-47
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 1e-13
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 3e-06
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 3e-48
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 2e-47
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 3e-14
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 3e-47
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 1e-37
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 8e-09
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 2e-06
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 5e-47
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 1e-37
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 7e-09
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 7e-06
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 7e-46
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 3e-45
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 9e-14
3qlj_A322 Short chain dehydrogenase; structural genomics, se 3e-44
3qlj_A322 Short chain dehydrogenase; structural genomics, se 1e-32
3qlj_A 322 Short chain dehydrogenase; structural genomics, se 4e-09
3qlj_A322 Short chain dehydrogenase; structural genomics, se 1e-05
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 9e-44
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 3e-34
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 1e-08
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 2e-05
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 2e-42
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 3e-42
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 2e-11
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 2e-42
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 1e-41
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 2e-10
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 3e-42
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 5e-41
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 7e-14
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 6e-07
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 3e-42
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 2e-41
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 3e-12
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 1e-05
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 8e-42
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 2e-41
3p19_A 266 BFPVVD8, putative blue fluorescent protein; rossma 2e-11
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 9e-42
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 7e-35
1gz6_A 319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 1e-11
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 2e-05
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 1e-41
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 2e-41
2nwq_A 272 Probable short-chain dehydrogenase; oxidoreductase 2e-10
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 3e-41
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 1e-40
3tfo_A 264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 4e-12
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 3e-41
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 2e-40
3m1a_A 281 Putative dehydrogenase; short, PSI, MCSG, structur 9e-13
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 2e-06
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 3e-41
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 9e-32
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 1e-08
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 1e-05
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 4e-41
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 1e-40
3rku_A 287 Oxidoreductase YMR226C; substrate fingerprint, sho 2e-11
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 7e-41
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 1e-37
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 2e-33
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 3e-30
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 2e-11
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 3e-11
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 2e-05
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 2e-05
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 1e-39
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 2e-38
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 1e-12
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 3e-06
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 1e-38
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 2e-38
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 1e-11
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 3e-08
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 1e-37
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 4e-37
3asu_A 248 Short-chain dehydrogenase/reductase SDR; SDR famil 9e-12
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 1e-36
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 5e-36
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 3e-04
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 4e-36
3oml_A613 GH14720P, peroxisomal multifunctional enzyme type 3e-31
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 3e-10
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 2e-04
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 6e-36
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 9e-36
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 1e-11
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 9e-06
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 1e-34
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 1e-34
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 5e-08
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 7e-07
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 4e-33
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 7e-33
1wma_A 276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 6e-08
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 1e-04
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 6e-33
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 1e-32
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 3e-09
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 1e-06
4alk_A282 ENR, enoyl-[acyl-carrier-protein] reductase [NADPH 4e-31
4alk_A282 ENR, enoyl-[acyl-carrier-protein] reductase [NADPH 3e-19
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 1e-30
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 1e-18
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 2e-30
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 2e-18
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 8e-30
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 2e-17
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 9e-30
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 8e-18
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 3e-29
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 2e-17
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 3e-29
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 2e-17
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 7e-29
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 6e-17
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 3e-28
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 3e-16
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 4e-28
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 5e-16
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 4e-25
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 2e-13
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 2e-24
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 1e-15
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 5e-24
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 6e-15
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 2e-22
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 1e-13
1wz2_A 967 Leucyl-tRNA synthetase; ligase, riken structural g 1e-21
1wkb_A 810 Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, e 4e-20
3lt0_A329 Enoyl-ACP reductase; triclosan, triclosan variant, 9e-19
3lt0_A329 Enoyl-ACP reductase; triclosan, triclosan variant, 2e-13
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 2e-18
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 2e-17
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 4e-12
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 9e-12
1ile_A 821 Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA s 1e-11
3s8m_A422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 3e-09
3s8m_A422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 2e-05
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 2e-05
4arc_A 880 Leucine--tRNA ligase; ligase-RNA complex, nucleoti 3e-05
2v0c_A 878 Aminoacyl-tRNA synthetase; ligase, nucleotide-bind 3e-05
2d5b_A500 Methionyl-tRNA synthetase; rossmann fold, class 1A 4e-04
3zu3_A405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 4e-04
4dlp_A536 Aminoacyl-tRNA synthetase, class I:aminoacyl-tRNA 5e-04
2x1l_A524 Methionyl-tRNA synthetase; nucleotide-binding, pro 5e-04
2csx_A497 Methionyl-tRNA synthetase; ligase, riken structura 5e-04
3kfl_A564 Methionyl-tRNA synthetase; parasite, aminoacyl-tRN 8e-04
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Length = 260 Back     alignment and structure
 Score =  377 bits (972), Expect = e-127
 Identities = 140/258 (54%), Positives = 181/258 (70%), Gaps = 1/258 (0%)

Query: 371 STAVNASRLAGKVAVVTASSDGIGFAIAKRLSTEGASVVISSRKESNVNKAVETLQKEGH 430
           +       L  KVA+VTAS+DGIG AIA+RL+ +GA VV+SSRK+ NV++ V TLQ EG 
Sbjct: 4   TGVERRKPLENKVALVTASTDGIGLAIARRLAQDGAHVVVSSRKQENVDRTVATLQGEGL 63

Query: 431 QKISGVVCHVAKKEDRQKLFEHAEKKFGGIDILVSNAAVNPATGPVVECPENVWDKIFEV 490
             ++G VCHV K EDR++L   A    GG+DILVSNAAVNP  G +++  E VWDKI  V
Sbjct: 64  -SVTGTVCHVGKAEDRERLVAMAVNLHGGVDILVSNAAVNPFFGNIIDATEEVWDKILHV 122

Query: 491 NVKSTFLLTQEVLPYIRKRNGGSIVYVSSIGGLAPFKLLGAYSVSKTALLGLTKAVAQDL 550
           NVK+T L+T+ V+P + KR GGS++ VSS+G   PF  LG Y+VSKTALLGLTK +A +L
Sbjct: 123 NVKATVLMTKAVVPEMEKRGGGSVLIVSSVGAYHPFPNLGPYNVSKTALLGLTKNLAVEL 182

Query: 551 ASENIRVNCLAPGITKTKFAAALYETEEAHEIAVSNVPMGRLAVPDEMGGIVAFLCSDDA 610
           A  NIRVNCLAPG+ KT F+  L+  +   E    ++ + RL  P++  GIV+FLCS+DA
Sbjct: 183 APRNIRVNCLAPGLIKTNFSQVLWMDKARKEYMKESLRIRRLGNPEDCAGIVSFLCSEDA 242

Query: 611 SYITGEVIVAAGGMQSRL 628
           SYITGE +V  GG  SRL
Sbjct: 243 SYITGETVVVGGGTASRL 260


>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Length = 260 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Length = 260 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Length = 260 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Length = 281 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Length = 281 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Length = 281 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Length = 281 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Length = 263 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Length = 263 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Length = 263 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Length = 263 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Length = 273 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Length = 273 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Length = 273 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Length = 273 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Length = 260 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Length = 260 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Length = 260 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Length = 260 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} Length = 264 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} Length = 264 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} Length = 264 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} Length = 264 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Length = 255 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Length = 255 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Length = 255 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Length = 255 Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Length = 266 Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Length = 266 Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Length = 266 Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Length = 266 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Length = 254 Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Length = 254 Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Length = 254 Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Length = 254 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Length = 260 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Length = 260 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Length = 260 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Length = 260 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Length = 260 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Length = 260 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Length = 260 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Length = 260 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Length = 265 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Length = 265 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Length = 265 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Length = 265 Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Length = 283 Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Length = 283 Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Length = 283 Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Length = 283 Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Length = 250 Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Length = 250 Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Length = 250 Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Length = 250 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Length = 261 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Length = 261 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Length = 261 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Length = 261 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Length = 277 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Length = 277 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Length = 277 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Length = 277 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Length = 280 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Length = 280 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Length = 280 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Length = 280 Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Length = 262 Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Length = 262 Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Length = 262 Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Length = 262 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Length = 256 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Length = 256 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Length = 256 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Length = 256 Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Length = 277 Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Length = 277 Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Length = 277 Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Length = 277 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Length = 259 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Length = 259 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Length = 259 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Length = 259 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Length = 261 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Length = 261 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Length = 261 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Length = 261 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 280 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 280 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 280 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 280 Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Length = 273 Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Length = 273 Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Length = 273 Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Length = 273 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Length = 258 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Length = 258 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Length = 258 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Length = 258 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 278 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 278 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 278 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 278 Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Length = 266 Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Length = 266 Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Length = 266 Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Length = 266 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Length = 263 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Length = 263 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Length = 263 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Length = 263 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 297 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 297 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 297 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 297 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} Length = 271 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} Length = 271 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} Length = 271 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} Length = 271 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} Length = 247 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} Length = 247 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} Length = 247 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} Length = 247 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Length = 270 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Length = 270 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Length = 270 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Length = 270 Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Length = 252 Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Length = 252 Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Length = 252 Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Length = 252 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Length = 264 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Length = 264 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Length = 264 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Length = 264 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Length = 253 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Length = 253 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Length = 253 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Length = 253 Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Length = 249 Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Length = 249 Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Length = 249 Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Length = 249 Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Length = 276 Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Length = 276 Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Length = 276 Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Length = 276 Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Length = 244 Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Length = 244 Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Length = 244 Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Length = 244 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Length = 269 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Length = 269 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Length = 269 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Length = 269 Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Length = 246 Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Length = 246 Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Length = 246 Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Length = 246 Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Length = 267 Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Length = 267 Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Length = 267 Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Length = 267 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Length = 244 Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Length = 244 Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Length = 244 Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Length = 244 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Length = 258 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Length = 258 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Length = 258 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Length = 258 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Length = 255 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Length = 255 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Length = 255 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Length = 255 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Length = 251 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Length = 251 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Length = 251 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Length = 251 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Length = 257 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Length = 257 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Length = 257 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Length = 257 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Length = 277 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Length = 277 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Length = 277 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Length = 277 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Length = 302 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Length = 302 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Length = 302 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Length = 302 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Length = 244 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Length = 244 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Length = 244 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Length = 244 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Length = 254 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Length = 254 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Length = 254 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Length = 254 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Length = 254 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Length = 254 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Length = 254 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Length = 254 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Length = 279 Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Length = 279 Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Length = 279 Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Length = 279 Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Length = 281 Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Length = 281 Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Length = 281 Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Length = 281 Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Length = 255 Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Length = 255 Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Length = 255 Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Length = 255 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Length = 262 Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Length = 262 Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Length = 262 Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Length = 262 Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Length = 255 Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Length = 255 Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Length = 255 Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Length = 255 Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Length = 267 Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Length = 267 Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Length = 267 Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Length = 267 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Length = 303 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Length = 303 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Length = 303 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Length = 303 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Length = 278 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Length = 278 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Length = 278 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Length = 278 Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Length = 254 Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Length = 254 Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Length = 254 Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Length = 254 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Length = 249 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Length = 249 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Length = 249 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Length = 249 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Length = 260 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Length = 260 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Length = 260 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Length = 260 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Length = 276 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Length = 276 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Length = 276 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Length = 276 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Length = 270 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Length = 270 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Length = 270 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Length = 270 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Length = 253 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Length = 253 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Length = 253 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Length = 253 Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Length = 258 Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Length = 258 Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Length = 258 Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Length = 258 Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Length = 259 Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Length = 259 Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Length = 259 Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Length = 259 Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Length = 271 Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Length = 271 Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Length = 271 Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Length = 271 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} Length = 262 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} Length = 262 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} Length = 262 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} Length = 262 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Length = 283 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Length = 283 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Length = 283 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Length = 283 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Length = 250 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Length = 250 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Length = 250 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Length = 250 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Length = 274 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Length = 274 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Length = 274 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Length = 274 Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Length = 255 Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Length = 255 Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Length = 255 Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Length = 255 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Length = 260 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Length = 260 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Length = 260 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Length = 260 Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Length = 239 Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Length = 239 Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Length = 239 Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Length = 239 Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} Length = 273 Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} Length = 273 Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} Length = 273 Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} Length = 273 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Length = 263 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Length = 263 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Length = 263 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Length = 263 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Length = 280 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Length = 280 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Length = 280 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Length = 280 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Length = 265 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Length = 265 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Length = 265 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Length = 265 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Length = 272 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Length = 272 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Length = 272 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Length = 272 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Length = 262 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Length = 262 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Length = 262 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Length = 262 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Length = 293 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Length = 293 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Length = 293 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Length = 293 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Length = 260 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Length = 260 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Length = 260 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Length = 260 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Length = 279 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Length = 279 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Length = 279 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Length = 279 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Length = 277 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Length = 277 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Length = 277 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Length = 277 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Length = 260 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Length = 260 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Length = 260 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Length = 260 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Length = 272 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Length = 272 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Length = 272 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Length = 272 Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Length = 294 Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Length = 294 Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Length = 294 Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Length = 294 Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} PDB: 3gdf_A Length = 267 Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} PDB: 3gdf_A Length = 267 Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} PDB: 3gdf_A Length = 267 Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} PDB: 3gdf_A Length = 267 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Length = 274 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Length = 274 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Length = 274 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Length = 274 Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Length = 254 Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Length = 254 Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Length = 254 Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Length = 254 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Length = 260 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Length = 260 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Length = 260 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Length = 260 Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} Length = 277 Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} Length = 277 Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} Length = 277 Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} Length = 277 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Length = 276 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Length = 276 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Length = 276 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Length = 276 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Length = 247 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Length = 247 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Length = 247 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Length = 247 Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Length = 285 Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Length = 285 Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Length = 285 Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Length = 285 Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} Length = 264 Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} Length = 264 Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} Length = 264 Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} Length = 264 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Length = 288 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Length = 288 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Length = 288 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Length = 288 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} Length = 280 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} Length = 280 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} Length = 280 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} Length = 280 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 245 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 245 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 245 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 245 Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Length = 299 Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Length = 299 Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Length = 299 Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Length = 299 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Length = 285 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Length = 285 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Length = 285 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Length = 285 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Length = 248 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Length = 248 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Length = 248 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Length = 248 Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} PDB: 3uwr_A* Length = 286 Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} PDB: 3uwr_A* Length = 286 Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} PDB: 3uwr_A* Length = 286 Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} PDB: 3uwr_A* Length = 286 Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Length = 270 Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Length = 270 Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Length = 270 Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Length = 270 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Length = 264 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Length = 264 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Length = 264 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Length = 264 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} Length = 247 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} Length = 247 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} Length = 247 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} Length = 247 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Length = 254 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Length = 254 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Length = 254 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Length = 254 Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} PDB: 3rsh_A* 3rro_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Length = 248 Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} PDB: 3rsh_A* 3rro_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Length = 248 Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} PDB: 3rsh_A* 3rro_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Length = 248 Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} PDB: 3rsh_A* 3rro_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Length = 248 Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Length = 259 Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Length = 259 Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Length = 259 Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Length = 259 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Length = 291 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Length = 291 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Length = 291 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Length = 291 Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Length = 247 Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Length = 247 Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Length = 247 Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Length = 247 Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} Length = 256 Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} Length = 256 Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} Length = 256 Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} Length = 256 Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Length = 246 Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Length = 246 Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Length = 246 Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Length = 246 Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Length = 269 Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Length = 269 Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Length = 269 Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Length = 269 Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Length = 245 Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Length = 245 Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Length = 245 Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Length = 245 Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Length = 291 Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Length = 291 Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Length = 291 Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Length = 291 Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Length = 328 Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Length = 328 Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Length = 328 Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Length = 328 Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} PDB: 3sj7_A* Length = 246 Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} PDB: 3sj7_A* Length = 246 Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} PDB: 3sj7_A* Length = 246 Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} PDB: 3sj7_A* Length = 246 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Length = 266 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Length = 266 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Length = 266 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Length = 266 Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Length = 255 Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Length = 255 Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Length = 255 Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Length = 255 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} Length = 235 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} Length = 235 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} Length = 235 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} Length = 235 Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Length = 247 Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Length = 247 Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Length = 247 Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Length = 247 Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Length = 253 Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Length = 253 Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Length = 253 Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Length = 253 Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Length = 257 Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Length = 257 Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Length = 257 Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Length = 257 Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} Length = 281 Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} Length = 281 Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} Length = 281 Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} Length = 281 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Length = 251 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Length = 251 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Length = 251 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Length = 251 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} Length = 287 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} Length = 287 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} Length = 287 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} Length = 287 Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Length = 244 Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Length = 244 Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Length = 244 Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Length = 244 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Length = 241 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Length = 241 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Length = 241 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Length = 241 Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Length = 317 Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Length = 317 Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Length = 317 Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Length = 317 Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Length = 269 Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Length = 269 Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Length = 269 Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Length = 269 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Length = 252 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Length = 252 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Length = 252 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Length = 252 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} Length = 249 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} Length = 249 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} Length = 249 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} Length = 249 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Length = 278 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Length = 278 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Length = 278 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Length = 278 Back     alignment and structure
>1gax_A Valrs, valyl-tRNA synthetase; protein-RNA complex, rossmann fold, coiled coil, riken structural genomics/proteomics initiative, RSGI; HET: VAA; 2.90A {Thermus thermophilus} SCOP: a.2.7.3 a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1ivs_A* 1iyw_A Length = 862 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Length = 346 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Length = 346 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Length = 346 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Length = 346 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Length = 250 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Length = 250 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Length = 250 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Length = 250 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Length = 301 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Length = 301 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Length = 301 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Length = 301 Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3q6i_A* 3m1l_A Length = 454 Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3q6i_A* 3m1l_A Length = 454 Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3q6i_A* 3m1l_A Length = 454 Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3q6i_A* 3m1l_A Length = 454 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Length = 286 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Length = 286 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Length = 286 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Length = 286 Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Length = 281 Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Length = 281 Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Length = 281 Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Length = 281 Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 236 Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 236 Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 236 Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 236 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Length = 319 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Length = 319 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Length = 319 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Length = 319 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Length = 245 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Length = 245 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Length = 245 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Length = 245 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Length = 234 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Length = 234 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Length = 234 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Length = 234 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Length = 272 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Length = 272 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Length = 272 Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Length = 257 Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Length = 257 Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Length = 257 Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Length = 257 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Length = 265 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Length = 265 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Length = 265 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Length = 265 Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} Length = 235 Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} Length = 235 Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} Length = 235 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Length = 322 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Length = 322 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Length = 322 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Length = 322 Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Length = 257 Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Length = 257 Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Length = 257 Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Length = 257 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Length = 279 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Length = 279 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Length = 279 Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Length = 247 Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Length = 247 Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Length = 247 Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Length = 202 Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Length = 202 Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Length = 202 Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Length = 202 Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Length = 230 Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Length = 230 Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Length = 230 Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Length = 230 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Length = 266 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Length = 266 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Length = 266 Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Length = 319 Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Length = 319 Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Length = 319 Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Length = 319 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Length = 272 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Length = 272 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Length = 272 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Length = 264 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Length = 264 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Length = 264 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Length = 281 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Length = 281 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Length = 281 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Length = 281 Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 242 Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 242 Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 242 Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 242 Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Length = 287 Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Length = 287 Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Length = 287 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Length = 324 Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Length = 324 Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Length = 324 Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Length = 324 Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Length = 207 Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Length = 207 Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Length = 207 Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Length = 207 Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Length = 248 Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Length = 248 Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Length = 248 Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} Length = 311 Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} Length = 311 Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} Length = 311 Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Length = 613 Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Length = 613 Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Length = 613 Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Length = 613 Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Length = 327 Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Length = 327 Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Length = 327 Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Length = 327 Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 250 Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 250 Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 250 Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 250 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Length = 276 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Length = 276 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Length = 276 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Length = 276 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>4alk_A ENR, enoyl-[acyl-carrier-protein] reductase [NADPH]; oxidoreductase, short-chain dehydrogenase/reductase superfam fatty acid biosynthesis; HET: NAP E9P GLU; 1.90A {Staphylococcus aureus} PDB: 4alj_A* 4ali_A* 4alm_A 4aln_A 3gr6_A* 3gns_A* 3gnt_A 4all_A* Length = 282 Back     alignment and structure
>4alk_A ENR, enoyl-[acyl-carrier-protein] reductase [NADPH]; oxidoreductase, short-chain dehydrogenase/reductase superfam fatty acid biosynthesis; HET: NAP E9P GLU; 1.90A {Staphylococcus aureus} PDB: 4alj_A* 4ali_A* 4alm_A 4aln_A 3gr6_A* 3gns_A* 3gnt_A 4all_A* Length = 282 Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Length = 261 Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Length = 261 Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Length = 266 Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Length = 266 Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Length = 293 Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Length = 293 Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Length = 275 Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Length = 275 Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Length = 296 Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Length = 296 Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Length = 285 Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Length = 285 Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Length = 265 Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Length = 265 Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 2jjy_A* Length = 280 Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 2jjy_A* Length = 280 Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} Length = 271 Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} Length = 271 Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Length = 297 Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Length = 297 Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Length = 269 Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Length = 269 Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Length = 315 Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Length = 315 Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Length = 319 Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Length = 319 Back     alignment and structure
>1wz2_A Leucyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiativ structural genomics, ligase-RNA complex; 3.21A {Pyrococcus horikoshii} Length = 967 Back     alignment and structure
>1wkb_A Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, editing, amino acid, aminoacylation, trnaLeu, structural genomics; 2.05A {Pyrococcus horikoshii} Length = 810 Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Length = 329 Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Length = 329 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Length = 291 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Length = 291 Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Length = 287 Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Length = 287 Back     alignment and structure
>1ile_A Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics; 2.50A {Thermus thermophilus} SCOP: a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1jzq_A* 1jzs_A* Length = 821 Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Length = 422 Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Length = 422 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Back     alignment and structure
>4arc_A Leucine--tRNA ligase; ligase-RNA complex, nucleotide-binding, protein biosynthesis I aminoacyl-tRNA synthetase, ATP-binding; 2.00A {Escherichia coli} PDB: 4aq7_A 4ari_A* 4as1_A* Length = 880 Back     alignment and structure
>2v0c_A Aminoacyl-tRNA synthetase; ligase, nucleotide-binding, protein biosynthesis; HET: LMS ANZ; 1.85A {Thermus thermophilus} PDB: 1h3n_A* 1obc_A* 1obh_A* 2bte_A* 2byt_A 2v0g_A* Length = 878 Back     alignment and structure
>2d5b_A Methionyl-tRNA synthetase; rossmann fold, class 1A AARS, isomerase, structural genomics, NPPSFA; 1.80A {Thermus thermophilus} SCOP: a.27.1.1 c.26.1.1 PDB: 1woy_A 1a8h_A 2d54_A Length = 500 Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Length = 405 Back     alignment and structure
>4dlp_A Aminoacyl-tRNA synthetase, class I:aminoacyl-tRNA synthetase, class IA:methionyl-tRNA...; structural genomics; 2.65A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} Length = 536 Back     alignment and structure
>2x1l_A Methionyl-tRNA synthetase; nucleotide-binding, protein biosynthesis, ligase, aminoacyl- synthetase; HET: ADN CXS; 2.30A {Mycobacterium smegmatis} PDB: 2x1m_A* Length = 524 Back     alignment and structure
>2csx_A Methionyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase/RNA complex; 2.70A {Aquifex aeolicus} PDB: 2ct8_A* Length = 497 Back     alignment and structure
>3kfl_A Methionyl-tRNA synthetase; parasite, aminoacyl-tRNA synthetase, tRNA ligase metrs, methionine, translation, ATP-binding; HET: ME8; 2.00A {Leishmania major} Length = 564 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query762
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 100.0
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 100.0
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 100.0
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 100.0
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 100.0
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 100.0
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 100.0
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 100.0
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 100.0
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 100.0
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 100.0
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 100.0
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 100.0
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 100.0
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 100.0
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 100.0
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 100.0
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 100.0
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 100.0
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 100.0
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 100.0
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 100.0
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 100.0
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 100.0
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 100.0
3rih_A293 Short chain dehydrogenase or reductase; structural 100.0
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 100.0
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 100.0
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 100.0
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 100.0
3tox_A280 Short chain dehydrogenase; structural genomics, PS 100.0
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 100.0
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 100.0
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 100.0
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 100.0
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 100.0
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 100.0
3imf_A257 Short chain dehydrogenase; structural genomics, in 100.0
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 100.0
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 100.0
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 100.0
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 100.0
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 100.0
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 100.0
3tsc_A277 Putative oxidoreductase; structural genomics, seat 100.0
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
4dqx_A277 Probable oxidoreductase protein; structural genomi 100.0
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 100.0
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 100.0
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 100.0
4eso_A255 Putative oxidoreductase; NADP, structural genomics 100.0
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 100.0
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 100.0
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 100.0
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 100.0
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 100.0
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 100.0
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
3edm_A259 Short chain dehydrogenase; structural genomics, ox 100.0
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 100.0
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 100.0
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 100.0
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 100.0
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 100.0
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 100.0
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 100.0
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 100.0
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 100.0
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 100.0
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 100.0
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 100.0
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 100.0
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 100.0
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 100.0
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 100.0
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 100.0
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 100.0
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 100.0
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 100.0
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 100.0
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 100.0
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 100.0
3cxt_A291 Dehydrogenase with different specificities; rossma 100.0
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 100.0
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 100.0
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 100.0
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 100.0
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 100.0
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 100.0
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 100.0
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 100.0
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 100.0
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 100.0
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 100.0
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 100.0
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 100.0
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 100.0
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 100.0
1xhl_A297 Short-chain dehydrogenase/reductase family member 100.0
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 100.0
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 100.0
1xkq_A280 Short-chain reductase family member (5D234); parra 100.0
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 100.0
3e03_A274 Short chain dehydrogenase; structural genomics, PS 100.0
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 100.0
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 100.0
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 100.0
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 100.0
3gem_A260 Short chain dehydrogenase; structural genomics, AP 100.0
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 100.0
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 100.0
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 100.0
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 100.0
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 100.0
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 100.0
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 100.0
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 100.0
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 100.0
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 100.0
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 100.0
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 100.0
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 100.0
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 100.0
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 100.0
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 100.0
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 100.0
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 100.0
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 100.0
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 100.0
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 100.0
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 100.0
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 100.0
3lt0_A329 Enoyl-ACP reductase; triclosan, triclosan variant, 100.0
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 100.0
1spx_A278 Short-chain reductase family member (5L265); paral 100.0
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 100.0
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 100.0
1nff_A260 Putative oxidoreductase RV2002; directed evolution 100.0
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 100.0
3qlj_A322 Short chain dehydrogenase; structural genomics, se 100.0
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 100.0
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 100.0
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 100.0
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 100.0
3zu3_A405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 100.0
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 100.0
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 100.0
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 100.0
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 100.0
4e4y_A244 Short chain dehydrogenase family protein; structur 100.0
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 100.0
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 100.0
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
3s8m_A422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 100.0
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 100.0
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 100.0
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 100.0
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 100.0
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 100.0
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 100.0
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 100.0
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 100.0
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 100.0
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 100.0
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 100.0
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 100.0
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 100.0
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 100.0
1xq1_A266 Putative tropinone reducatse; structural genomics, 100.0
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 100.0
3tox_A280 Short chain dehydrogenase; structural genomics, PS 100.0
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 100.0
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 100.0
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 100.0
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 100.0
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 100.0
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 100.0
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 100.0
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 100.0
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 100.0
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 100.0
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 100.0
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 100.0
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 100.0
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 100.0
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 100.0
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 100.0
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 100.0
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 100.0
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 100.0
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 100.0
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 100.0
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 100.0
3rih_A293 Short chain dehydrogenase or reductase; structural 100.0
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 100.0
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 100.0
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 100.0
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 100.0
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 100.0
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 100.0
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 100.0
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 100.0
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 100.0
3tsc_A277 Putative oxidoreductase; structural genomics, seat 100.0
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 100.0
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 100.0
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 100.0
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 100.0
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 100.0
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 100.0
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 100.0
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 100.0
3imf_A257 Short chain dehydrogenase; structural genomics, in 100.0
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 100.0
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 100.0
4eso_A255 Putative oxidoreductase; NADP, structural genomics 100.0
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 100.0
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 100.0
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 100.0
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 100.0
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 100.0
4dqx_A277 Probable oxidoreductase protein; structural genomi 100.0
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 100.0
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 100.0
3edm_A259 Short chain dehydrogenase; structural genomics, ox 100.0
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 100.0
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 100.0
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 100.0
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 100.0
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 100.0
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 100.0
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 100.0
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 100.0
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 100.0
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 100.0
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 100.0
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 100.0
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 100.0
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 100.0
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 100.0
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 100.0
4eue_A418 Putative reductase CA_C0462; TER, biofuel, synthet 100.0
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 100.0
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 100.0
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 100.0
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 100.0
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 100.0
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 100.0
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 100.0
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 100.0
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 100.0
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 100.0
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 100.0
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 100.0
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 100.0
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 100.0
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 100.0
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 100.0
3tjr_A301 Short chain dehydrogenase; structural genomics, se 100.0
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 100.0
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 100.0
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 100.0
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 100.0
1ooe_A236 Dihydropteridine reductase; structural genomics, P 100.0
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 100.0
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 100.0
3cxt_A291 Dehydrogenase with different specificities; rossma 100.0
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 100.0
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 100.0
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 100.0
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 100.0
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 100.0
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 100.0
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 100.0
3e03_A274 Short chain dehydrogenase; structural genomics, PS 100.0
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 100.0
1xhl_A297 Short-chain dehydrogenase/reductase family member 100.0
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 100.0
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 100.0
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 100.0
3gem_A260 Short chain dehydrogenase; structural genomics, AP 100.0
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 100.0
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 100.0
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 100.0
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 100.0
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 100.0
1xkq_A280 Short-chain reductase family member (5D234); parra 100.0
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 100.0
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 100.0
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 100.0
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 100.0
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 100.0
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 100.0
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 100.0
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 100.0
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 100.0
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 100.0
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 100.0
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 100.0
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 100.0
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 100.0
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 100.0
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 100.0
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 100.0
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 100.0
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 100.0
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 100.0
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 100.0
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 100.0
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 100.0
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 100.0
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 100.0
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 100.0
3qlj_A322 Short chain dehydrogenase; structural genomics, se 100.0
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 100.0
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 100.0
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 100.0
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 100.0
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 100.0
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 100.0
1spx_A278 Short-chain reductase family member (5L265); paral 100.0
1nff_A260 Putative oxidoreductase RV2002; directed evolution 100.0
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 100.0
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 100.0
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 100.0
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 100.0
3zu3_A405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 100.0
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 100.0
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 100.0
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 100.0
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 100.0
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 100.0
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 100.0
3s8m_A422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 100.0
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 100.0
3tjr_A301 Short chain dehydrogenase; structural genomics, se 100.0
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 100.0
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 100.0
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 100.0
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 100.0
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 100.0
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 100.0
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 100.0
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 100.0
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 100.0
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 100.0
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 100.0
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 100.0
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 100.0
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 100.0
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 100.0
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 100.0
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 100.0
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 100.0
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 100.0
3lt0_A329 Enoyl-ACP reductase; triclosan, triclosan variant, 100.0
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 100.0
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 100.0
4e4y_A244 Short chain dehydrogenase family protein; structur 100.0
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 100.0
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 100.0
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 100.0
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 100.0
1xq1_A266 Putative tropinone reducatse; structural genomics, 100.0
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 100.0
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 100.0
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 100.0
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 100.0
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 100.0
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 100.0
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 100.0
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 100.0
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 100.0
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 100.0
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 100.0
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 100.0
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 100.0
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 100.0
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 100.0
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 100.0
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 100.0
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 100.0
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 100.0
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 100.0
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 100.0
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 100.0
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 100.0
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 100.0
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 100.0
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 100.0
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 100.0
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 100.0
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 100.0
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 100.0
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 100.0
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 100.0
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 100.0
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 100.0
1ooe_A236 Dihydropteridine reductase; structural genomics, P 100.0
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 100.0
3oml_A613 GH14720P, peroxisomal multifunctional enzyme type 100.0
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 100.0
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 100.0
4eue_A418 Putative reductase CA_C0462; TER, biofuel, synthet 100.0
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 100.0
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 100.0
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 100.0
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 100.0
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 100.0
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 100.0
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 100.0
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 100.0
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 100.0
3slk_A795 Polyketide synthase extender module 2; rossmann fo 100.0
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 100.0
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 100.0
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 100.0
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 100.0
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 100.0
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 100.0
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 100.0
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 100.0
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 100.0
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 99.97
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 99.97
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 99.97
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 99.97
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 99.96
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 99.96
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 99.96
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 99.96
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 99.96
3slk_A795 Polyketide synthase extender module 2; rossmann fo 99.95
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 99.95
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 99.95
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 99.95
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 99.94
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 99.93
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 99.93
4ggo_A401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 99.92
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 99.92
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 99.92
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.91
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 99.91
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 99.91
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.9
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 99.89
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 99.89
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 99.88
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 99.88
4ggo_A401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 99.88
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 99.88
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 99.88
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 99.87
2vz8_A2512 Fatty acid synthase; transferase, phosphopantethei 99.87
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 99.87
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 99.87
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 99.87
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 99.86
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 99.86
1xq6_A253 Unknown protein; structural genomics, protein stru 99.85
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 99.85
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 99.85
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 99.84
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 99.84
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 99.83
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 99.83
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 99.83
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 99.83
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 99.83
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 99.83
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 99.83
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 99.83
4f6c_A427 AUSA reductase domain protein; thioester reductase 99.82
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 99.82
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 99.82
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 99.82
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 99.82
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 99.82
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 99.82
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 99.81
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 99.81
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 99.81
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 99.81
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 99.81
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 99.81
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 99.81
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 99.81
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 99.8
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 99.8
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 99.8
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 99.8
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 99.8
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
Probab=100.00  E-value=8e-89  Score=795.85  Aligned_cols=509  Identities=25%  Similarity=0.387  Sum_probs=417.3

Q ss_pred             CCCCCEEEEECCcchHHHHHHHHHHHcCCEEEEEcCCh---------hhHHHHHHHHHHcCCCeEEEEEccCCCHHHHHH
Q psy942            9 RLTGKVAVVTASSDGIGFAIAKRLSAEGASVVISSRKE---------SNVNKAVETLQKEGHQKISGVVCHVAKKEDRQK   79 (762)
Q Consensus         9 ~l~gkvalVTGas~GIG~aia~~la~~Ga~Vvi~~r~~---------~~l~~~~~~l~~~g~~~~~~~~~Dvsd~~~v~~   79 (762)
                      +|+||++|||||++|||+++|+.|+++|++|++++|+.         +.++++.+++.+.++ ++   .+|++|.+++++
T Consensus         5 ~l~gkvalVTGas~GIG~a~A~~la~~Ga~Vv~~~~~~~~~~~gr~~~~~~~~~~~i~~~g~-~~---~~d~~d~~~~~~   80 (604)
T 2et6_A            5 DFKDKVVIITGAGGGLGKYYSLEFAKLGAKVVVNDLGGALNGQGGNSKAADVVVDEIVKNGG-VA---VADYNNVLDGDK   80 (604)
T ss_dssp             CCTTCEEEETTTTSHHHHHHHHHHHHTTCEEEEECC-----------CHHHHHHHHHHHTTC-EE---EEECCCTTCHHH
T ss_pred             CCCCCEEEEeCCCcHHHHHHHHHHHHcCCEEEEEeCCccccccccchHHHHHHHHHHHhcCC-eE---EEEcCCHHHHHH
Confidence            58899999999999999999999999999999998865         678888888877665 33   368888888999


Q ss_pred             HHHHHHHhcCCccEEEEcCCCCCCCCCCCCCCHHHHHHHHHHHhHHHHHHHHHHHHHHHcCCCcEEEEecCcccccCCCC
Q psy942           80 LFEHAEKKFGGIDILVSNAAVNPATGPVVECPENVWDKIFEVNVKSTFLLTQEVLPYIRKRNGGSIVYVSSIGGLAPFKL  159 (762)
Q Consensus        80 ~~~~~~~~~G~iDiLVnNAG~~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IVnisS~~~~~~~~~  159 (762)
                      +++++.++||+||+||||||+.. ..++.++++++|+++|++|++|+|+++|+++|+|++++.|+||||||.++..+.++
T Consensus        81 ~v~~~~~~~G~iDiLVnNAGi~~-~~~~~~~~~~~~~~~~~vNl~g~~~~~~a~~p~m~~~~~G~IVnisS~ag~~~~~~  159 (604)
T 2et6_A           81 IVETAVKNFGTVHVIINNAGILR-DASMKKMTEKDYKLVIDVHLNGAFAVTKAAWPYFQKQKYGRIVNTSSPAGLYGNFG  159 (604)
T ss_dssp             HHHHHHHHHSCCCEEEECCCCCC-CBCTTTCCHHHHHHHHHHHTHHHHHHHHHHHHHHHHHTCEEEEEECCHHHHHCCTT
T ss_pred             HHHHHHHHcCCCCEEEECCCCCC-CCChhhCCHHHHHHHHHHHhHHHHHHHHHHHHHHHHcCCCEEEEECCHHHcCCCCC
Confidence            99999999999999999999864 46899999999999999999999999999999999888899999999999999999


Q ss_pred             ChHHHHHHHHHHHHHHHHHHHhCCCCeEEEEEecCcccCcchhhhHHHhhhhhcCCCccccCCCCCcchhhhcCCCCCCC
Q psy942          160 LGAYSVSKTALLGLTKAVAQDLASENIRVNCLAPGITKTKFAAAKKEVKKKETNDEPIVYTSNTAPGEMKDVLGPLPSSY  239 (762)
Q Consensus       160 ~~~Y~asKaal~~lt~~lA~Ela~~gIrVN~V~PG~v~T~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~m~s~Y  239 (762)
                      .++|++||+|+.+|||+||.|++++|||||+|+|| ++|+|.....          +         .+   ..       
T Consensus       160 ~~~Y~asKaal~~lt~~la~El~~~gIrVn~v~Pg-~~T~m~~~~~----------~---------~~---~~-------  209 (604)
T 2et6_A          160 QANYASAKSALLGFAETLAKEGAKYNIKANAIAPL-ARSRMTESIM----------P---------PP---ML-------  209 (604)
T ss_dssp             BHHHHHHHHHHHHHHHHHHHHHGGGTEEEEEEEEC-CCCHHHHTTS----------C---------HH---HH-------
T ss_pred             chHHHHHHHHHHHHHHHHHHHhCccCeEEEEEccC-CcCccccccC----------C---------hh---hh-------
Confidence            99999999999999999999999999999999998 6898753210          0         00   00       


Q ss_pred             CchhhhccccccccccCCCCCccccccccccCCCCcccccCCChhhHHHHHHhccccccccccccccceeecceEeeCCC
Q psy942          240 SPQYVEAAWYPWWEKQGFFKPEYGRKSIGEKNPKGKFVMVIPPPNVTGTLHLGHALTNAVEDSITRWNRMKGKTTLWNPG  319 (762)
Q Consensus       240 ~p~~ve~~w~~~w~~~~~~~~~~~r~~~g~~~~~~~~~i~lpp~~vtg~l~~g~s~~~~~~d~~~r~~~~~G~~~~~~~G  319 (762)
                                              +  ..+            |.+++..+.|+++.. .         +++|+.+.+++|
T Consensus       210 ------------------------~--~~~------------pe~vA~~v~~L~s~~-~---------~itG~~~~vdgG  241 (604)
T 2et6_A          210 ------------------------E--KLG------------PEKVAPLVLYLSSAE-N---------ELTGQFFEVAAG  241 (604)
T ss_dssp             ------------------------T--TCS------------HHHHHHHHHHHTSSS-C---------CCCSCEEEEETT
T ss_pred             ------------------------c--cCC------------HHHHHHHHHHHhCCc-c---------cCCCCEEEECCC
Confidence                                    0  112            888999999988876 5         778888777776


Q ss_pred             CC--------------C-CCchhhHHHHhhhchh----cc-------cccccccchhHHHHHHHHhhhhccccccccccc
Q psy942          320 CD--------------H-AGIATQVVVEKKLWRE----EK-------KTRHEIGREKFIEKVWEWKKEVFSTSTKIMSTA  373 (762)
Q Consensus       320 ~d--------------h-agia~q~~v~~~l~~~----~~-------~~~~~~~r~~f~~~v~~~~~~~~s~~~~~M~~~  373 (762)
                      .-              . ....++.+.+  .|..    ..       ...++.++..+.....+++. .+......    
T Consensus       242 ~~~~~~~~~~~~~~~~~~~~~~~~~v~~--~~~~~~~~~~~~~~~~~~~~~P~~~~d~~~l~~ka~~-~~~~~~~~----  314 (604)
T 2et6_A          242 FYAQIRWERSGGVLFKPDQSFTAEVVAK--RFSEILDYDDSRKPEYLKNQYPFMLNDYATLTNEARK-LPANDASG----  314 (604)
T ss_dssp             EEEEEEEEECCCEECCSSTTCCHHHHHH--HHHHHTCCCCTTSCGGGSCBCCSSSCCHHHHHHHHTT-SCCCCCTT----
T ss_pred             eEEEEEEEeccceecCCCCCCCHHHHHH--HHHHhhchhhccccccccccCcchHHHHHHHHHHHHh-CCcccccc----
Confidence            31              1 1234444433  2321    10       23445555556655555542 22211111    


Q ss_pred             cccccCCCCEEEEeCCCChHHHHHHHHHHHCCCEEEEEcCCcccHHHHHHHHHHcCCCeEEEEEecCCCHHHHHHHHHHH
Q psy942          374 VNASRLAGKVAVVTASSDGIGFAIAKRLSTEGASVVISSRKESNVNKAVETLQKEGHQKISGVVCHVAKKEDRQKLFEHA  453 (762)
Q Consensus       374 ~~~~~l~gkvalVTGas~GIG~aiA~~la~~Ga~Vvl~~r~~~~l~~~~~~l~~~g~~~~~~~~~Dv~~~~~~~~~v~~~  453 (762)
                      ....+|+||++|||||++|||+++|+.|+++|++|++++|+  .++++++++.+.++ ++..+.+|++  ++.+++++++
T Consensus       315 ~~~~~l~gkvalVTGas~GIG~a~A~~la~~Ga~Vv~~~~~--~~~~~~~~i~~~g~-~~~~~~~Dv~--~~~~~~~~~~  389 (604)
T 2et6_A          315 APTVSLKDKVVLITGAGAGLGKEYAKWFAKYGAKVVVNDFK--DATKTVDEIKAAGG-EAWPDQHDVA--KDSEAIIKNV  389 (604)
T ss_dssp             CCCCCCTTCEEEESSCSSHHHHHHHHHHHHTTCEEEEECSS--CCHHHHHHHHHTTC-EEEEECCCHH--HHHHHHHHHH
T ss_pred             ccccccCCCeEEEECcchHHHHHHHHHHHHCCCEEEEEeCc--cHHHHHHHHHhcCC-eEEEEEcChH--HHHHHHHHHH
Confidence            11246899999999999999999999999999999999874  35677788877665 6777788884  5567899999


Q ss_pred             HHHcCCccEEEEcCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCcEEEEecCcccccCCCCChHHH
Q psy942          454 EKKFGGIDILVSNAAVNPATGPVVECPENVWDKIFEVNVKSTFLLTQEVLPYIRKRNGGSIVYVSSIGGLAPFKLLGAYS  533 (762)
Q Consensus       454 ~~~fG~iDiLVNNAG~~~~~~~~~~~~~~~~~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IVnisS~ag~~~~~~~~~Y~  533 (762)
                      .++||+||+||||||+. ...++.++++++|+++|++|+.|+|+++|+++|+|+++++|+||||||.++..+.+++.+|+
T Consensus       390 ~~~~G~iDiLVnNAGi~-~~~~~~~~~~~~~~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IVnisS~ag~~~~~~~~~Y~  468 (604)
T 2et6_A          390 IDKYGTIDILVNNAGIL-RDRSFAKMSKQEWDSVQQVHLIGTFNLSRLAWPYFVEKQFGRIINITSTSGIYGNFGQANYS  468 (604)
T ss_dssp             HHHHSCCCEEEECCCCC-CCBCTTTCCHHHHHHHHHHHTHHHHHHHHHHHHHHHHTTCEEEEEECCHHHHSCCTTBHHHH
T ss_pred             HHhcCCCCEEEECCCCC-CCCChhhCCHHHHHHHHHHHhHHHHHHHHHHHHHHHHcCCCEEEEECChhhccCCCCChhHH
Confidence            99999999999999985 46789999999999999999999999999999999998899999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHhCCCCeEEEEEeCCCcCChhhhhhcCCHHHHHHHhhCCCCCCCCCHHHHHHHHHHHcCCCCCCc
Q psy942          534 VSKTALLGLTKAVAQDLASENIRVNCLAPGITKTKFAAALYETEEAHEIAVSNVPMGRLAVPDEMGGIVAFLCSDDASYI  613 (762)
Q Consensus       534 asKaal~~ltrslA~Ela~~gIrVN~V~PG~v~T~~~~~~~~~~~~~~~~~~~~pl~r~~~pedvA~~v~fL~S~~a~~i  613 (762)
                      +||+||.+|||+||.||+++|||||+|+||+ +|+|...... +          ...+.++|||||++++||+|+.++ +
T Consensus       469 asKaal~~lt~~la~El~~~gIrVn~v~PG~-~T~m~~~~~~-~----------~~~~~~~pe~vA~~v~~L~s~~~~-i  535 (604)
T 2et6_A          469 SSKAGILGLSKTMAIEGAKNNIKVNIVAPHA-ETAMTLSIMR-E----------QDKNLYHADQVAPLLVYLGTDDVP-V  535 (604)
T ss_dssp             HHHHHHHHHHHHHHHHHGGGTEEEEEEEECC-CCCC--------------------CCSSCGGGTHHHHHHTTSTTCC-C
T ss_pred             HHHHHHHHHHHHHHHHhCccCeEEEEEcCCC-CCccccccCc-h----------hhccCCCHHHHHHHHHHHhCCccC-C
Confidence            9999999999999999999999999999995 9998653211 1          123457999999999999999999 9


Q ss_pred             cccEEEeCCCccc
Q psy942          614 TGEVIVAAGGMQS  626 (762)
Q Consensus       614 tG~~i~vdGG~~~  626 (762)
                      ||++|.||||+..
T Consensus       536 tG~~~~vdGG~~~  548 (604)
T 2et6_A          536 TGETFEIGGGWIG  548 (604)
T ss_dssp             CSCEEEEETTEEE
T ss_pred             CCcEEEECCCeeE
Confidence            9999999999764



>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 762
d2ew8a1247 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenas 2e-75
d2ew8a1247 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenas 4e-55
d2ew8a1247 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenas 3e-12
d2ew8a1247 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenas 1e-07
d2d1ya1248 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {T 6e-75
d2d1ya1248 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {T 2e-54
d2d1ya1 248 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {T 3e-12
d2d1ya1248 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {T 9e-11
d1spxa_264 c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nemato 7e-73
d1spxa_264 c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nemato 9e-55
d1spxa_264 c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nemato 5e-10
d1spxa_ 264 c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nemato 1e-09
d1ydea1250 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 2e-72
d1ydea1250 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 2e-53
d1ydea1250 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 1e-10
d1ydea1 250 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 1e-10
d1xg5a_257 c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC41 6e-72
d1xg5a_257 c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC41 5e-54
d1xg5a_257 c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC41 3e-13
d1xg5a_257 c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC41 2e-07
d1xkqa_272 c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorh 3e-70
d1xkqa_272 c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorh 5e-52
d1xkqa_ 272 c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorh 1e-09
d1xkqa_272 c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorh 5e-07
d1xq1a_259 c.2.1.2 (A:) Tropinone reductase {Thale cress (Ara 6e-70
d1xq1a_259 c.2.1.2 (A:) Tropinone reductase {Thale cress (Ara 3e-49
d1xq1a_ 259 c.2.1.2 (A:) Tropinone reductase {Thale cress (Ara 2e-09
d1xq1a_259 c.2.1.2 (A:) Tropinone reductase {Thale cress (Ara 7e-06
d1zk4a1251 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase 2e-69
d1zk4a1251 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase 9e-48
d1zk4a1 251 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase 7e-08
d1zk4a1251 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase 5e-07
d2ae2a_259 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 2e-69
d2ae2a_259 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 4e-49
d2ae2a_ 259 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 3e-09
d2ae2a_259 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 5e-08
d1hxha_253 c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydroge 9e-67
d1hxha_253 c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydroge 1e-47
d1hxha_ 253 c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydroge 5e-11
d1hxha_253 c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydroge 6e-05
d1xhla_274 c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorh 4e-66
d1xhla_274 c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorh 4e-48
d1xhla_274 c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorh 3e-09
d1xhla_ 274 c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorh 0.001
d1cyda_242 c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus muscul 4e-66
d1cyda_242 c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus muscul 6e-44
d1cyda_242 c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus muscul 1e-08
d1cyda_242 c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus muscul 7e-07
d1hdca_254 c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydr 2e-65
d1hdca_254 c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydr 5e-47
d1hdca_ 254 c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydr 7e-08
d1hdca_254 c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydr 1e-07
d2bgka1268 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol de 2e-64
d2bgka1268 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol de 1e-45
d2bgka1 268 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol de 7e-08
d2bgka1268 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol de 1e-05
d1gz6a_302 c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase do 2e-64
d1gz6a_302 c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase do 7e-51
d1gz6a_ 302 c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase do 5e-13
d1gz6a_302 c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase do 5e-07
d1pr9a_244 c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapie 3e-64
d1pr9a_244 c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapie 1e-42
d1pr9a_244 c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapie 3e-09
d1pr9a_244 c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapie 3e-06
d2c07a1251 c.2.1.2 (A:54-304) beta-keto acyl carrier protein 4e-64
d2c07a1251 c.2.1.2 (A:54-304) beta-keto acyl carrier protein 4e-44
d2c07a1251 c.2.1.2 (A:54-304) beta-keto acyl carrier protein 5e-09
d1h5qa_260 c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Aga 5e-64
d1h5qa_260 c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Aga 2e-43
d1h5qa_260 c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Aga 1e-07
d1h5qa_ 260 c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Aga 0.003
d1ulsa_242 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 1e-63
d1ulsa_242 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 7e-44
d1ulsa_242 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 8e-10
d1ulsa_242 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 2e-04
d1vl8a_251 c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga 1e-63
d1vl8a_251 c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga 1e-40
d1vl8a_251 c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga 1e-06
d1iy8a_258 c.2.1.2 (A:) Levodione reductase {Corynebacterium 2e-63
d1iy8a_258 c.2.1.2 (A:) Levodione reductase {Corynebacterium 4e-44
d1iy8a_258 c.2.1.2 (A:) Levodione reductase {Corynebacterium 2e-05
d1iy8a_ 258 c.2.1.2 (A:) Levodione reductase {Corynebacterium 4e-05
d1bdba_276 c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehy 2e-62
d1bdba_276 c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehy 1e-44
d1bdba_ 276 c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehy 6e-09
d1bdba_276 c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehy 5e-04
d1yxma1297 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA re 2e-62
d1yxma1297 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA re 5e-42
d1yxma1297 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA re 3e-07
d1ae1a_258 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 4e-62
d1ae1a_258 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 4e-43
d1ae1a_258 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 1e-06
d1ae1a_ 258 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 5e-04
d1fmca_255 c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase 2e-61
d1fmca_255 c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase 2e-40
d1fmca_255 c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase 8e-06
d1zema1260 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconoba 6e-61
d1zema1260 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconoba 4e-43
d1zema1260 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconoba 6e-08
d1zmta1252 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Ag 7e-61
d1zmta1252 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Ag 2e-41
d1zmta1 252 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Ag 2e-07
d1zmta1252 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Ag 9e-06
d2gdza1254 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrog 1e-60
d2gdza1254 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrog 9e-46
d2gdza1 254 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrog 6e-08
d2gdza1254 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrog 3e-06
d2ag5a1245 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR fami 2e-59
d2ag5a1245 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR fami 4e-40
d2ag5a1245 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR fami 1e-07
d2ag5a1 245 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR fami 3e-07
d2rhca1257 c.2.1.2 (A:5-261) beta-keto acyl carrier protein r 2e-59
d2rhca1257 c.2.1.2 (A:5-261) beta-keto acyl carrier protein r 4e-39
d2rhca1257 c.2.1.2 (A:5-261) beta-keto acyl carrier protein r 3e-08
d1w6ua_294 c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondr 4e-59
d1w6ua_294 c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondr 1e-38
d1w6ua_294 c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondr 2e-07
d1nffa_244 c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycob 6e-59
d1nffa_244 c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycob 5e-41
d1nffa_244 c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycob 1e-06
d1q7ba_243 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 7e-59
d1q7ba_243 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 1e-39
d1q7ba_243 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 1e-06
d1q7ba_243 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 5e-05
d1ja9a_259 c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reduc 1e-58
d1ja9a_259 c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reduc 2e-40
d1ja9a_259 c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reduc 2e-06
d1ja9a_ 259 c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reduc 7e-04
d1g0oa_272 c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase 4e-58
d1g0oa_272 c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase 3e-39
d1g0oa_272 c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase 4e-07
d1ulua_256 c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermoph 1e-57
d1ulua_256 c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermoph 2e-37
d1ulua_ 256 c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermoph 1e-06
d1x1ta1260 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydroge 2e-57
d1x1ta1260 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydroge 1e-37
d1x1ta1260 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydroge 3e-07
d1sbya1254 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase 8e-57
d1sbya1254 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase 2e-46
d1sbya1254 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase 1e-09
d1sbya1 254 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase 6e-06
d1geea_261 c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megat 1e-56
d1geea_261 c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megat 3e-34
d1geea_261 c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megat 7e-05
d1yb1a_244 c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase 3e-56
d1yb1a_244 c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase 3e-54
d1yb1a_244 c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase 6e-13
d1yb1a_244 c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase 7e-08
d2a4ka1241 c.2.1.2 (A:2-242) beta-keto acyl carrier protein r 3e-56
d2a4ka1241 c.2.1.2 (A:2-242) beta-keto acyl carrier protein r 2e-36
d2a4ka1241 c.2.1.2 (A:2-242) beta-keto acyl carrier protein r 2e-07
d1edoa_244 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 1e-54
d1edoa_244 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 1e-36
d1edoa_244 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 5e-06
d1edoa_244 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 5e-04
d1uzma1237 c.2.1.2 (A:9-245) beta-keto acyl carrier protein r 2e-54
d1uzma1237 c.2.1.2 (A:9-245) beta-keto acyl carrier protein r 1e-34
d1uzma1237 c.2.1.2 (A:9-245) beta-keto acyl carrier protein r 0.001
d1o5ia_234 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 2e-53
d1o5ia_234 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 7e-34
d1o5ia_234 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 3e-06
d1k2wa_256 c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter s 2e-53
d1k2wa_256 c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter s 8e-34
d1k2wa_256 c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter s 3e-04
d1gega_255 c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Kl 3e-51
d1gega_255 c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Kl 3e-32
d1gega_255 c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Kl 9e-05
d2bd0a1240 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase 4e-51
d2bd0a1240 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase 1e-40
d2bd0a1240 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase 3e-07
d2bd0a1240 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase 1e-06
d1qsga_258 c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli 3e-50
d1qsga_258 c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli 2e-30
d1qsga_258 c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli 3e-04
d1oaaa_259 c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus mus 6e-49
d1oaaa_259 c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus mus 2e-35
d1oaaa_259 c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus mus 1e-05
d1xu9a_269 c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1e-48
d1xu9a_269 c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 2e-45
d1xu9a_269 c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 3e-09
d1xu9a_ 269 c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1e-05
d1uaya_241 c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogena 3e-48
d1uaya_241 c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogena 2e-33
d1uaya_241 c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogena 3e-06
d1uaya_241 c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogena 3e-06
d1mxha_266 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 1e-46
d1mxha_266 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 3e-29
d1mxha_266 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 1e-05
d2o23a1248 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydr 4e-44
d2o23a1248 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydr 3e-31
d2o23a1248 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydr 9e-05
d2o23a1248 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydr 0.003
d1dhra_236 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 3e-42
d1dhra_236 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 7e-31
d1dhra_236 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 2e-06
d1dhra_236 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 3e-04
d1fjha_257 c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase 8e-41
d1fjha_257 c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase 2e-20
d1fjha_ 257 c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase 0.002
d1wmaa1275 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydrox 4e-39
d1wmaa1275 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydrox 5e-37
d1wmaa1 275 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydrox 1e-11
d1wmaa1275 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydrox 3e-06
d1ivsa4425 c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase 8e-39
d2pd4a1274 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacte 4e-38
d2pd4a1274 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacte 4e-20
d1yo6a1250 c.2.1.2 (A:1-250) Putative carbonyl reductase snif 5e-38
d1yo6a1250 c.2.1.2 (A:1-250) Putative carbonyl reductase snif 3e-37
d1yo6a1250 c.2.1.2 (A:1-250) Putative carbonyl reductase snif 1e-08
d1yo6a1 250 c.2.1.2 (A:1-250) Putative carbonyl reductase snif 5e-08
d1jtva_285 c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroi 6e-38
d1jtva_285 c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroi 2e-33
d1jtva_285 c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroi 6e-12
d1jtva_ 285 c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroi 3e-05
d1ooea_235 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 8e-37
d1ooea_235 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 2e-27
d1ooea_235 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 1e-04
d1ooea_235 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 6e-04
d1e7wa_284 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 3e-35
d1e7wa_284 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 2e-18
d1h3na3494 c.26.1.1 (A:1-225,A:418-686) Leucyl-tRNA synthetas 2e-33
d1ilea3452 c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthe 1e-32
d2h7ma1268 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacteri 4e-32
d2h7ma1268 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacteri 2e-14
d1d7oa_297 c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (B 7e-32
d1d7oa_297 c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (B 2e-11
d1snya_248 c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly 1e-29
d1snya_248 c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly 1e-27
d1snya_248 c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly 1e-06
d1snya_248 c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly 4e-04
d1uh5a_329 c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite 3e-28
d1uh5a_329 c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite 2e-14
d1ffya3450 c.26.1.1 (A:1-200,A:395-644) Isoleucyl-tRNA synthe 6e-28
d2d5ba2348 c.26.1.1 (A:1-348) Methionyl-tRNA synthetase (MetR 2e-18
d1jaya_212 c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase 3e-18
d1jaya_212 c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase 8e-18
d1rqga2361 c.26.1.1 (A:1-138,A:174-396) Methionyl-tRNA synthe 9e-16
d1luaa1191 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopter 3e-15
d1luaa1191 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopter 5e-15
d2fr1a1259 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI 4e-14
d2fr1a1259 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI 1e-13
d1pfva2350 c.26.1.1 (A:4-140,A:176-388) Methionyl-tRNA synthe 7e-14
d1irxa2317 c.26.1.1 (A:3-319) Class I lysyl-tRNA synthetase { 3e-08
d1db3a_357 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escheric 4e-04
d1db3a_357 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escheric 0.001
d1li5a2315 c.26.1.1 (A:1-315) Cysteinyl-tRNA synthetase (CysR 8e-04
d1t2aa_347 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (H 0.002
d1t2aa_347 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (H 0.003
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Length = 247 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: (s)-1-phenylethanol dehydrogenase
species: Azoarcus sp. ebn1 [TaxId: 76114]
 Score =  242 bits (619), Expect = 2e-75
 Identities = 81/247 (32%), Positives = 127/247 (51%), Gaps = 4/247 (1%)

Query: 378 RLAGKVAVVTASSDGIGFAIAKRLSTEGASVVISSRKESNVNKAVETLQKEGHQKISGVV 437
           RL  K+AV+T  ++GIG AIA+R + EGA + I+    +      E   +   +++  V 
Sbjct: 2   RLKDKLAVITGGANGIGRAIAERFAVEGADIAIADLVPA---PEAEAAIRNLGRRVLTVK 58

Query: 438 CHVAKKEDRQKLFEHAEKKFGGIDILVSNAAVNPATGPVVECPENVWDKIFEVNVKSTFL 497
           C V++  D +   +     FG  DILV+NA + P   P  E     W K FE+NV S FL
Sbjct: 59  CDVSQPGDVEAFGKQVISTFGRCDILVNNAGIYP-LIPFDELTFEQWKKTFEINVDSGFL 117

Query: 498 LTQEVLPYIRKRNGGSIVYVSSIGGLAPFKLLGAYSVSKTALLGLTKAVAQDLASENIRV 557
           + +  +P +++   G I+ ++S       +    Y  +K A +G T+A+A DL  + I V
Sbjct: 118 MAKAFVPGMKRNGWGRIINLTSTTYWLKIEAYTHYISTKAANIGFTRALASDLGKDGITV 177

Query: 558 NCLAPGITKTKFAAALYETEEAHEIAVSNVPMGRLAVPDEMGGIVAFLCSDDASYITGEV 617
           N +AP + +T    A   +     +      + RL VP ++ G  AFL SDDAS+ITG+ 
Sbjct: 178 NAIAPSLVRTATTEASALSAMFDVLPNMLQAIPRLQVPLDLTGAAAFLASDDASFITGQT 237

Query: 618 IVAAGGM 624
           +   GGM
Sbjct: 238 LAVDGGM 244


>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Length = 247 Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Length = 247 Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Length = 247 Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Length = 248 Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Length = 248 Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Length = 248 Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Length = 248 Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 264 Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 264 Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 264 Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 264 Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 250 Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 250 Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 250 Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 250 Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Length = 257 Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Length = 257 Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Length = 257 Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Length = 257 Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Length = 272 Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Length = 272 Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Length = 272 Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Length = 272 Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 259 Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 259 Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 259 Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 259 Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Length = 251 Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Length = 251 Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Length = 251 Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Length = 251 Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Length = 259 Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Length = 259 Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Length = 259 Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Length = 259 Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 253 Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 253 Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 253 Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 253 Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Length = 274 Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Length = 274 Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Length = 274 Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Length = 274 Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Length = 254 Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Length = 254 Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Length = 254 Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Length = 254 Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Length = 268 Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Length = 268 Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Length = 268 Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Length = 268 Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 302 Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 302 Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 302 Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 302 Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 251 Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 251 Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 251 Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Length = 260 Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Length = 260 Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Length = 260 Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Length = 260 Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Length = 242 Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Length = 242 Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Length = 242 Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Length = 242 Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 251 Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 251 Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 251 Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Length = 258 Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Length = 258 Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Length = 258 Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Length = 258 Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Length = 276 Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Length = 276 Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Length = 276 Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Length = 276 Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Length = 258 Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Length = 258 Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Length = 258 Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Length = 258 Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Length = 255 Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Length = 255 Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Length = 255 Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Length = 260 Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Length = 260 Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Length = 260 Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Length = 252 Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Length = 252 Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Length = 252 Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Length = 252 Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Length = 257 Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Length = 257 Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Length = 257 Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 244 Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 244 Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 244 Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Length = 243 Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Length = 243 Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Length = 243 Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Length = 243 Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 259 Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 259 Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 259 Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 259 Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 272 Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 272 Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 272 Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Length = 256 Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Length = 256 Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Length = 256 Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Length = 260 Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Length = 260 Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Length = 260 Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Length = 254 Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Length = 254 Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Length = 254 Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Length = 254 Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Length = 261 Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Length = 261 Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Length = 261 Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Length = 244 Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Length = 244 Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Length = 244 Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Length = 244 Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 237 Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 237 Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 237 Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Length = 234 Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Length = 234 Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Length = 234 Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 256 Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 256 Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 256 Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Length = 255 Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Length = 255 Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Length = 255 Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Length = 240 Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Length = 240 Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Length = 240 Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Length = 240 Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Length = 258 Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Length = 258 Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Length = 258 Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 259 Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 259 Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 259 Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Length = 266 Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Length = 266 Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Length = 266 Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 236 Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 236 Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 236 Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 236 Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 257 Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 257 Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 257 Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure
>d1ivsa4 c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]} Length = 425 Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Length = 274 Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Length = 274 Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Length = 250 Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Length = 250 Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Length = 250 Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Length = 250 Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 235 Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 235 Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 235 Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 235 Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Length = 284 Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Length = 284 Back     information, alignment and structure
>d1h3na3 c.26.1.1 (A:1-225,A:418-686) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]} Length = 494 Back     information, alignment and structure
>d1ilea3 c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]} Length = 452 Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Length = 268 Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Length = 268 Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Length = 297 Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Length = 297 Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 248 Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 248 Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 248 Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 248 Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 329 Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 329 Back     information, alignment and structure
>d1ffya3 c.26.1.1 (A:1-200,A:395-644) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]} Length = 450 Back     information, alignment and structure
>d2d5ba2 c.26.1.1 (A:1-348) Methionyl-tRNA synthetase (MetRS) {Thermus thermophilus [TaxId: 274]} Length = 348 Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 212 Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 212 Back     information, alignment and structure
>d1rqga2 c.26.1.1 (A:1-138,A:174-396) Methionyl-tRNA synthetase (MetRS) {Pyrococcus abyssi [TaxId: 29292]} Length = 361 Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Length = 191 Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Length = 191 Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Length = 259 Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Length = 259 Back     information, alignment and structure
>d1pfva2 c.26.1.1 (A:4-140,A:176-388) Methionyl-tRNA synthetase (MetRS) {Escherichia coli [TaxId: 562]} Length = 350 Back     information, alignment and structure
>d1irxa2 c.26.1.1 (A:3-319) Class I lysyl-tRNA synthetase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 317 Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Length = 357 Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Length = 357 Back     information, alignment and structure
>d1li5a2 c.26.1.1 (A:1-315) Cysteinyl-tRNA synthetase (CysRS) {Escherichia coli [TaxId: 562]} Length = 315 Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Length = 347 Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Length = 347 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query762
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 100.0
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 100.0
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 100.0
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 100.0
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 100.0
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 100.0
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 100.0
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 100.0
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 100.0
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 100.0
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 100.0
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 100.0
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 100.0
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 100.0
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 100.0
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 100.0
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 100.0
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 100.0
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 100.0
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 100.0
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 100.0
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 100.0
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 100.0
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 100.0
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 100.0
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 100.0
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 100.0
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 100.0
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 100.0
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 100.0
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 100.0
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 100.0
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 100.0
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 100.0
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 100.0
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 100.0
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 100.0
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 100.0
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 100.0
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 100.0
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 100.0
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 100.0
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 100.0
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 100.0
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 100.0
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 100.0
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 100.0
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 100.0
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 100.0
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 100.0
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 100.0
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 100.0
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 100.0
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 100.0
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 100.0
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 100.0
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 100.0
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 100.0
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 100.0
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 100.0
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 100.0
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 100.0
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 100.0
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 100.0
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 100.0
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 100.0
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 100.0
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 100.0
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 100.0
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 100.0
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 100.0
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 100.0
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 100.0
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 100.0
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 100.0
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 100.0
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 100.0
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 100.0
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 100.0
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 100.0
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 100.0
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 100.0
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 100.0
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 100.0
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 100.0
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 100.0
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 100.0
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 100.0
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 100.0
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 100.0
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 100.0
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 100.0
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 100.0
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 100.0
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 100.0
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 100.0
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 100.0
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 100.0
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 100.0
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 100.0
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 100.0
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 100.0
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 100.0
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 100.0
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 100.0
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 100.0
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 100.0
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 100.0
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 100.0
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 100.0
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 100.0
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 100.0
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 100.0
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 100.0
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 100.0
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 100.0
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 100.0
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 100.0
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 100.0
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 100.0
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 100.0
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 100.0
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 100.0
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 100.0
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 100.0
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 100.0
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 100.0
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 100.0
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 100.0
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 99.98
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 99.97
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 99.96
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 99.79
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 99.78
d1h3na3494 Leucyl-tRNA synthetase (LeuRS) {Thermus thermophil 99.6
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 99.47
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 99.42
d1ffya3450 Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus 99.4
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 99.38
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 99.31
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 99.3
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.28
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.26
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 99.25
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.25
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.24
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 99.24
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 99.24
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 99.23
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.22
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 99.22
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 99.21
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 99.19
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 99.16
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 99.15
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.15
d1ivsa4425 Valyl-tRNA synthetase (ValRS) {Thermus thermophilu 99.14
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 99.14
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 99.12
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 99.11
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 99.11
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 99.09
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 99.08
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 99.06
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.05
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.05
d1ilea3452 Isoleucyl-tRNA synthetase (IleRS) {Thermus thermop 99.05
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 99.03
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 99.01
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 98.99
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 98.99
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 98.99
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 98.99
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 98.98
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 98.97
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 98.95
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 98.94
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 98.93
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 98.93
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 98.93
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 98.91
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.85
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 98.84
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 98.81
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.8
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 98.75
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 98.44
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 98.41
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 98.4
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 98.35
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 98.34
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 98.28
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 98.27
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 98.25
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 98.2
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 98.19
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 98.17
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 98.15
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 97.6
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 97.56
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 97.47
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 97.46
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 97.36
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 97.29
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 97.23
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 97.22
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 97.2
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 97.2
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 97.19
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 97.16
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 97.12
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 97.1
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 97.08
d1rqga2361 Methionyl-tRNA synthetase (MetRS) {Pyrococcus abys 97.05
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 97.05
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.04
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 96.97
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 96.93
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 96.91
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.83
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 96.79
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.79
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.78
d1pfva2350 Methionyl-tRNA synthetase (MetRS) {Escherichia col 96.71
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 96.7
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 96.66
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 96.63
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 96.62
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.48
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 96.41
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 96.36
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.35
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.31
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.23
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 96.12
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 96.11
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 96.07
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 96.07
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 96.03
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.0
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 95.92
d2d5ba2348 Methionyl-tRNA synthetase (MetRS) {Thermus thermop 95.92
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 95.88
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 95.83
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.77
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 95.73
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 95.71
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 95.7
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 95.51
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 95.42
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 95.42
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.39
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 95.37
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 95.34
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 95.32
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 95.32
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 95.31
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 95.3
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 95.25
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 95.2
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 95.2
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 95.13
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 95.08
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 95.06
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 94.99
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 94.91
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 94.83
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 94.75
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 94.73
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 94.71
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 94.68
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 94.67
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 94.67
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 94.65
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 94.64
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 94.61
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 94.61
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 94.57
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 94.56
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 94.48
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 94.4
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 94.36
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 94.32
d1id1a_153 Rck domain from putative potassium channel Kch {Es 94.32
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 94.32
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 94.27
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 94.25
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 94.22
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 94.17
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 94.12
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 94.04
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 94.04
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 94.02
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 93.99
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 93.9
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 93.88
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 93.85
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 93.83
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 93.71
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 93.63
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 93.6
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 93.55
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 93.53
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 93.52
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 93.49
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 93.41
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 93.36
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 93.33
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 93.29
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 93.28
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 93.26
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 93.23
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 93.2
d1p9oa_290 Phosphopantothenoylcysteine synthetase {Human (Hom 93.14
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 93.06
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 93.04
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 93.0
d1p9oa_290 Phosphopantothenoylcysteine synthetase {Human (Hom 92.97
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 92.97
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 92.93
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 92.87
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 92.85
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 92.75
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 92.73
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 92.57
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 92.56
d1id1a_153 Rck domain from putative potassium channel Kch {Es 92.54
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 92.4
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 92.32
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 92.11
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 92.04
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 91.84
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 91.8
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 91.73
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 91.63
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 91.55
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 91.49
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 91.25
d1irxa2317 Class I lysyl-tRNA synthetase {Archaeon Pyrococcus 91.16
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 91.06
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 90.84
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 90.64
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 90.62
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 90.6
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 90.59
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 90.43
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 90.34
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 89.81
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 89.8
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 89.54
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 89.07
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 89.04
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 88.94
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 88.87
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 88.58
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 88.12
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 87.94
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 87.94
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 87.91
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 87.7
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 87.62
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 87.59
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 87.37
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 87.22
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 87.18
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 87.17
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 87.15
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 87.08
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 86.63
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 86.5
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 86.48
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 85.35
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 85.09
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 84.87
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 83.89
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 83.73
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 83.7
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 83.45
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 83.42
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 83.25
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 82.98
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 82.95
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 82.88
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 82.8
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 82.22
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 82.17
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 82.16
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 81.72
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 81.64
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 81.47
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 81.26
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 81.16
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 80.91
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 80.85
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 80.61
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 80.47
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 80.4
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 80.28
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 80.19
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 80.04
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Gluconate 5-dehydrogenase
species: Thermotoga maritima [TaxId: 2336]
Probab=100.00  E-value=9.6e-62  Score=505.87  Aligned_cols=249  Identities=33%  Similarity=0.587  Sum_probs=234.2

Q ss_pred             ccCCCCEEEEeCCCChHHHHHHHHHHHCCCEEEEEcCCcccHHHHHHHHHHcCCCeEEEEEecCCCHHHHHHHHHHHHHH
Q psy942          377 SRLAGKVAVVTASSDGIGFAIAKRLSTEGASVVISSRKESNVNKAVETLQKEGHQKISGVVCHVAKKEDRQKLFEHAEKK  456 (762)
Q Consensus       377 ~~l~gkvalVTGas~GIG~aiA~~la~~Ga~Vvl~~r~~~~l~~~~~~l~~~g~~~~~~~~~Dv~~~~~~~~~v~~~~~~  456 (762)
                      ++|+||+||||||++|||+++|+.|+++|++|++++|+.++++++++++.+..+.++..+++|++|+++++++++++.++
T Consensus         1 f~l~gK~~lITGas~GIG~aia~~la~~Ga~V~i~~r~~~~~~~~~~~l~~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~   80 (251)
T d1vl8a_           1 FDLRGRVALVTGGSRGLGFGIAQGLAEAGCSVVVASRNLEEASEAAQKLTEKYGVETMAFRCDVSNYEEVKKLLEAVKEK   80 (251)
T ss_dssp             CCCTTCEEEEETTTSHHHHHHHHHHHHTTCEEEEEESCHHHHHHHHHHHHHHHCCCEEEEECCTTCHHHHHHHHHHHHHH
T ss_pred             CCCCCCEEEEeCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHhCCcEEEEEccCCCHHHHHHHHHHHHHH
Confidence            46899999999999999999999999999999999999999999998886654447888999999999999999999999


Q ss_pred             cCCccEEEEcCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCcEEEEecCccc-ccCCCCChHHHHH
Q psy942          457 FGGIDILVSNAAVNPATGPVVECPENVWDKIFEVNVKSTFLLTQEVLPYIRKRNGGSIVYVSSIGG-LAPFKLLGAYSVS  535 (762)
Q Consensus       457 fG~iDiLVNNAG~~~~~~~~~~~~~~~~~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IVnisS~ag-~~~~~~~~~Y~as  535 (762)
                      ||+||+||||||+. ..+++.++++++|+++|++|+.|+|+++|+++|+|+++++|+|||++|..+ ..+.++..+|++|
T Consensus        81 ~g~iDiLVnnAG~~-~~~~~~~~~~e~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~Ii~i~S~~~~~~~~~~~~~Y~as  159 (251)
T d1vl8a_          81 FGKLDTVVNAAGIN-RRHPAEEFPLDEFRQVIEVNLFGTYYVCREAFSLLRESDNPSIINIGSLTVEEVTMPNISAYAAS  159 (251)
T ss_dssp             HSCCCEEEECCCCC-CCCCGGGCCHHHHHHHHHHHTHHHHHHHHHHHHHHTTCSSCEEEEECCGGGTCCCSSSCHHHHHH
T ss_pred             cCCCCEEEECCCCC-CCCChhhCCHHHHHHHHHhhhhhhhhhhhhhhhcccccccccccccccchhccccCccccchHHH
Confidence            99999999999985 578999999999999999999999999999999999999999999999876 5578889999999


Q ss_pred             HHHHHHHHHHHHHHhCCCCeEEEEEeCCCcCChhhhhhcCCHHHHHHHhhCCCCCCCCCHHHHHHHHHHHcCCCCCCccc
Q psy942          536 KTALLGLTKAVAQDLASENIRVNCLAPGITKTKFAAALYETEEAHEIAVSNVPMGRLAVPDEMGGIVAFLCSDDASYITG  615 (762)
Q Consensus       536 Kaal~~ltrslA~Ela~~gIrVN~V~PG~v~T~~~~~~~~~~~~~~~~~~~~pl~r~~~pedvA~~v~fL~S~~a~~itG  615 (762)
                      |+||.+|||+||.||+++|||||+|+||+|+|+|......+++..+.+.+.+|++|+++|||||++++|||||+++||||
T Consensus       160 Kaal~~lt~~lA~e~~~~gIrVN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~pl~R~~~pedvA~~v~fL~S~~a~~itG  239 (251)
T d1vl8a_         160 KGGVASLTKALAKEWGRYGIRVNVIAPGWYRTKMTEAVFSDPEKLDYMLKRIPLGRTGVPEDLKGVAVFLASEEAKYVTG  239 (251)
T ss_dssp             HHHHHHHHHHHHHHHGGGTCEEEEEEECCBCSTTTHHHHTCHHHHHHHHHTCTTSSCBCGGGGHHHHHHHHSGGGTTCCS
T ss_pred             HHhHHHHHHHHHHHhcccCeEEEEEeeCcccCHHHHhccCCHHHHHHHHhcCCCCCCCCHHHHHHHHHHHhCchhCCCcC
Confidence            99999999999999999999999999999999998877667777788889999999999999999999999999999999


Q ss_pred             cEEEeCCCccc
Q psy942          616 EVIVAAGGMQS  626 (762)
Q Consensus       616 ~~i~vdGG~~~  626 (762)
                      |+|.||||+++
T Consensus       240 ~~i~vDGG~ta  250 (251)
T d1vl8a_         240 QIIFVDGGWTA  250 (251)
T ss_dssp             CEEEESTTGGG
T ss_pred             cEEEeCcCeeC
Confidence            99999999874



>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1h3na3 c.26.1.1 (A:1-225,A:418-686) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ffya3 c.26.1.1 (A:1-200,A:395-644) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1ivsa4 c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ilea3 c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rqga2 c.26.1.1 (A:1-138,A:174-396) Methionyl-tRNA synthetase (MetRS) {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1pfva2 c.26.1.1 (A:4-140,A:176-388) Methionyl-tRNA synthetase (MetRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2d5ba2 c.26.1.1 (A:1-348) Methionyl-tRNA synthetase (MetRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1p9oa_ c.72.3.1 (A:) Phosphopantothenoylcysteine synthetase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1p9oa_ c.72.3.1 (A:) Phosphopantothenoylcysteine synthetase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1irxa2 c.26.1.1 (A:3-319) Class I lysyl-tRNA synthetase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure