254780125

254780125

prophage antirepressor

GeneID in NCBI database:8209100Locus tag:CLIBASIA_00020
Protein GI in NCBI database:254780125Protein Accession:YP_003064538.1
Gene range:+(2285, 3073)Protein Length:262aa
Gene description:prophage antirepressor
COG prediction:[K] Prophage antirepressor
KEGG prediction:prophage antirepressor
SEED prediction:Phage antirepressor protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260--
MSTITPFEFESNKIRTIVDKDQNIWFVAKDVATALGYENSNEAINAHCKGVAKRYPLKTEGGIQKVRIISEPDVYRLLVKSTLPSAQKFERWVFEEVLPTLRKTGSYSVEAPKLRATSASTVLRVHKHLEELAKQAGLKDNQLLLKVNRGVTKITGVDQLEAMDIKHLPSSDNDEYLTITQIGERLNPPQRARFLNKLLLKRGLQVSKVSGGYRPTPKGEERGGKMCDVPMQHVEGSTQQLKWNSNLLVSFLQNELINTPRL
ccccEEEEEcccEEEEEEEccccccHHHHHHHHHHccccHHHHHHHHccccccEEEEEcccccEEEEEEcHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccHHHHHHHcccccHHHHHHHHHHHcccEEEcccccEEEcHHHHccccccEEccccccccccHHccccHHHHHHHHHHHHcccccc
cccEEEEEccccEEEEEEEcccccEEEHHHHHHHHccccHHHHHHHHcccccccccccccccccEEEEEccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHccHHHHHHHHcccHHHcHHHHHHHHHHHHHHcccEEEEccccEEEcccccccccEEEEcccccccccccEEEEcHHHHHHHHHHHHHccccc
mstitpfefesnkirtivdkdqnIWFVAKDVATALGYENSNEAINAHCKGVakryplkteggiqkvriisepDVYRLLVKSTLPSAQKFERWVFEEVLptlrktgsysveapklratSASTVLRVHKHLEELAKQaglkdnqlllkvnrgvtkitgvdqleamdikhlpssdndeylTITQigerlnppQRARFLNKLLLKRGlqvskvsggyrptpkgeerggkmcdvpmqhvegstqqlkWNSNLLVSFLQNelintprl
mstitpfefesnkirtivdkdqniWFVAKDVATALGYENSNEAINAHCKGVAKRyplkteggiqkvriisepdvYRLLVKSTlpsaqkferWVFEEVlptlrktgsysveapklratsASTVLRVHKHLEELAkqaglkdnqlllkVNRGVTkitgvdqleamdikhlpssdnDEYLTITqigerlnppQRARFLNKLLLkrglqvskvsggyrptpkgeerggKMCDVPMQHVEGSTQQLKWNSNLLVSFlqnelintprl
MSTITPFEFESNKIRTIVDKDQNIWFVAKDVATALGYENSNEAINAHCKGVAKRYPLKTEGGIQKVRIISEPDVYRLLVKSTLPSAQKFERWVFEEVLPTLRKTGSYSVEAPKLRATSASTVLRVHKHLEELAKQAGLKDNQLLLKVNRGVTKITGVDQLEAMDIKHLPSSDNDEYLTITQIGERLNPPQRARFLNKLLLKRGLQVSKVSGGYRPTPKGEERGGKMCDVPMQHVEGSTQQLKWNSNLLVSFLQNELINTPRL
MSTITPFEFESNKIRTIVDKDQNIWFVAKDVATALGYENSNEAINAHCKGVAKRYPLKTEGGIQKVRIISEPDVYRLLVKSTLPSAQKFERWVFEEVLPTLRKTGS*****PKLRATSASTVLRVHKHLEELAKQAGLKDNQLLLKVNRGVTKITGVDQLEAMDIKHLPSSDNDEYLTITQIGERLNPPQRARFLNKLLLKRGLQVSKVSGGYRPTPKGEERGGKMCDVPMQHVEGSTQQLKWNSNLLVSFLQNELINTPR*
MSTITPFEFESNKIRTIVDKDQNIWFVAKDVATALGYENSNEAINAHCKGVAKRYPLKTEGGIQKVRIISEPDVYRLLVKSTLPSAQKFERWVFEEVLPTLRKTGSYSVEAPKLRATSASTVLRVHKHLEELAKQAGLKDNQLLLKVNRGVTKITGVDQLEAMDIKHLPSSDNDEYLTITQIGERLNPPQRARFLNKLLLKRGLQVSKVSGGYRPTPKGEERGGKMCDVPMQHVEGSTQQLKWNSNLLVSFLQNELINTPRL
*STITPFEFESNKIRTIVDKDQNIWFVAKDVATALGYENSNEAINAHCKGVAKRYPLKTEGGIQKVRIISEPDVYRLLVKSTLPSAQKFERWVFEEVLPTLRKTGSYSVEAPKLRATSASTVLRVHKHLEELAKQAGLKDNQLLLKVNRGVTKITGVDQLEAMDIKHLPSSDNDEYLTITQIGERLNPPQRARFLNKLLLKRGLQVSKVSGGYRPTPKGEERGGKMCDVPMQHVEGSTQQLKWNSNLLVSFLQNELINTPRL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTITPFEFESNKIRTIVDKDQNIWFVAKDVATALGYENSNEAINAHCKGVAKRYPLKTEGGIQKVRIISEPDVYRLLVKSTLPSAQKFERWVFEEVLPTLRKTGSYSVEAPKLRATSASTVLRVHKHLEELAKQAGLKDNQLLLKVNRGVTKITGVDQLEAMDIKHLPSSDNDEYLTITQIGERLNPPQRARFLNKLLLKRGLQVSKVSGGYRPTPKGEERGGKMCDVPMQHVEGSTQQLKWNSNLLVSFLQNELINTPRL
MSTITPFEFESNKIRTIVDKDQNIWFVAKDVATALGYENSNEAINAHCKGVAKRYPLKTEGGIQKVRIISEPDVYRLLVKSTLPSAQKFERWVFEEVLPTLRKTGSYSVEAPKLRATSASTVLRVHKHLEELAKQAGLKDNQLLLKVNRGVTKITGVDQLEAMDIKHLPSSDNDEYLTITQIGERLNPPQRARFLNKLLLKRGLQVSKVSGGYRPTPKGEERGGKMCDVPMQHVEGSTQQLKWNSNLLVSFLQNELINTPRL
MSTITPFEFESNKIRTIVDKDQNIWFVAKDVATALGYENSNEAINAHCKGVAKRYPLKTEGGIQKVRIISEPDVYRLLVKSTLPSAQKFERWVFEEVLPTLRKTGSYSVEAPKLRATSASTVLRVHKHLEELAKQAGLKDNQLLLKVNRGVTKITGVDQLEAMDIKHLPSSDNDEYLTITQIGERLNPPQRARFLNKLLLKRGLQVSKVSGGYRPTPKGEERGGKMCDVPMQHVEGSTQQLKWNSNLLVSFLQNELINTPRL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target262 prophage antirepressor [Candidatus Liberibacter asiatic
25478055541 hypothetical protein CLIBASIA_02210 [Candidatus Li 4e-07
254780987110 hypothetical protein CLIBASIA_04440 [Candidatus Li 7e-06
>gi|254780555|ref|YP_003064968.1| hypothetical protein CLIBASIA_02210 [Candidatus Liberibacter asiaticus str. psy62] Length = 41 Back     alignment
 Score = 46.6 bits (109), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 24/37 (64%)

Query: 1  MSTITPFEFESNKIRTIVDKDQNIWFVAKDVATALGY 37
          MS + PF  E N IR +VD+D N WF+ KDVA  L +
Sbjct: 1  MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37

>gi|254780987|ref|YP_003065400.1| hypothetical protein CLIBASIA_04440 [Candidatus Liberibacter asiaticus str. psy62] Length = 110 Back     alignment
 Score = 42.7 bits (99), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 55/102 (53%), Gaps = 7/102 (6%)

Query: 154 ITGVDQLEAMDIKHLPSSDNDEYLTITQIGERLNPPQRARFLNKLLLKRGLQVSKVSGGY 213
           + GV+ L+ ++   LP+ +N  Y T TQ+G++L     A  +NK L + G  + +   G 
Sbjct: 4   VLGVNVLQDIN---LPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGR 60

Query: 214 RP---TPKGEERGGKMCDVPMQHVEGS-TQQLKWNSNLLVSF 251
           +    TPKG + GG+  D   +  +G+  QQ+KW+  ++ S 
Sbjct: 61  KRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVESL 102

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target262 prophage antirepressor [Candidatus Liberibacter asiatic
315121965263 prophage antirepressor [Candidatus Liberibacter solanac 1 1e-100
315122933264 prophage antirepressor [Candidatus Liberibacter solanac 1 3e-99
315122913261 prophage antirepressor [Candidatus Liberibacter solanac 1 2e-65
315121946262 prophage antirepressor [Candidatus Liberibacter solanac 1 9e-57
255957589100 hypothetical protein [Candidatus Liberibacter asiaticus 1 5e-51
255957559100 hypothetical protein [Candidatus Liberibacter asiaticus 1 2e-45
255957554100 hypothetical protein [Candidatus Liberibacter asiaticus 1 1e-44
71899745251 BRO, N-terminal [Xylella fastidiosa Ann-1] Length = 251 1 2e-43
28198899262 hypothetical protein PD1001 [Xylella fastidiosa Temecul 1 4e-43
71898928387 BRO, N-terminal [Xylella fastidiosa Ann-1] Length = 387 1 2e-41
>gi|315121965|ref|YP_004062454.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 263 Back     alignment and organism information
 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 182/251 (72%), Positives = 207/251 (82%), Gaps = 3/251 (1%)

Query: 4   ITPFEFESNKIRTIVDKDQNIWFVAKDVATALGYENSNEAINAHCKGVAKRYPLKTEGGI 63
           I PFEFESN+IRT+VD+D  I FVAKD+A ALGY+NSNEA+N HCKGV KRYPLKT+GGI
Sbjct: 6   IIPFEFESNRIRTVVDEDNTILFVAKDIAEALGYKNSNEAVNEHCKGVVKRYPLKTDGGI 65

Query: 64  QKVRIISEPDVYRLLVKSTLPSAQKFERWVFEEVLPTLRKTGSYSVEAPKLRATSASTVL 123
           QKVR+I E DVYRL+VKS LPSA+KFERWVFEEVLPTLRKTGSYS++  KL   SA+T++
Sbjct: 66  QKVRVILESDVYRLIVKSKLPSAEKFERWVFEEVLPTLRKTGSYSIKPQKL--PSATTIM 123

Query: 124 RVHKHLEELAKQAGLKDNQLLLKVNRGVTKITGVDQLEAMDIKHLPSSDNDEYLTITQIG 183
           R HKHLE LAKQAGLKDNQLLLKVNRGVTKITGVDQLE MDIKHL S DNDEYL  T+IG
Sbjct: 124 RFHKHLEVLAKQAGLKDNQLLLKVNRGVTKITGVDQLEVMDIKHLLSPDNDEYLAPTEIG 183

Query: 184 ERLNPPQRARFLNKLLLKRGLQVSK-VSGGYRPTPKGEERGGKMCDVPMQHVEGSTQQLK 242
           + LNP  +A+ LN  L   GLQ+ K    G+ PTPKGEE GGKMCDV +QHVEGST  LK
Sbjct: 184 KSLNPVIKAKALNSWLTYLGLQIPKHTKKGFLPTPKGEELGGKMCDVALQHVEGSTPYLK 243

Query: 243 WNSNLLVSFLQ 253
           WN  ++V +LQ
Sbjct: 244 WNPKVIVPYLQ 254


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315122933|ref|YP_004063422.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 264 Back     alignment and organism information
>gi|315122913|ref|YP_004063402.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 261 Back     alignment and organism information
>gi|315121946|ref|YP_004062435.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 262 Back     alignment and organism information
>gi|255957589|dbj|BAH96644.1| hypothetical protein [Candidatus Liberibacter asiaticus] Length = 100 Back     alignment and organism information
>gi|255957559|dbj|BAH96620.1| hypothetical protein [Candidatus Liberibacter asiaticus] Length = 100 Back     alignment and organism information
>gi|255957554|dbj|BAH96616.1| hypothetical protein [Candidatus Liberibacter asiaticus] Length = 100 Back     alignment and organism information
>gi|71899745|ref|ZP_00681896.1| BRO, N-terminal [Xylella fastidiosa Ann-1] Length = 251 Back     alignment and organism information
>gi|28198899|ref|NP_779213.1| hypothetical protein PD1001 [Xylella fastidiosa Temecula1] Length = 262 Back     alignment and organism information
>gi|71898928|ref|ZP_00681095.1| BRO, N-terminal [Xylella fastidiosa Ann-1] Length = 387 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target262 prophage antirepressor [Candidatus Liberibacter asiatic
pfam0249891 pfam02498, Bro-N, BRO family, N-terminal domain 7e-24
COG3617176 COG3617, COG3617, Prophage antirepressor [Transcription 1e-32
>gnl|CDD|145567 pfam02498, Bro-N, BRO family, N-terminal domain Back     alignment and domain information
>gnl|CDD|33416 COG3617, COG3617, Prophage antirepressor [Transcription] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 262 prophage antirepressor [Candidatus Liberibacter asiatic
COG3617176 Prophage antirepressor [Transcription] 100.0
pfam0249891 Bro-N BRO family, N-terminal domain. This family includ 99.8
pfam10547120 P22_AR_N P22_AR N-terminal domain. This domain was iden 97.58
pfam03374112 ANT Phage antirepressor protein KilAC domain. This doma 99.41
COG3645135 Uncharacterized phage-encoded protein [Function unknown 98.92
PRK11050155 manganese transport regulator MntR; Provisional 93.41
PRK03902142 manganese transport transcriptional regulator; Provisio 92.87
smart0052996 HTH_DTXR Helix-turn-helix diphteria tox regulatory elem 92.1
>COG3617 Prophage antirepressor [Transcription] Back     alignment and domain information
>pfam02498 Bro-N BRO family, N-terminal domain Back     alignment and domain information
>pfam10547 P22_AR_N P22_AR N-terminal domain Back     alignment and domain information
>pfam03374 ANT Phage antirepressor protein KilAC domain Back     alignment and domain information
>COG3645 Uncharacterized phage-encoded protein [Function unknown] Back     alignment and domain information
>PRK11050 manganese transport regulator MntR; Provisional Back     alignment and domain information
>PRK03902 manganese transport transcriptional regulator; Provisional Back     alignment and domain information
>smart00529 HTH_DTXR Helix-turn-helix diphteria tox regulatory element Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target262 prophage antirepressor [Candidatus Liberibacter asiatic
3b73_A111 PHIH1 repressor-like protein; winged-helix-turn-helix, 93.66
2h09_A155 Transcriptional regulator MNTR; transcription regulator 93.14
1on2_A142 Transcriptional regulator MNTR; helix-turn-helix, DNA-b 93.0
2x4h_A139 Hypothetical protein SSO2273; transcription; 2.30A {Sul 91.83
1fx7_A230 Iron-dependent repressor IDER; DTXR, iron-dependent reg 92.37
3hrs_A214 Metalloregulator SCAR; DTXR/MNTR family member, transcr 92.21
2qq9_A226 Diphtheria toxin repressor; regulator, DTXR, helix-turn 91.12
>3b73_A PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049} Back     alignment and structure
Probab=93.66  E-value=0.13  Score=29.30  Aligned_cols=54  Identities=15%  Similarity=0.083  Sum_probs=42.6

Q ss_pred             HHCCCCCCCHHHHHHHHCCCCCHHHHHH---HHHHCCCEEECCCCCEEECHHHHHHH
Q ss_conf             4155873239999997389988899999---99978976853799443657897543
Q gi|254780125|r  170 SSDNDEYLTITQIGERLNPPQRARFLNK---LLLKRGLQVSKVSGGYRPTPKGEERG  223 (262)
Q Consensus       170 ~~~~~~~l~~t~iak~l~~~~sa~~~N~---lL~~~g~q~Rk~~~~W~lt~kg~~~g  223 (262)
                      ++...+..+...||+.+++..|...+..   -|.+.|+..+..++.+.+|.+|+.|-
T Consensus        21 ~L~e~g~~t~~eIA~~lgi~~S~~~Vs~rl~~L~~~GLve~~g~G~Y~iT~~G~~yL   77 (111)
T 3b73_A           21 IIHEEGNGSPKELEDRDEIRISKSSVSRRLKKLADHDLLQPLANGVYVITEEGEAYL   77 (111)
T ss_dssp             HHHHHSCBCHHHHHTSTTCCSCHHHHHHHHHHHHHTTSEEECSTTCEEECHHHHHHH
T ss_pred             HHHHCCCCCHHHHHHHHCCCCCHHHHHHHHHHHHHCCCEEECCCCCEEECHHHHHHH
T ss_conf             999849999999999868884799999999999878795666870079896689999



>2h09_A Transcriptional regulator MNTR; transcription regulator, diphtheria toxin, manganese transport, structural genomics, NPPSFA; 2.10A {Escherichia coli} Back     alignment and structure
>1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D Back     alignment and structure
>2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>1fx7_A Iron-dependent repressor IDER; DTXR, iron-dependent regulator, signaling protein; 2.00A {Mycobacterium tuberculosis} SCOP: a.4.5.24 a.76.1.1 b.34.1.2 PDB: 1u8r_A Back     alignment and structure
>3hrs_A Metalloregulator SCAR; DTXR/MNTR family member, transcription; 2.70A {Streptococcus gordonii} PDB: 3hrt_A 3hru_A Back     alignment and structure
>2qq9_A Diphtheria toxin repressor; regulator, DTXR, helix-turn-helix, metal ION, activation, DNA-binding, ferrous iron, cytoplasm; 1.71A {Corynebacterium diphtheriae} PDB: 2tdx_A 1ddn_A 1g3t_A 1g3s_A 1g3w_A 2qqa_A 2qqb_A 2dtr_A 1bi0_A 1bi2_A 1bi3_A 1dpr_A 1bi1_A 1fwz_A 1g3y_A 1c0w_A* 3glx_A 1p92_A 1xcv_A 1f5t_A ... Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target262 prophage antirepressor [Candidatus Liberibacter asiatic
d1mkma175 Transcriptional regulator IclR, N-terminal domain {Ther 93.41
>d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: Transcriptional regulator IclR, N-terminal domain
domain: Transcriptional regulator IclR, N-terminal domain
species: Thermotoga maritima [TaxId: 2336]
Probab=93.41  E-value=0.12  Score=27.73  Aligned_cols=59  Identities=22%  Similarity=0.192  Sum_probs=46.5

Q ss_pred             HHHHCCCCCCCHHHHHHHHCCCC-CHHHHHHHHHHCCCEEECCCCCEEECHHHHHHHHHH
Q ss_conf             65415587323999999738998-889999999978976853799443657897543553
Q gi|254780125|r  168 LPSSDNDEYLTITQIGERLNPPQ-RARFLNKLLLKRGLQVSKVSGGYRPTPKGEERGGKM  226 (262)
Q Consensus       168 d~~~~~~~~l~~t~iak~l~~~~-sa~~~N~lL~~~g~q~Rk~~~~W~lt~kg~~~g~~~  226 (262)
                      +.+.++...+++++||+.+|++. +..++=.-|.+.|+..+...+.|.|..+...+|...
T Consensus        12 ~~~a~~~~~~s~~eia~~~~~~~st~~rll~tL~~~g~l~~~~~g~y~lG~~l~~lg~~~   71 (75)
T d1mkma1          12 DFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRKKDKRYVPGYKLIEYGSFV   71 (75)
T ss_dssp             HHHHHCSSCBCHHHHHHHTTCCHHHHHHHHHHHHHTTSEEECTTSCEEECTHHHHHHHHH
T ss_pred             HHHHHCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEECCCCCEEECHHHHHHHHHH
T ss_conf             999857999899999999791999999999999988998889999786329999999999



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target262 prophage antirepressor [Candidatus Liberibacter asiatic
3hrs_A_1-138138 Metalloregulator SCAR; DTXR/MNTR family member, tr 94.46
2h09_A_155 Transcriptional regulator MNTR; transcription regu 94.42
2qq9_A_1-146146 Diphtheria toxin repressor; regulator, DTXR, helix 94.29
3b73_A_111 PHIH1 repressor-like protein; winged-helix-turn-he 94.18
1on2_A_142 Transcriptional regulator MNTR; helix-turn-helix, 93.35
1fx7_A_1-141141 Iron-dependent repressor IDER; DTXR, iron-dependen 92.39
2o0y_A_1-9595 Transcriptional regulator; ICLR-family, structural 91.91
>3hrs_A (A:1-138) Metalloregulator SCAR; DTXR/MNTR family member, transcription; 2.70A {Streptococcus gordonii} PDB: 3hrt_A 3hru_A Back     alignment and structure
Probab=94.46  E-value=0.13  Score=30.34  Aligned_cols=57  Identities=18%  Similarity=0.176  Sum_probs=46.4

Q ss_pred             HHCCCCCCCHHHHHHHHCCCCC-HHHHHHHHHHCCCEEECCCCCEEECHHHHHHHHHH
Q ss_conf             4155873239999997389988-89999999978976853799443657897543553
Q gi|254780125|r  170 SSDNDEYLTITQIGERLNPPQR-ARFLNKLLLKRGLQVSKVSGGYRPTPKGEERGGKM  226 (262)
Q Consensus       170 ~~~~~~~l~~t~iak~l~~~~s-a~~~N~lL~~~g~q~Rk~~~~W~lt~kg~~~g~~~  226 (262)
                      ++...+.+++++||+.+|+..+ ...+-+.|.+.|+..+...+.+.+|++|.......
T Consensus        14 ~~~~~~~~t~~~lA~~lgis~~tvt~~l~~Le~~GlV~~~r~~~v~lT~~G~~~~~~~   71 (138)
T 3hrs_A           14 LGTRHNKITNKEIAQLMQVSPPAVTEMMKKLLAEELLIKDKKAGYLLTDLGLKLVSDL   71 (138)
T ss_dssp             TTSSCSCCCHHHHHHHHTCCHHHHHHHHHHHHHTTSEEEETTTEEEECHHHHHHHHHH
T ss_pred             HHHCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEECCCCCEEECHHHHHHHHHH
T ss_conf             9834998759999999789928999999999988997863895189878799999999



>2h09_A (A:) Transcriptional regulator MNTR; transcription regulator, diphtheria toxin, manganese transport, structural genomics, NPPSFA; 2.10A {Escherichia coli} Back     alignment and structure
>2qq9_A (A:1-146) Diphtheria toxin repressor; regulator, DTXR, helix-turn-helix, metal ION, activation, DNA-binding, ferrous iron, cytoplasm; 1.71A {Corynebacterium diphtheriae} PDB: 2tdx_A 1ddn_A 1g3t_A 1g3s_A 1g3w_A 2qqa_A 2qqb_A 2dtr_A 1bi0_A 1bi2_A 1bi3_A 1dpr_A 1bi1_A 1fwz_A 1g3y_A 1c0w_A* 3glx_A 1p92_A 1xcv_A 1f5t_A ... Back     alignment and structure
>3b73_A (A:) PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>1on2_A (A:) Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} Back     alignment and structure
>1fx7_A (A:1-141) Iron-dependent repressor IDER; DTXR, iron-dependent regulator, signaling protein; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2o0y_A (A:1-95) Transcriptional regulator; ICLR-family, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.00A {Rhodococcus SP} Back     alignment and structure