254780126

254780126

hypothetical protein CLIBASIA_00025

GeneID in NCBI database:8209101Locus tag:CLIBASIA_00025
Protein GI in NCBI database:254780126Protein Accession:YP_003064539.1
Gene range:+(3091, 3741)Protein Length:216aa
Gene description:hypothetical protein
COG prediction:[E] ABC-type dipeptide transport system, periplasmic component
KEGG prediction:hypothetical protein
SEED prediction:unknown
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210------
MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPWN
cEEEEEEcEEEccHHccccccccccccccccEEEEEEEccccHHHHHHHHHHHHHHHHHccccccHHHHHHHcccccccccccccccccccccccccccccccccEEEEEcccccccccEEcccccccccccccEEcccEEEEEEEEEEEEEccccccEEEEEEccEEEEcccccccccccccHHHHHHcccccHHHHHHHHHHHHHccccccccc
ccEEEEEEEEEHHHHccccHcEcccccccccEEEEEEEccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHccccccccccccccccccccccccccccccccccEEEEEcccccccEEEEccccccEcccccEEcEEEEEEEEEEEEEcccccccccEEEccccEEEEEccccccccccccHHHHHHccHHHHHHHHHHHHHcccccccccccc
mqkltvkgrlsypaldtkvrmklpdgssvehygcdivfpkadtKQINAVEACLKTAVteifpnvspdaFLSAVRSKsesrgvlrdgdakiasshkpenytqtytdSVYISAknkyvqpllvdrqaqpvsdprevfypgCWVIAKLnigayeldpyktkgfsctltgvqffkhderwgaspksdtsefkdygeeqdsdtsvsnfasaevdsdalpwn
mqkltvkgrlsypaldtkvrmklpdgssveHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAFLSAVrsksesrgvlrdgdakiasshkpenytqtyTDSVYISAKNKYVQPLLVdrqaqpvsdprevFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFfkhderwgaspksDTSEFKDYGeeqdsdtsvsnfasaevdsdalpwn
MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPWN
***LTVKGRLSYPALDT**************YGCDIVFPKADTKQINAVEACLKTAVTEIF**************KSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGAS*KSDTSEFKDYGEEQDSDTSVSNFASAEVD***LPW*
MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAFLS************RDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERW*************************NFASAEVDSDALPWN
*QKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGA****DTSEFKDYGEEQDSDTSVSNFASAEVDSDA****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPWN
MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPWN
MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPWN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target216 hypothetical protein CLIBASIA_00025 [Candidatus Liberib
254781192198 hypothetical protein CLIBASIA_05495 [Candidatus Li 1e-33
>gi|254781192|ref|YP_003065605.1| hypothetical protein CLIBASIA_05495 [Candidatus Liberibacter asiaticus str. psy62] Length = 198 Back     alignment
 Score =  134 bits (337), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 84/197 (42%), Positives = 113/197 (57%), Gaps = 9/197 (4%)

Query: 1   MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEI 60
           M K+ +KGRLSYP L  + R     G  V  Y  DI+F K D +Q + +E  ++ A  E 
Sbjct: 1   MAKVLIKGRLSYPQLH-EPRAYGDKGDEV--YSADILFSKTDNEQCDKLEQAIREAGEEK 57

Query: 61  FPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLL 120
           F   +  A +   R K   R  L+DGD KI++S KPE Y + Y    YI+ KNK V+P L
Sbjct: 58  FGGSNMSALIE--RMKRTGRYPLKDGDQKISTSLKPEAY-EVYAGQYYITPKNKKVRPRL 114

Query: 121 VDRQAQPVSDP-REVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGAS 179
           VDR  Q V++  +EVFY GC V A +++ AY      TKG + TLTGVQF K D RWG  
Sbjct: 115 VDRHVQEVTENIQEVFYSGCHVNAIISVYAYTFQG--TKGVTFTLTGVQFVKDDTRWGGQ 172

Query: 180 PKSDTSEFKDYGEEQDS 196
            ++ +S+F+ Y EE  S
Sbjct: 173 LRASSSDFESYEEETAS 189

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target216 hypothetical protein CLIBASIA_00025 [Candidatus Liberib
255957640216 hypothetical protein [Candidatus Liberibacter asiaticus 1 1e-124
255957610216 hypothetical protein [Candidatus Liberibacter asiaticus 1 1e-123
255957555216 hypothetical protein [Candidatus Liberibacter asiaticus 1 1e-123
255957560216 hypothetical protein [Candidatus Liberibacter asiaticus 1 1e-122
315121966214 hypothetical protein CKC_01080 [Candidatus Liberibacter 1 4e-67
315122934183 hypothetical protein CKC_05950 [Candidatus Liberibacter 1 8e-61
144452121 unknown [Citrus greening disease-associated bacterium] 1 4e-59
254781192198 hypothetical protein CLIBASIA_05495 [Candidatus Liberib 1 9e-30
212712319183 hypothetical protein PROVALCAL_03407 [Providencia alcal 1 2e-12
212499744184 hypothetical protein APSE240 [Bacteriophage APSE-2] Len 1 3e-10
>gi|255957640|dbj|BAH96685.1| hypothetical protein [Candidatus Liberibacter asiaticus] Length = 216 Back     alignment and organism information
 Score =  446 bits (1147), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 214/216 (99%), Positives = 215/216 (99%)

Query: 1   MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEI 60
           MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPK DTKQINAVEACLKTAVTEI
Sbjct: 1   MQKLTVKGRLSYPALDTKVRMKLPDGSSVEHYGCDIVFPKTDTKQINAVEACLKTAVTEI 60

Query: 61  FPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLL 120
           FPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLL
Sbjct: 61  FPNVSPDAFLSAVRSKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNKYVQPLL 120

Query: 121 VDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASP 180
           VDRQAQPVS+PREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASP
Sbjct: 121 VDRQAQPVSNPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASP 180

Query: 181 KSDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPWN 216
           KSDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPWN
Sbjct: 181 KSDTSEFKDYGEEQDSDTSVSNFASAEVDSDALPWN 216


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|255957610|dbj|BAH96661.1| hypothetical protein [Candidatus Liberibacter asiaticus] Length = 216 Back     alignment and organism information
>gi|255957555|dbj|BAH96617.1| hypothetical protein [Candidatus Liberibacter asiaticus] Length = 216 Back     alignment and organism information
>gi|255957560|dbj|BAH96621.1| hypothetical protein [Candidatus Liberibacter asiaticus] Length = 216 Back     alignment and organism information
>gi|315121966|ref|YP_004062455.1| hypothetical protein CKC_01080 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 214 Back     alignment and organism information
>gi|315122934|ref|YP_004063423.1| hypothetical protein CKC_05950 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 183 Back     alignment and organism information
>gi|144452|gb|AAA23102.1| unknown [Citrus greening disease-associated bacterium] Length = 121 Back     alignment and organism information
>gi|254781192|ref|YP_003065605.1| hypothetical protein CLIBASIA_05495 [Candidatus Liberibacter asiaticus str. psy62] Length = 198 Back     alignment and organism information
>gi|212712319|ref|ZP_03320447.1| hypothetical protein PROVALCAL_03407 [Providencia alcalifaciens DSM 30120] Length = 183 Back     alignment and organism information
>gi|212499744|ref|YP_002308552.1| hypothetical protein APSE240 [Bacteriophage APSE-2] Length = 184 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target216 hypothetical protein CLIBASIA_00025 [Candidatus Liberib
pfam10991181 pfam10991, DUF2815, Protein of unknown function (DUF281 1e-20
>gnl|CDD|151438 pfam10991, DUF2815, Protein of unknown function (DUF2815) Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 216 hypothetical protein CLIBASIA_00025 [Candidatus Liberib
pfam10991181 DUF2815 Protein of unknown function (DUF2815). This is 100.0
PHA00458230 single-stranded DNA-binding protein 99.98
>pfam10991 DUF2815 Protein of unknown function (DUF2815) Back     alignment and domain information
>PHA00458 single-stranded DNA-binding protein Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target216 hypothetical protein CLIBASIA_00025 [Candidatus Liberib
1je5_A206 Crystal Structure Of Gp2.5, A Single-Stranded Dna B 1e-16
>gi|15826753|pdb|1JE5|A Chain A, Crystal Structure Of Gp2.5, A Single-Stranded Dna Binding Protein Encoded By Bacteriophage T7 Length = 206 Back     alignment and structure
 Score = 90.7 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 28/198 (14%), Positives = 61/198 (30%), Gaps = 15/198 (7%)

Query: 12  YPALDTKVRMKLPDGSSVEH--YGCDIVFPKADTKQINAVEACLKTAVTEIFPNVSPDAF 69
           Y  +          G       Y  D+  P  D +    V+  +K    E     + + +
Sbjct: 16  YAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVK--CHEEAYAAAVEEY 73

Query: 70  LSAVRSKSESRGVLR--DGDAKIASSHKPENYTQTYTDSVYISAKNKYVQ---PLLVDRQ 124
            +   + +  +  L+  +GD     +       +    + +   K K  +    ++VD +
Sbjct: 74  EANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSK 133

Query: 125 AQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKSDT 184
            + + D   +   G  +  K ++  Y+ +          L  V   +     G       
Sbjct: 134 GKKMED-VPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGG-----E 187

Query: 185 SEFKDYGEEQDSDTSVSN 202
            ++ D  EE     S S 
Sbjct: 188 DDWADEVEENGYVASGSA 205


Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target216 hypothetical protein CLIBASIA_00025 [Candidatus Liberib
1je5_A206 Helix-destabilizing protein; OB-fold, beta barrel, DNA 1e-11
>1je5_A Helix-destabilizing protein; OB-fold, beta barrel, DNA binding protein; 1.90A {Enterobacteria phage T7} SCOP: b.40.4.7 Length = 206 Back     alignment and structure
 Score = 65.0 bits (158), Expect = 1e-11
 Identities = 23/198 (11%), Positives = 52/198 (26%), Gaps = 34/198 (17%)

Query: 11  SYPAL---DTK---VRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNV 64
            Y  +   D          P G     Y  D+  P  D +    V+  +K          
Sbjct: 15  PYAYIAKPDYGNEERGFGNPRG----VYKVDLTIPNKDPRCQRMVDEIVKCH-------- 62

Query: 65  SPDAFLSAVRSKSESRGVLRDGDAKIASSHKPEN-YTQTYTDSVYISAKNKY-------- 115
             +   +A   + E+         K    ++ +  +      +     K           
Sbjct: 63  --EEAYAAAVEEYEANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTK 120

Query: 116 ----VQPLLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFK 171
               +  ++VD + + + D   +   G  +  K ++  Y+ +          L  V   +
Sbjct: 121 ETKHINLVVVDSKGKKMEDVPII-GGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVE 179

Query: 172 HDERWGASPKSDTSEFKD 189
                G          ++
Sbjct: 180 LATFGGGEDDWADEVEEN 197


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target216 hypothetical protein CLIBASIA_00025 [Candidatus Liberib
1je5_A206 Helix-destabilizing protein; OB-fold, beta barrel, DNA 100.0
>1je5_A Helix-destabilizing protein; OB-fold, beta barrel, DNA binding protein; 1.90A {Enterobacteria phage T7} SCOP: b.40.4.7 Back     alignment and structure
Probab=100.00  E-value=8.5e-35  Score=232.81  Aligned_cols=163  Identities=13%  Similarity=0.203  Sum_probs=124.2

Q ss_pred             EEEEEEE-ECCCCCCCCCCCCCCC--CCCCEEEEEEEECCCCHHH---HHHHHHHHHHHHHHH---HHHCCCCCCCCCCC
Q ss_conf             6776899-8331278641123678--8662479999963787899---999999999998754---20002210013444
Q gi|254780126|r    4 LTVKGRL-SYPALDTKVRMKLPDG--SSVEHYGCDIVFPKADTKQ---INAVEACLKTAVTEI---FPNVSPDAFLSAVR   74 (216)
Q Consensus         4 vt~kgr~-sYp~L~~P~~~~~~~g--~~~~kYs~~llipK~d~~~---~~~i~~AI~~a~~~~---~~~k~~~~~~~~~k   74 (216)
                      .|++|++ +||||++||+.|...+  ..+.+|||+|+||++|++.   +.+|+++++++.+..   +.++.+        
T Consensus         7 ttp~G~a~~Y~~L~~PD~~f~~~~~~~~~g~Y~v~L~v~k~d~~a~~~~~~i~~~~~~a~~~~~~~~~~k~~--------   78 (206)
T 1je5_A            7 TSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYEANPP--------   78 (206)
T ss_dssp             ECCSEEECSSCEEEEEECCC---CCSCCSCEEEEEEEEETTSHHHHHHHHHHHHHHHHHHHHHHHHHHTSCC--------
T ss_pred             CCCCCCEEECCCCCCCCCCCCCCCCCCCCCEEEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC--------
T ss_conf             279833340553378874433234678896389999974761789999999999999999999987503654--------


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCC------------CCCCEEECCCCCCCCCCCCCCCCCCEEE
Q ss_conf             4344665210175455555454456542277389930377------------7788368578747347677401540799
Q gi|254780126|r   75 SKSESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNK------------YVQPLLVDRQAQPVSDPREVFYPGCWVI  142 (216)
Q Consensus        75 ~~~~~k~plrDGD~~~~~~~~~~~~~e~~~g~~~i~a~~k------------~~kP~ivD~~~~~i~d~~~~iySGs~~k  142 (216)
                      .....+.++++++...       +++++++|.++|++++|            +++|.|||++++||++. +.|||||++|
T Consensus        79 k~~~~k~~~~~~~~~~-------p~~~e~~G~~~fk~K~Ka~~~~~k~g~~~~~~P~v~D~~~~~l~~~-~~i~~Gs~~~  150 (206)
T 1je5_A           79 AVARGKKPLKPYEGDM-------PFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDV-PIIGGGSKLK  150 (206)
T ss_dssp             -------CCCCCBCCC-------SEEECSSSEEEEEEEEESEEECTTTCCEEECCCCEECTTSCBCSSC-CCCCTTCEEE
T ss_pred             CCCCCCCCCCCCCCCC-------CCCCCCCCCEEEEEEEEEEEECCCCCCCCCCCCEEECCCCCCCCCC-CCCCCCCEEE
T ss_conf             4442335777765668-------8653658748999998667411556775555870796989898886-6035786899


Q ss_pred             EEEEEEEEECCCCCCEEEEEEECEEEEEECCCCCCCCCCC
Q ss_conf             9999998640788531169997407997248755566665
Q gi|254780126|r  143 AKLNIGAYELDPYKTKGFSCTLTGVQFFKHDERWGASPKS  182 (216)
Q Consensus       143 v~~~~~pY~~~~~~gkGVs~~L~~VQ~i~dgE~~GG~~~~  182 (216)
                      |+++++||.++++.|+||+|+|++||+|+++|+.||+..+
T Consensus       151 v~~~~~py~~~~~~g~Gvsl~L~~VQv~~~~e~~~g~~~~  190 (206)
T 1je5_A          151 VKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGEDDW  190 (206)
T ss_dssp             EEEEEEEECCCSSCCBEEEEEEEEEEEEECCC------CC
T ss_pred             EEEEEEEEEECCCCCEEEEEEECEEEEEECCCCCCCCCCC
T ss_conf             9999987886598863899883669998712567877666




Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 216 hypothetical protein CLIBASIA_00025 [Candidatus Liberib
d1je5a_197 b.40.4.7 (A:) gp2.5 {Bacteriophage T7 [TaxId: 10760]} L 2e-07
>d1je5a_ b.40.4.7 (A:) gp2.5 {Bacteriophage T7 [TaxId: 10760]} Length = 197 Back     information, alignment and structure

class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: Phage ssDNA-binding proteins
domain: gp2.5
species: Bacteriophage T7 [TaxId: 10760]
 Score = 49.3 bits (117), Expect = 2e-07
 Identities = 23/198 (11%), Positives = 50/198 (25%), Gaps = 34/198 (17%)

Query: 11  SYPAL---DTK---VRMKLPDGSSVEHYGCDIVFPKADTKQINAVEACLKTAVTEIFPNV 64
            Y  +   D          P G     Y  D+  P  D +    V+  +K          
Sbjct: 15  PYAYIAKPDYGNEERGFGNPRG----VYKVDLTIPNKDPRCQRMVDEIVKCH-------- 62

Query: 65  SPDAFLSAVRSKSESRGVLR-DGDAKIASSHKPENYTQTYTDSVYISAKNKY-------- 115
             +   +A   + E+       G   +        +      +     K           
Sbjct: 63  --EEAYAAAVEEYEANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTK 120

Query: 116 ----VQPLLVDRQAQPVSDPREVFYPGCWVIAKLNIGAYELDPYKTKGFSCTLTGVQFFK 171
               +  ++VD + + + D   +   G  +  K ++  Y+ +          L  V   +
Sbjct: 121 ETKHINLVVVDSKGKKMEDVPII-GGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVE 179

Query: 172 HDERWGASPKSDTSEFKD 189
                G          ++
Sbjct: 180 LATFGGGEDDWADEVEEN 197


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target216 hypothetical protein CLIBASIA_00025 [Candidatus Liberib
d1je5a_197 gp2.5 {Bacteriophage T7 [TaxId: 10760]} 100.0
>d1je5a_ b.40.4.7 (A:) gp2.5 {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: Phage ssDNA-binding proteins
domain: gp2.5
species: Bacteriophage T7 [TaxId: 10760]
Probab=100.00  E-value=1.7e-36  Score=241.78  Aligned_cols=163  Identities=12%  Similarity=0.188  Sum_probs=125.8

Q ss_pred             EEEEEEE-ECCCCCCCCCCCCCCC--CCCCEEEEEEEECCCCHHH---HHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             6776899-8331278641123678--8662479999963787899---99999999999875420002210013444434
Q gi|254780126|r    4 LTVKGRL-SYPALDTKVRMKLPDG--SSVEHYGCDIVFPKADTKQ---INAVEACLKTAVTEIFPNVSPDAFLSAVRSKS   77 (216)
Q Consensus         4 vt~kgr~-sYp~L~~P~~~~~~~g--~~~~kYs~~llipK~d~~~---~~~i~~AI~~a~~~~~~~k~~~~~~~~~k~~~   77 (216)
                      .|+.|++ +||||++||+.|...+  .++.+|||+|+||++|+++   +.+|+++++++.+.......     .......
T Consensus         7 ttp~G~a~~Y~~L~kPDt~f~~~~~~~~~g~Ykv~L~v~k~d~~a~~~i~~i~~~~e~a~~~~~~~~~-----~~~~k~~   81 (197)
T d1je5a_           7 TSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYE-----ANPPAVA   81 (197)
T ss_dssp             ECCSEEECSSCEEEEEECCC---CCSCCSCEEEEEEEEETTSHHHHHHHHHHHHHHHHHHHHHHHHHH-----TSCC---
T ss_pred             CCCCCCEECCCCCCCCCCCCCCCCCCCCCCEEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHC-----CCCCCCC
T ss_conf             27983234154337898554333467889618999997264177999999999999999999998753-----4565443


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCC------------CCCCEEECCCCCCCCCCCCCCCCCCEEEEEE
Q ss_conf             4665210175455555454456542277389930377------------7788368578747347677401540799999
Q gi|254780126|r   78 ESRGVLRDGDAKIASSHKPENYTQTYTDSVYISAKNK------------YVQPLLVDRQAQPVSDPREVFYPGCWVIAKL  145 (216)
Q Consensus        78 ~~k~plrDGD~~~~~~~~~~~~~e~~~g~~~i~a~~k------------~~kP~ivD~~~~~i~d~~~~iySGs~~kv~~  145 (216)
                      ..+.|+++++.+.+       +.+++.|.|++++++|            .++|.|||++++||++. ..|||||++||++
T Consensus        82 ~~K~~~~p~~~~~~-------~~~~~~G~~~fk~K~Ka~~~~~kt~~~~~~~P~i~Ds~~~~l~~~-~~i~~Gs~~~v~~  153 (197)
T d1je5a_          82 RGKKPLKPYEGDMP-------FFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDV-PIIGGGSKLKVKY  153 (197)
T ss_dssp             ----CCCCCBCCCS-------EEECSSSEEEEEEEEESEEECTTTCCEEECCCCEECTTSCBCSSC-CCCCTTCEEEEEE
T ss_pred             CCCCCCCCCCCCCC-------CCCCCCCCEEEEEEEEEEECCCCCCCCCCCCCEEECCCCCCCCCC-CCCCCCCEEEEEE
T ss_conf             11135687644577-------753668858999998765024567875544873798989998887-6123686899999


Q ss_pred             EEEEEECCCCCCEEEEEEECEEEEEECCCCCCCC
Q ss_conf             9998640788531169997407997248755566
Q gi|254780126|r  146 NIGAYELDPYKTKGFSCTLTGVQFFKHDERWGAS  179 (216)
Q Consensus       146 ~~~pY~~~~~~gkGVs~~L~~VQ~i~dgE~~GG~  179 (216)
                      .++||.++++.|+||+|+|++||+|+++|++||.
T Consensus       154 ~~~py~~~~~~g~Gvsl~L~~VQvi~~~e~~gg~  187 (197)
T d1je5a_         154 SLVPYKWNTAVGASVKLQLESVMLVELATFGGGE  187 (197)
T ss_dssp             EEEEECCCSSCCBEEEEEEEEEEEEECCC-----
T ss_pred             EEEEEEECCCCCEEEEEEEEEEEEEEECCCCCCC
T ss_conf             9855450798863899984469998812677877



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00