254780128

254780128

VRR-NUC domain-containing protein

GeneID in NCBI database:8209103Locus tag:CLIBASIA_00035
Protein GI in NCBI database:254780128Protein Accession:YP_003064541.1
Gene range:+(5769, 6080)Protein Length:103aa
Gene description:VRR-NUC domain-containing protein
COG prediction:none
KEGG prediction:VRR-NUC domain-containing protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100---
MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTLY
ccEEEEEEHHHHHHHHHHHHHHHHcccEEEEEEEccccccccEEEEEEcccEEEEEEccccccccHHHHHHHHHHHHcccEEEEEEcHHHHHHHHHHHHHccc
ccccccccccHHHHHHHHHHHHHHccccEEEEEcccccccccEEEEcccccEEEEEEEcccccccHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHccccc
msfysfhyqtEKDVEKRLVTGAKKLDCWVrkasfvgrrgcpdrliitpngglwwievkkptgrlshQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTLY
msfysfhyqtekdvekrlvtgakkldcwvrkasfvgrrgcpdrliitpngglwWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTLY
MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTLY
***Y***YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGR**HQ*MSEIEELRRRGQRVKVLVSMEEVDNFLEELACTL*
MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTLY
*SFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTLY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTLY
MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTLY
MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTLY

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target103 VRR-NUC domain-containing protein [Candidatus Liberibac
25478119498 hypothetical protein CLIBASIA_05505 [Candidatus Li 2e-25
>gi|254781194|ref|YP_003065607.1| hypothetical protein CLIBASIA_05505 [Candidatus Liberibacter asiaticus str. psy62] Length = 98 Back     alignment
 Score =  105 bits (263), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 52/93 (55%), Positives = 63/93 (67%)

Query: 8   YQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGRLSHQ 67
           Y +E  +EKRLV G+KKLDC V K  F+ +RGCPDRLIITPNG  +W+E+K   GRLS+ 
Sbjct: 5   YLSEAKLEKRLVKGSKKLDCLVFKTQFINQRGCPDRLIITPNGAHFWVEMKTSRGRLSNA 64

Query: 68  QMSEIEELRRRGQRVKVLVSMEEVDNFLEELAC 100
           Q   I  L    Q+V+VL S EEVD FL  L C
Sbjct: 65  QKRVIATLLLYHQKVQVLSSTEEVDGFLRMLEC 97

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target103 VRR-NUC domain-containing protein [Candidatus Liberibac
255957557103 VRR-NUC domain protein [Candidatus Liberibacter asiatic 1 2e-54
255957617103 VRR-NUC domain protein [Candidatus Liberibacter asiatic 1 7e-54
255957612103 VRR-NUC domain protein [Candidatus Liberibacter asiatic 1 9e-54
255957622103 VRR-NUC domain protein [Candidatus Liberibacter asiatic 1 2e-53
255957602103 VRR-NUC domain protein [Candidatus Liberibacter asiatic 1 3e-53
255957592103 VRR-NUC domain protein [Candidatus Liberibacter asiatic 1 6e-53
255957662103 VRR-NUC domain protein [Candidatus Liberibacter asiatic 1 7e-53
255957562103 VRR-NUC domain protein [Candidatus Liberibacter asiatic 1 1e-52
315121968101 VRR-NUC domain-containing protein [Candidatus Liberibac 1 3e-35
25478119498 hypothetical protein CLIBASIA_05505 [Candidatus Liberib 1 2e-21
>gi|255957557|dbj|BAH96619.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus] Length = 103 Back     alignment and organism information
 Score =  215 bits (547), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 102/103 (99%), Positives = 103/103 (100%)

Query: 1   MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP 60
           MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP
Sbjct: 1   MSFYSFHYQTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKP 60

Query: 61  TGRLSHQQMSEIEELRRRGQRVKVLVSMEEVDNFLEELACTLY 103
           TGRLSHQQMSEIEELRRRGQRVKVL+SMEEVDNFLEELACTLY
Sbjct: 61  TGRLSHQQMSEIEELRRRGQRVKVLISMEEVDNFLEELACTLY 103


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|255957617|dbj|BAH96667.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus] Length = 103 Back     alignment and organism information
>gi|255957612|dbj|BAH96663.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus] Length = 103 Back     alignment and organism information
>gi|255957622|dbj|BAH96671.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus] Length = 103 Back     alignment and organism information
>gi|255957602|dbj|BAH96655.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus] Length = 103 Back     alignment and organism information
>gi|255957592|dbj|BAH96647.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus] Length = 103 Back     alignment and organism information
>gi|255957662|dbj|BAH96703.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus] Length = 103 Back     alignment and organism information
>gi|255957562|dbj|BAH96623.1| VRR-NUC domain protein [Candidatus Liberibacter asiaticus] Length = 103 Back     alignment and organism information
>gi|315121968|ref|YP_004062457.1| VRR-NUC domain-containing protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 101 Back     alignment and organism information
>gi|254781194|ref|YP_003065607.1| hypothetical protein CLIBASIA_05505 [Candidatus Liberibacter asiaticus str. psy62] Length = 98 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target103 VRR-NUC domain-containing protein [Candidatus Liberibac
pfam0877496 pfam08774, VRR_NUC, VRR-NUC domain 1e-07
>gnl|CDD|149740 pfam08774, VRR_NUC, VRR-NUC domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 103 VRR-NUC domain-containing protein [Candidatus Liberibac
pfam0877496 VRR_NUC VRR-NUC domain. 99.64
cd00523123 archeal_HJR Holliday junction resolvases (HJRs) are end 97.62
pfam0187093 Hjc Archaeal holliday junction resolvase (hjc). This fa 97.59
COG1591137 Holliday junction resolvase - archaeal type [DNA replic 96.97
pfam0202194 UPF0102 Uncharacterized protein family UPF0102. The fun 94.33
PHA01753121 Holliday junction resolvase 94.14
COG2810 284 Predicted type IV restriction endonuclease [Defense mec 93.48
PRK12497118 hypothetical protein; Reviewed 93.18
cd00221115 Vsr Very Short Patch Repair (Vsr) Endonuclease. Endonuc 92.91
pfam03838167 RecU Recombination protein U. 91.88
KOG2143854 consensus 98.75
pfam10107153 Endonuc_Holl Endonuclease related to archaeal Holliday 91.63
>pfam08774 VRR_NUC VRR-NUC domain Back     alignment and domain information
>cd00523 archeal_HJR Holliday junction resolvases (HJRs) are endonucleases that specifically resolve Holliday junction DNA intermediates during homologous recombination Back     alignment and domain information
>pfam01870 Hjc Archaeal holliday junction resolvase (hjc) Back     alignment and domain information
>COG1591 Holliday junction resolvase - archaeal type [DNA replication, recombination, and repair] Back     alignment and domain information
>pfam02021 UPF0102 Uncharacterized protein family UPF0102 Back     alignment and domain information
>PHA01753 Holliday junction resolvase Back     alignment and domain information
>COG2810 Predicted type IV restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>PRK12497 hypothetical protein; Reviewed Back     alignment and domain information
>cd00221 Vsr Very Short Patch Repair (Vsr) Endonuclease Back     alignment and domain information
>pfam03838 RecU Recombination protein U Back     alignment and domain information
>KOG2143 consensus Back     alignment and domain information
>pfam10107 Endonuc_Holl Endonuclease related to archaeal Holliday junction resolvase Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target103 VRR-NUC domain-containing protein [Candidatus Liberibac
1ob8_A135 Holliday-junction resolvase; hydrolase, enzyme, homolog 97.48
2wcw_A139 HJC; type II restriction endonuclease, hydrolase, DNA b 97.13
1gef_A123 Holliday junction resolvase; HJC, hydrolase; 2.00A {Pyr 97.1
1hh1_A143 Holliday junction resolving enzyme HJC; holliday juncti 96.73
2eo0_A147 Hypothetical protein ST1444; holliday junction resolvas 96.7
3fov_A134 UPF0102 protein RPA0323; structural genomics, APC7380, 94.7
2fco_A200 Recombination protein U (penicillin-binding protein rel 94.36
1zp7_A206 Recombination protein U; recombination,DNA-binding prot 94.07
1cw0_A155 Protein (DNA mismatch endonuclease); protein-DNA comple 92.2
3dnx_A153 Uncharacterized protein SPO1766; structural genomics, A 91.54
2vld_A251 NUCS, UPF0286 protein pyrab01260; endonuclease, hydrola 90.76
>1ob8_A Holliday-junction resolvase; hydrolase, enzyme, homologous recombination, holliday junction resolving enzyme, nuclease, archaea; 1.8A {Sulfolobus solfataricus} SCOP: c.52.1.18 PDB: 1ob9_A Back     alignment and structure
Probab=97.48  E-value=0.00066  Score=44.27  Aligned_cols=68  Identities=16%  Similarity=0.124  Sum_probs=51.0

Q ss_pred             HHHHHHHHHHHHHCCCEEEEEE-CCC-CCCCCEEEEECCCCCEEEEEEECCCCC---CCHHHHHHHHHH-HHCCC
Q ss_conf             9999999999997898999981-188-898743999906982999999768988---688999999999-97898
Q gi|254780128|r   12 KDVEKRLVTGAKKLDCWVRKAS-FVG-RRGCPDRLIITPNGGLWWIEVKKPTGR---LSHQQMSEIEEL-RRRGQ   80 (103)
Q Consensus        12 ~~ie~~l~~~lk~~G~~~~K~~-~~g-~~GvPDli~~~~~g~~~fIEvK~~~gk---ls~~Q~~~~~~l-~~~G~   80 (103)
                      +..|+.++..+...|+.+++.. +.+ ..|.||++.. +++..++||||+-++.   +++.|..-+..+ +..|.
T Consensus         7 ~~~Er~~~~~L~~~G~~v~r~~~s~~~~~g~iDiiA~-~~~~~~~IEvKs~~~~~iy~~~eqv~~l~~f~~~~g~   80 (135)
T 1ob8_A            7 KNAERELVSILRGEGFNAVRIPTSNSSPNPLPDIFAT-KGNTLLSIECKSTWENKVKVKEHQVRKLLDFLSMFTM   80 (135)
T ss_dssp             HHHHHHHHHHHHHTTCEEEECCC-----CCSCSEEEE-ETTEEEEEEEEEESSSEEEECHHHHHHHHHHHHTSSS
T ss_pred             HHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCEEEE-CCCEEEEEEEEECCCCEEECCHHHHHHHHHHHHHCCC
T ss_conf             9999999999996995899946778888899888995-3999999999963498252699999999999996385



>2wcw_A HJC; type II restriction endonuclease, hydrolase, DNA binding protein, holliday junction resolvase; 1.58A {Archaeoglobus fulgidus} PDB: 2wcz_A 2wiw_A 2wiz_A 2wj0_A Back     alignment and structure
>1gef_A Holliday junction resolvase; HJC, hydrolase; 2.00A {Pyrococcus furiosus} SCOP: c.52.1.18 PDB: 1ipi_A Back     alignment and structure
>1hh1_A Holliday junction resolving enzyme HJC; holliday junction resolvase, homologous recombination, nuclease domain, archaea; 2.15A {Sulfolobus solfataricus} SCOP: c.52.1.18 Back     alignment and structure
>2eo0_A Hypothetical protein ST1444; holliday junction resolvase, DNA binding protein, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>3fov_A UPF0102 protein RPA0323; structural genomics, APC7380, PSI-2, protein structure initiative; 1.88A {Rhodopseudomonas palustris CGA009} Back     alignment and structure
>2fco_A Recombination protein U (penicillin-binding protein related factor A); flexibility, hydrolase; 1.40A {Geobacillus kaustophilus HTA426} PDB: 1y1o_A Back     alignment and structure
>1zp7_A Recombination protein U; recombination,DNA-binding protein,resolvase, DNA binding protein; 2.25A {Bacillus subtilis} PDB: 1rzn_A Back     alignment and structure
>1cw0_A Protein (DNA mismatch endonuclease); protein-DNA complex, intercalation, zinc, hydrolase/DNA; HET: DNA; 2.30A {Escherichia coli} SCOP: c.52.1.15 Back     alignment and structure
>3dnx_A Uncharacterized protein SPO1766; structural genomics, APC88088, protein of unknown function, PSI-2, protein structure initiative; HET: MSE; 1.94A {Silicibacter pomeroyi} Back     alignment and structure
>2vld_A NUCS, UPF0286 protein pyrab01260; endonuclease, hydrolase; 2.60A {Pyrococcus abyssi} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target103 VRR-NUC domain-containing protein [Candidatus Liberibac
d1ob8a_124 Holliday-junction resolvase SSO1176 {Sulfolobus solfata 97.49
d1hh1a_132 Archaeal Holliday junction resolvase Hjc {Archaeon Sulf 97.01
d1gefa_120 Archaeal Holliday junction resolvase Hjc {Archaeon Pyro 96.07
d1rzna_165 Recombination protein U (RecU)/PBP related factor A (Pr 94.44
d1y1oa_168 Recombination protein U (RecU)/PBP related factor A (Pr 94.03
>d1ob8a_ c.52.1.18 (A:) Holliday-junction resolvase SSO1176 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Restriction endonuclease-like
superfamily: Restriction endonuclease-like
family: Hjc-like
domain: Holliday-junction resolvase SSO1176
species: Sulfolobus solfataricus [TaxId: 2287]
Probab=97.49  E-value=0.00067  Score=42.77  Aligned_cols=67  Identities=16%  Similarity=0.125  Sum_probs=53.7

Q ss_pred             HHHHHHHHHHHHHCCCEEEEEECCC--CCCCCEEEEECCCCCEEEEEEECCCCC---CCHHHHHHHHHHHHCC
Q ss_conf             9999999999997898999981188--898743999906982999999768988---6889999999999789
Q gi|254780128|r   12 KDVEKRLVTGAKKLDCWVRKASFVG--RRGCPDRLIITPNGGLWWIEVKKPTGR---LSHQQMSEIEELRRRG   79 (103)
Q Consensus        12 ~~ie~~l~~~lk~~G~~~~K~~~~g--~~GvPDli~~~~~g~~~fIEvK~~~gk---ls~~Q~~~~~~l~~~G   79 (103)
                      +..|+.+++.+...|+.+.+..+.|  ..+.||++.. ++++++-||+|+.++.   ++..|...+..+.+..
T Consensus         2 ~~~ERelv~~l~~~gf~vvR~~gSGs~~~~~pDllA~-~~~~~~~IEvKst~~~kiyi~~eqie~L~~f~~~f   73 (124)
T d1ob8a_           2 KNAERELVSILRGEGFNAVRIPTSNSSPNPLPDIFAT-KGNTLLSIECKSTWENKVKVKEHQVRKLLDFLSMF   73 (124)
T ss_dssp             HHHHHHHHHHHHHTTCEEEECCC-----CCSCSEEEE-ETTEEEEEEEEEESSSEEEECHHHHHHHHHHHHTS
T ss_pred             CHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCEEEE-CCCEEEEEEEEECCCCEEEECHHHHHHHHHHHHHC
T ss_conf             5699999999986994399923578988889878985-79869999998535985998799999999999971



>d1hh1a_ c.52.1.18 (A:) Archaeal Holliday junction resolvase Hjc {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gefa_ c.52.1.18 (A:) Archaeal Holliday junction resolvase Hjc {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1rzna_ c.52.1.28 (A:) Recombination protein U (RecU)/PBP related factor A (PrfA) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y1oa_ c.52.1.28 (A:) Recombination protein U (RecU)/PBP related factor A (PrfA) {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target103 VRR-NUC domain-containing protein [Candidatus Liberibac
1gef_A_123 Holliday junction resolvase; HJC, hydrolase; 2.00A 97.57
2wcw_A_139 HJC; type II restriction endonuclease, hydrolase, 97.56
1hh1_A_143 Holliday junction resolving enzyme HJC; holliday j 97.04
2eo0_A_147 Hypothetical protein ST1444; holliday junction res 96.79
3h1t_A_1-169_362-370178 Type I site-specific restriction-modification syst 96.28
2w00_A_1-54_129-248174 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 95.62
2fco_A_200 Recombination protein U (penicillin-binding protei 95.19
3dnx_A_153 Uncharacterized protein SPO1766; structural genomi 94.86
1zp7_A_206 Recombination protein U; recombination,DNA-binding 94.78
3fov_A_134 UPF0102 protein RPA0323; structural genomics, APC7 94.38
2vld_A_122-251130 NUCS, UPF0286 protein pyrab01260; endonuclease, hy 94.15
>1gef_A (A:) Holliday junction resolvase; HJC, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
Probab=97.57  E-value=0.00063  Score=45.32  Aligned_cols=73  Identities=19%  Similarity=0.146  Sum_probs=58.2

Q ss_pred             CCHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCEEEEECCCCCEEEEEEECCCCC---CCHHHHHHHHHH-HHCCCEEEE
Q ss_conf             8999999999999997898999981188898743999906982999999768988---688999999999-978988999
Q gi|254780128|r    9 QTEKDVEKRLVTGAKKLDCWVRKASFVGRRGCPDRLIITPNGGLWWIEVKKPTGR---LSHQQMSEIEEL-RRRGQRVKV   84 (103)
Q Consensus         9 ~~E~~ie~~l~~~lk~~G~~~~K~~~~g~~GvPDli~~~~~g~~~fIEvK~~~gk---ls~~Q~~~~~~l-~~~G~~~~V   84 (103)
                      ++=+..|+.+++.+...|+.+++..+   +|-||++.. +++.++.||||+..+.   ++..|..-+..+ +..|+..++
T Consensus         3 ~kG~~~EReL~~~L~~~Gfav~R~pg---Sg~pDiiA~-~~~~~~~iEvKst~k~~iyi~~eqiekL~~f~~~fg~~p~i   78 (123)
T 1gef_A            3 RKGAQAERELIKLLEKHGFAVVRSAG---SKKVDLVAG-NGKKYLCIEVKVTKKDHLYVGKRDMGRLIEFSRRFGGIPVL   78 (123)
T ss_dssp             HHHHHHHHHHHHHHHHTTCEEEEBGG---GSSCSEEEE-CSSCEEEEEEEEESSSCEEECHHHHHHHHHHHHHHTCEEEE
T ss_pred             CCCCHHHHHHHHHHHHHCEEEEEECC---CCCCCEEEC-CCEEEEEEEEEECCCCCEEECHHHHHHHHHHHHHCCCCEEE
T ss_conf             44106799999999972716999548---999766605-74068999999816875662588889999999861972689


Q ss_pred             E
Q ss_conf             8
Q gi|254780128|r   85 L   85 (103)
Q Consensus        85 v   85 (103)
                      +
T Consensus        79 a   79 (123)
T 1gef_A           79 A   79 (123)
T ss_dssp             E
T ss_pred             E
T ss_conf             9



>2wcw_A (A:) HJC; type II restriction endonuclease, hydrolase, DNA binding protein, holliday junction resolvase; 1.58A {Archaeoglobus fulgidus} PDB: 2wcz_A 2wiw_A 2wiz_A 2wj0_A Back     alignment and structure
>1hh1_A (A:) Holliday junction resolving enzyme HJC; holliday junction resolvase, homologous recombination, nuclease domain, archaea; 2.15A {Sulfolobus solfataricus} Back     alignment and structure
>2eo0_A (A:) Hypothetical protein ST1444; holliday junction resolvase, DNA binding protein, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>3h1t_A (A:1-169,A:362-370) Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2w00_A (A:1-54,A:129-248) HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, plasmid, helicase, hydrolase, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} Back     alignment and structure
>2fco_A (A:) Recombination protein U (penicillin-binding protein related factor A); flexibility, hydrolase; 1.40A {Geobacillus kaustophilus HTA426} PDB: 1y1o_A Back     alignment and structure
>3dnx_A (A:) Uncharacterized protein SPO1766; structural genomics, APC88088, protein of unknown function, PSI-2, protein structure initiative; HET: MSE; 1.94A {Silicibacter pomeroyi} Back     alignment and structure
>1zp7_A (A:) Recombination protein U; recombination,DNA-binding protein,resolvase, DNA binding protein; 2.25A {Bacillus subtilis} PDB: 1rzn_A Back     alignment and structure
>3fov_A (A:) UPF0102 protein RPA0323; structural genomics, APC7380, PSI-2, protein structure initiative; 1.88A {Rhodopseudomonas palustris CGA009} Back     alignment and structure
>2vld_A (A:122-251) NUCS, UPF0286 protein pyrab01260; endonuclease, hydrolase; 2.60A {Pyrococcus abyssi} Back     alignment and structure