254780129

254780129

hypothetical protein CLIBASIA_00040

GeneID in NCBI database:8209104Locus tag:CLIBASIA_00040
Protein GI in NCBI database:254780129Protein Accession:YP_003064542.1
Gene range:+(6065, 6727)Protein Length:220aa
Gene description:hypothetical protein
COG prediction:[K] [L] Superfamily II DNA/RNA helicases, SNF2 family
KEGG prediction:hypothetical protein
SEED prediction:DNA helicase, phage-associated
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220
MHLVLKPHQIVMVNWLLSHDRCALWASMGSGKTVSVLFALSTIKILDPRPVLIIAPLRVAQYVWKDEVERWSAFSDMTVSSLIGSERQRIKALNTPAHLYIINFENIPWLVKMKLDHWDFATIVVDESTKLKSFRTHQGTKQTRALGKVAFSKVKRFIELTGTPSPNGLIDLWGQIWFLDKGKRLGLSFKSFVERWFHTQQVGSSIGAVKHIPKINAQKE
ccccccHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHccccccEEEEEcHHHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHHccccEEEEcHHHHHHHHHHHHHcccccEEEEccHHHcccccccHHHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHcc
cccccHHHHHHHHHHHHHHHHHccHHcccccHHHHHHHHHHHHHHcccccEEEEEcHHHHHccHHHHHHHcccccccEEEEEEccHHHHHHHHHccccEEEEcHHHHHHHHHHHHccccccEEEEEHHHHccccHHHHHHHHHHHHHHHHHHHcccEEEEccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccccHEEEccccccccc
mhlvlkphQIVMVNWLLSHDRcalwasmgsgktVSVLFALStikildprpvliiapLRVAQYVWKDEVERWSAFSDMTVSSLIGSERQRIKALNTPAHLYIINFENIPWLVKMKLDHWDFATIVVdestklksfrthqgtkqtrALGKVAFSKVKRFIEltgtpspnglidlWGQIwfldkgkrlgLSFKSFVERWFHTqqvgssigavkhipkinaqke
MHLVLKPHQIVMVNWLLSHDRCALWASMGSGKTVSVLFALSTikildprpvliiAPLRVAQYVWKDEVERWSAFSDMTVSSLIGSERQRIKALNTPAHLYIINFENIPWLVKMKLDHWDFATIVVdestklksfrthqgtkqtralgkvaFSKVKRFIeltgtpspngliDLWGQIWFLDKGKRLGLSFKSFVERWFHTQqvgssigavkhipkinaqke
MHLVLKPHQIVMVNWLLSHDRCALWASMGSGKTVSVLFALSTIKILDPRPVLIIAPLRVAQYVWKDEVERWSAFSDMTVSSLIGSERQRIKALNTPAHLYIINFENIPWLVKMKLDHWDFATIVVDESTKLKSFRTHQGTKQTRALGKVAFSKVKRFIELTGTPSPNGLIDLWGQIWFLDKGKRLGLSFKSFVERWFHTQQVGSSIGAVKHIPKINAQKE
MHLVLKPHQIVMVNWLLSHDRCALWASMGSGKTVSVLFALSTIKILDPRPVLIIAPLRVAQYVWKDEVERWSAFSDMTVSSLIGSERQR**ALNTPAHLYIINFENIPWLVKMKLDHWDFATIVVDESTKLKSFRTHQGTKQTRALGKVAFSKVKRFIELTGTPSPNGLIDLWGQIWFLDKGKRLGLSFKSFVERWFHTQ*************KI*****
MHLVLKPHQIVMVNWLLSHDRCALWASMGSGKTVSVLFALSTIKILDPRPVLIIAPLRVAQYVWKDEVERWSAFSDMTVSSLIGSERQRIKALNTPAHLYIINFENIPWLVKMKLDHWDFATIVVDESTKLKSFRTHQGTKQTRALGKVAFSKVKRFIELTGTPSPNGLIDLWGQIWFLDKGKRLGLSFKSFVERWFHTQQVGSSIGAVKHIPKINAQKE
*HLVLKPHQIVMVNWLLSHDRCALWASMGSGKTVSVLFALSTIKILDPRPVLIIAPLRVAQYVWKDEVERWSAFSDMTVSSLIGSERQRIKALNTPAHLYIINFENIPWLVKMKLDHWDFATIVVDESTKLKSFRTHQGTKQTRALGKVAFSKVKRFIELTGTPSPNGLIDLWGQIWFLDKGKRLGLSFKSFVERWFHTQQVGSSIGAVKHIPKI*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHLVLKPHQIVMVNWLLSHDRCALWASMGSGKTVSVLFALSTIKILDPRPVLIIAPLRVAQYVWKDEVERWSAFSDMTVSSLIGSERQRIKALNTPAHLYIINFENIPWLVKMKLDHWDFATIVVDESTKLKSFRTHQGTKQTRALGKVAFSKVKRFIELTGTPSPNGLIDLWGQIWFLDKGKRLGLSFKSFVERWFHTQQVGSSIGAVKHIPKINAQKE
MHLVLKPHQIVMVNWLLSHDRCALWASMGSGKTVSVLFALSTIKILDPRPVLIIAPLRVAQYVWKDEVERWSAFSDMTVSSLIGSERQRIKALNTPAHLYIINFENIPWLVKMKLDHWDFATIVVDESTKLKSFRTHQGTKQTRALGKVAFSKVKRFIELTGTPSPNGLIDLWGQIWFLDKGKRLGLSFKSFVERWFHTQQVGSSIGAVKHIPKINAQKE
MHLVLKPHQIVMVNWLLSHDRCALWASMGSGKTVSVLFALSTIKILDPRPVLIIAPLRVAQYVWKDEVERWSAFSDMTVSSLIGSERQRIKALNTPAHLYIINFENIPWLVKMKLDHWDFATIVVDESTKLKSFRTHQGTKQTRALGKVAFSKVKRFIELTGTPSPNGLIDLWGQIWFLDKGKRLGLSFKSFVERWFHTQQVGSSIGAVKHIPKINAQKE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target220 hypothetical protein CLIBASIA_00040 [Candidatus Liberib
255764515 458 SNF2 related [Candidatus Liberibacter asiaticus st 2e-79
254780382 465 ATP dependent RNA helicase protein [Candidatus Lib 2e-04
254780837426 putative restriction endonuclease S subunit [Candi 0.040
>gi|255764515|ref|YP_003065608.2| SNF2 related [Candidatus Liberibacter asiaticus str. psy62] Length = 458 Back     alignment
 Score =  286 bits (733), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 166/216 (76%), Gaps = 1/216 (0%)

Query: 5   LKPHQIVMVNWLLSHDRCALWASMGSGKTVSVLFALSTIKILDPRPVLIIAPLRVAQYVW 64
           L PHQ  +V+W+L H RCA+WASMGSGKTVSVL ALS I +   + VL+IAPLRVAQ VW
Sbjct: 3   LAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVW 62

Query: 65  KDEVERWSAFSDMTVSSLIGSERQRIKALNTPAHLYIINFENIPWLVKMKLDHWDFATIV 124
             EV+RWS FS M +S + G+ +QR K L TPA LY+INFEN+ WLV+     W FATIV
Sbjct: 63  TSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIV 122

Query: 125 VDESTKLKSFRTHQGTKQTRALGKVAFSKVKRFIELTGTPSPNGLIDLWGQIWFLDKGKR 184
           VDESTKLKSFR  QG+K  RAL K A+   +RFIELTGTPSPNGLIDLWGQIWFLDKGKR
Sbjct: 123 VDESTKLKSFRLRQGSKTARALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGKR 181

Query: 185 LGLSFKSFVERWFHTQQVGSSIGAVKHIPKINAQKE 220
           LG  F+SFV RWF+T Q+GS IGAV++  K  AQKE
Sbjct: 182 LGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKE 217

>gi|254780382|ref|YP_003064795.1| ATP dependent RNA helicase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 465 Back     alignment
 Score = 37.7 bits (86), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 42/85 (49%), Gaps = 9/85 (10%)

Query: 7   PHQIVMVNWLLS-HDRCALWASMGSGKTVSVLFALSTI------KILDPRPVLIIAPLRV 59
           P QI  +  +L  HD C + A  G+GKT S +  + TI      ++  PR  LI+ P R 
Sbjct: 26  PIQIKTIPLVLQRHDVCGI-AQTGTGKTASFVLPMLTILEKGRARVRMPR-TLILEPTRE 83

Query: 60  AQYVWKDEVERWSAFSDMTVSSLIG 84
                 D  E++    ++TV+ LIG
Sbjct: 84  LAAQVADNFEKYGKNYNLTVALLIG 108

>gi|254780837|ref|YP_003065250.1| putative restriction endonuclease S subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 426 Back     alignment
 Score = 29.6 bits (65), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 25/40 (62%), Gaps = 3/40 (7%)

Query: 2   HLVLKPHQI--VMVNWLL-SHDRCALWASMGSGKTVSVLF 38
           ++ +KPH I    + WL+ S+D C ++ +MGSG   S+ F
Sbjct: 320 YMAVKPHGIDSTYLAWLMRSYDLCKVFYAMGSGLRQSLKF 359

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target220 hypothetical protein CLIBASIA_00040 [Candidatus Liberib
317120700 461 SNF2 Dead box helicase [Liberibacter phage SC1] Length 1 1e-126
317120844 461 SNF2 Dead box helicase [Candidatus Liberibacter asiatic 1 1e-124
315122937 456 SNF2 related protein [Candidatus Liberibacter solanacea 1 8e-82
315121969 456 SNF2 related protein [Candidatus Liberibacter solanacea 1 1e-81
317120757 460 SNF2 Dead box helicase [Candidatus Liberibacter asiatic 1 4e-76
255764515 458 SNF2 related [Candidatus Liberibacter asiaticus str. ps 1 1e-75
41179407 464 Bbp47 [Bordetella phage BPP-1] Length = 464 1 7e-59
15837282 472 hypothetical protein XF0680 [Xylella fastidiosa 9a5c] L 1 9e-55
71900964 472 SNF2-related [Xylella fastidiosa Ann-1] Length = 472 1 2e-54
71275472 472 SNF2-related [Xylella fastidiosa Dixon] Length = 472 1 2e-54
>gi|317120700|gb|ADV02523.1| SNF2 Dead box helicase [Liberibacter phage SC1] Length = 461 Back     alignment and organism information
 Score =  454 bits (1169), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 220/220 (100%), Positives = 220/220 (100%)

Query: 1   MHLVLKPHQIVMVNWLLSHDRCALWASMGSGKTVSVLFALSTIKILDPRPVLIIAPLRVA 60
           MHLVLKPHQIVMVNWLLSHDRCALWASMGSGKTVSVLFALSTIKILDPRPVLIIAPLRVA
Sbjct: 1   MHLVLKPHQIVMVNWLLSHDRCALWASMGSGKTVSVLFALSTIKILDPRPVLIIAPLRVA 60

Query: 61  QYVWKDEVERWSAFSDMTVSSLIGSERQRIKALNTPAHLYIINFENIPWLVKMKLDHWDF 120
           QYVWKDEVERWSAFSDMTVSSLIGSERQRIKALNTPAHLYIINFENIPWLVKMKLDHWDF
Sbjct: 61  QYVWKDEVERWSAFSDMTVSSLIGSERQRIKALNTPAHLYIINFENIPWLVKMKLDHWDF 120

Query: 121 ATIVVDESTKLKSFRTHQGTKQTRALGKVAFSKVKRFIELTGTPSPNGLIDLWGQIWFLD 180
           ATIVVDESTKLKSFRTHQGTKQTRALGKVAFSKVKRFIELTGTPSPNGLIDLWGQIWFLD
Sbjct: 121 ATIVVDESTKLKSFRTHQGTKQTRALGKVAFSKVKRFIELTGTPSPNGLIDLWGQIWFLD 180

Query: 181 KGKRLGLSFKSFVERWFHTQQVGSSIGAVKHIPKINAQKE 220
           KGKRLGLSFKSFVERWFHTQQVGSSIGAVKHIPKINAQKE
Sbjct: 181 KGKRLGLSFKSFVERWFHTQQVGSSIGAVKHIPKINAQKE 220


Species: Liberibacter phage SC1
Genus: 
Family: Podoviridae
Order: Caudovirales
Class: 
Phylum: 
Superkingdom: Viruses
>gi|317120844|gb|ADV02665.1| SNF2 Dead box helicase [Candidatus Liberibacter asiaticus] Length = 461 Back     alignment and organism information
>gi|315122937|ref|YP_004063426.1| SNF2 related protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 456 Back     alignment and organism information
>gi|315121969|ref|YP_004062458.1| SNF2 related protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 456 Back     alignment and organism information
>gi|317120757|gb|ADV02578.1| SNF2 Dead box helicase [Candidatus Liberibacter asiaticus] Length = 460 Back     alignment and organism information
>gi|255764515|ref|YP_003065608.2| SNF2 related [Candidatus Liberibacter asiaticus str. psy62] Length = 458 Back     alignment and organism information
>gi|41179407|ref|NP_958716.1| Bbp47 [Bordetella phage BPP-1] Length = 464 Back     alignment and organism information
>gi|15837282|ref|NP_297970.1| hypothetical protein XF0680 [Xylella fastidiosa 9a5c] Length = 472 Back     alignment and organism information
>gi|71900964|ref|ZP_00683077.1| SNF2-related [Xylella fastidiosa Ann-1] Length = 472 Back     alignment and organism information
>gi|71275472|ref|ZP_00651758.1| SNF2-related [Xylella fastidiosa Dixon] Length = 472 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target220 hypothetical protein CLIBASIA_00040 [Candidatus Liberib
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 6e-15
KOG0385 971 KOG0385, KOG0385, KOG0385, Chromatin remodeling complex 4e-11
KOG1000 689 KOG1000, KOG1000, KOG1000, Chromatin remodeling protein 6e-11
KOG0387 923 KOG0387, KOG0387, KOG0387, Transcription-coupled repair 4e-10
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 4e-09
KOG0389 941 KOG0389, KOG0389, KOG0389, SNF2 family DNA-dependent AT 1e-08
KOG0384 1373 KOG0384, KOG0384, KOG0384, Chromodomain-helicase DNA-bi 6e-08
KOG1015 1567 KOG1015, KOG1015, KOG1015, Transcription regulator XNP/ 3e-07
KOG0392 1549 KOG0392, KOG0392, KOG0392, SNF2 family DNA-dependent AT 4e-07
KOG4439 901 KOG4439, KOG4439, KOG4439, RNA polymerase II transcript 1e-06
KOG0391 1958 KOG0391, KOG0391, KOG0391, SNF2 family DNA-dependent AT 2e-06
KOG0388 1185 KOG0388, KOG0388, KOG0388, SNF2 family DNA-dependent AT 1e-05
KOG0390 776 KOG0390, KOG0390, KOG0390, DNA repair protein, SNF2 fam 7e-05
KOG1016 1387 KOG1016, KOG1016, KOG1016, Predicted DNA helicase, DEAD 0.004
pfam00176295 pfam00176, SNF2_N, SNF2 family N-terminal domain 1e-14
COG0553 866 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 f 1e-13
KOG0386 1157 KOG0386, KOG0386, KOG0386, Chromatin remodeling complex 3e-06
pfam00270167 pfam00270, DEAD, DEAD/DEAH box helicase 1e-04
COG1061 442 COG1061, SSL2, DNA or RNA helicases of superfamily II [ 2e-04
>gnl|CDD|128763 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|35606 KOG0385, KOG0385, KOG0385, Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>gnl|CDD|36218 KOG1000, KOG1000, KOG1000, Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|35608 KOG0387, KOG0387, KOG0387, Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription, Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|28927 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|35610 KOG0389, KOG0389, KOG0389, SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|35605 KOG0384, KOG0384, KOG0384, Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>gnl|CDD|36233 KOG1015, KOG1015, KOG1015, Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>gnl|CDD|35613 KOG0392, KOG0392, KOG0392, SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>gnl|CDD|39640 KOG4439, KOG4439, KOG4439, RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription, Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|35612 KOG0391, KOG0391, KOG0391, SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|35609 KOG0388, KOG0388, KOG0388, SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|35611 KOG0390, KOG0390, KOG0390, DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|36234 KOG1016, KOG1016, KOG1016, Predicted DNA helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|143942 pfam00176, SNF2_N, SNF2 family N-terminal domain Back     alignment and domain information
>gnl|CDD|30899 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|35607 KOG0386, KOG0386, KOG0386, Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics, Transcription] Back     alignment and domain information
>gnl|CDD|144015 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|31261 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 220 hypothetical protein CLIBASIA_00040 [Candidatus Liberib
KOG0392 1549 consensus 100.0
pfam00176295 SNF2_N SNF2 family N-terminal domain. This domain is fo 100.0
KOG0385 971 consensus 100.0
KOG0384 1373 consensus 100.0
KOG0387 923 consensus 100.0
KOG0391 1958 consensus 100.0
KOG0389 941 consensus 100.0
KOG0390 776 consensus 100.0
KOG0386 1157 consensus 100.0
KOG0388 1185 consensus 100.0
KOG4439 901 consensus 100.0
KOG1000 689 consensus 100.0
KOG1015 1567 consensus 100.0
PRK04914 955 ATP-dependent helicase HepA; Validated 100.0
KOG1002 791 consensus 99.98
COG0553 866 HepA Superfamily II DNA/RNA helicases, SNF2 family [Tra 99.97
KOG1016 1387 consensus 99.95
KOG1001 674 consensus 99.93
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Transcript 99.92
TIGR00603 756 rad25 DNA repair helicase rad25; InterPro: IPR001161 Xe 99.91
TIGR00643 721 recG ATP-dependent DNA helicase RecG; InterPro: IPR0046 99.85
KOG0383 696 consensus 99.85
KOG0298 1394 consensus 99.85
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recombinati 99.84
PRK01172 674 ski2-like helicase; Provisional 99.8
PRK10917 677 ATP-dependent DNA helicase RecG; Provisional 99.79
PRK02362 736 ski2-like helicase; Provisional 99.78
COG1200 677 RecG RecG-like helicase [DNA replication, recombination 99.78
KOG1123 776 consensus 99.76
COG1201 814 Lhr Lhr-like helicases [General function prediction onl 99.7
TIGR00580 997 mfd transcription-repair coupling factor; InterPro: IPR 99.65
KOG0952 1230 consensus 99.49
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.45
TIGR00614 497 recQ_fam ATP-dependent DNA helicase, RecQ family; Inter 99.41
TIGR01389 607 recQ ATP-dependent DNA helicase RecQ; InterPro: IPR0062 99.41
COG1202 830 Superfamily II helicase, archaea-specific [General func 99.4
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.33
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, reco 99.22
KOG0343 758 consensus 98.88
KOG0351 941 consensus 98.71
KOG0950 1008 consensus 98.68
KOG0949 1330 consensus 98.62
KOG0344 593 consensus 98.53
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombinatio 98.53
KOG0922 674 consensus 98.48
KOG0328 400 consensus 98.47
KOG0352 641 consensus 98.37
KOG1513 1300 consensus 98.36
KOG4284 980 consensus 98.3
KOG0920 924 consensus 98.27
TIGR01447 753 recD exodeoxyribonuclease V, alpha subunit; InterPro: I 98.25
pfam02399 829 Herpes_ori_bp Origin of replication binding protein. Th 98.05
TIGR01970 858 DEAH_box_HrpB ATP-dependent helicase HrpB; InterPro: IP 98.02
PRK10536262 hypothetical protein; Provisional 98.01
KOG0923 902 consensus 97.97
KOG0341 610 consensus 97.74
KOG0925 699 consensus 97.53
PRK13889 992 conjugal transfer relaxase TraA; Provisional 97.1
PRK04296197 thymidine kinase; Provisional 96.97
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 96.86
PRK13826 1102 Dtr system oriT relaxase; Provisional 96.59
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.56
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 96.47
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.38
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 96.13
pfam03354 473 Terminase_1 Phage Terminase. The majority of the member 95.44
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 95.4
pfam00265175 TK Thymidine kinase. 95.32
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 94.7
PRK05986190 cob(I)yrinic acid a,c-diamide adenosyltransferase; Vali 94.16
pfam02572172 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/C 94.11
TIGR02928 383 TIGR02928 orc1/cdc6 family replication initiation prote 93.75
TIGR02768 888 TraA_Ti Ti-type conjugative transfer relaxase TraA; Int 93.04
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 90.7
COG0553 866 HepA Superfamily II DNA/RNA helicases, SNF2 family [Tra 90.48
COG2109198 BtuR ATP:corrinoid adenosyltransferase [Coenzyme metabo 90.26
smart00487201 DEXDc DEAD-like helicases superfamily. 99.91
PRK13766 764 Hef nuclease; Provisional 99.9
pfam04851103 ResIII Type III restriction enzyme, res subunit. 99.87
PRK11448 1126 hsdR type I restriction enzyme EcoKI subunit R; Provisi 99.87
KOG0354 746 consensus 99.83
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse family 99.79
PRK00254 717 ski2-like helicase; Provisional 99.79
pfam00270167 DEAD DEAD/DEAH box helicase. Members of this family inc 99.79
COG4096 875 HsdR Type I site-specific restriction-modification syst 99.76
COG1204 766 Superfamily II helicase [General function prediction on 99.75
PRK13767 878 ATP-dependent helicase; Provisional 99.73
COG1205 851 Distinct helicase family with a unique C-terminal domai 99.72
COG4889 1518 Predicted helicase [General function prediction only] 99.66
PRK10689 1148 transcription-repair coupling factor; Provisional 99.65
PRK11192 417 ATP-dependent RNA helicase SrmB; Provisional 99.61
cd00268203 DEADc DEAD-box helicases. A diverse family of proteins 99.6
TIGR00348 813 hsdR type I site-specific deoxyribonuclease, HsdR famil 99.59
COG1197 1139 Mfd Transcription-repair coupling factor (superfamily I 99.59
PRK04537 574 ATP-dependent RNA helicase RhlB; Provisional 99.59
COG0610 962 Type I site-specific restriction-modification system, R 99.57
PRK10590 457 ATP-dependent RNA helicase RhlE; Provisional 99.56
TIGR03158 357 cas3_cyano CRISPR-associated helicase, Cyano-type. subt 99.54
PRK11776 459 ATP-dependent RNA helicase DbpA; Provisional 99.54
PRK01297 472 ATP-dependent RNA helicase RhlB; Provisional 99.53
PTZ00110 602 helicase; Provisional 99.51
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 99.51
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.48
COG4581 1041 Superfamily II RNA helicase [DNA replication, recombina 99.47
KOG0947 1248 consensus 99.29
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA replicat 99.28
KOG0330 476 consensus 99.19
KOG0331 519 consensus 99.13
pfam07652146 Flavi_DEAD Flavivirus DEAD domain. 99.1
KOG0948 1041 consensus 99.03
PRK05580 699 primosome assembly protein PriA; Validated 99.02
KOG0951 1674 consensus 98.97
COG1198 730 PriA Primosomal protein N' (replication factor Y) - sup 98.9
KOG0338 691 consensus 98.89
PRK11131 1295 ATP-dependent RNA helicase HrpA; Provisional 98.89
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanisms] 98.87
KOG0335 482 consensus 98.87
KOG0342 543 consensus 98.86
KOG0348 708 consensus 98.82
COG4098 441 comFA Superfamily II DNA/RNA helicase required for DNA 98.79
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 98.78
KOG0340 442 consensus 98.77
KOG0353 695 consensus 98.62
PRK09694 878 hypothetical protein; Provisional 98.61
TIGR01587 424 cas3_core CRISPR-associated helicase Cas3; InterPro: IP 98.49
KOG0347 731 consensus 98.45
TIGR02621 975 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-sub 98.41
pfam02562205 PhoH PhoH-like protein. PhoH is a cytoplasmic protein a 98.32
COG3587 985 Restriction endonuclease [Defense mechanisms] 98.29
KOG0339 731 consensus 98.28
KOG0336 629 consensus 98.17
TIGR00595 524 priA primosomal protein N'; InterPro: IPR005259 All pro 98.12
KOG0926 1172 consensus 98.05
TIGR01967 1320 DEAH_box_HrpA ATP-dependent helicase HrpA; InterPro: IP 97.99
TIGR02397 363 dnaX_nterm DNA polymerase III, subunits gamma and tau; 97.89
PRK06305 462 DNA polymerase III subunits gamma and tau; Validated 97.89
pfam05876 552 Terminase_GpA Phage terminase large subunit (GpA). This 97.85
PRK05563 541 DNA polymerase III subunits gamma and tau; Validated 97.82
KOG0337 529 consensus 97.78
PRK08769 319 DNA polymerase III subunit delta'; Validated 97.77
PRK06645 507 DNA polymerase III subunits gamma and tau; Validated 97.76
PRK07764 775 DNA polymerase III subunits gamma and tau; Validated 97.75
PRK06674 563 DNA polymerase III subunits gamma and tau; Validated 97.61
PRK06647 560 DNA polymerase III subunits gamma and tau; Validated 97.6
PRK08853 717 DNA polymerase III subunits gamma and tau; Validated 97.59
PRK07003 816 DNA polymerase III subunits gamma and tau; Validated 97.57
PRK08691 704 DNA polymerase III subunits gamma and tau; Validated 97.56
KOG0924 1042 consensus 97.56
PRK05896 613 DNA polymerase III subunits gamma and tau; Validated 97.52
PRK12323 721 DNA polymerase III subunits gamma and tau; Provisional 97.47
COG3421 812 Uncharacterized protein conserved in bacteria [Function 97.46
PRK08770 663 DNA polymerase III subunits gamma and tau; Validated 97.43
PRK07994 643 DNA polymerase III subunits gamma and tau; Validated 97.41
PRK08451 523 DNA polymerase III subunits gamma and tau; Validated 97.39
KOG0329 387 consensus 97.34
PRK06872 696 DNA polymerase III subunits gamma and tau; Provisional 97.3
KOG0327 397 consensus 97.27
PRK05648 705 DNA polymerase III subunits gamma and tau; Reviewed 97.21
PRK09111 600 DNA polymerase III subunits gamma and tau; Validated 97.19
PRK09112 352 DNA polymerase III subunit delta'; Validated 97.09
KOG0326 459 consensus 97.01
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 97.0
pfam04466 387 Terminase_3 Phage terminase large subunit. Initiation o 96.96
KOG0953 700 consensus 96.7
pfam05621302 TniB Bacterial TniB protein. This family consists of se 96.62
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexameric h 96.55
COG1435201 Tdk Thymidine kinase [Nucleotide transport and metaboli 96.44
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 96.35
pfam03237 380 Terminase_6 Terminase-like family. This family represen 96.26
COG4626 546 Phage terminase-like protein, large subunit [General fu 96.23
pfam02702211 KdpD Osmosensitive K+ channel His kinase sensor domain. 95.85
KOG0332 477 consensus 95.82
PRK05595444 replicative DNA helicase; Provisional 95.7
PRK08082453 consensus 95.44
PRK08760476 replicative DNA helicase; Provisional 95.26
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 95.05
PRK06321472 replicative DNA helicase; Provisional 95.02
PRK05636507 replicative DNA helicase; Provisional 94.65
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family, HK0 94.55
cd03115173 SRP The signal recognition particle (SRP) mediates the 94.54
PRK08694468 consensus 94.47
PRK08840464 replicative DNA helicase; Provisional 94.33
PRK07414178 cob(I)yrinic acid a,c-diamide adenosyltransferase; Vali 93.99
PRK05748448 replicative DNA helicase; Provisional 93.39
PRK06904472 replicative DNA helicase; Validated 92.73
TIGR00064284 ftsY signal recognition particle-docking protein FtsY; 92.7
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/C 92.62
PRK08006471 replicative DNA helicase; Provisional 92.56
PRK08506473 replicative DNA helicase; Provisional 92.13
PRK07004460 replicative DNA helicase; Provisional 91.92
COG1618179 Predicted nucleotide kinase [Nucleotide transport and m 91.62
PRK07263453 consensus 90.82
KOG0350 620 consensus 99.0
COG1110 1187 Reverse gyrase [DNA replication, recombination, and rep 98.85
TIGR01054 1843 rgy reverse gyrase; InterPro: IPR005736 DNA topoisomera 98.85
PRK09401 1176 reverse gyrase; Reviewed 98.81
KOG0345 567 consensus 98.63
KOG0333 673 consensus 98.43
KOG0346 569 consensus 98.3
KOG0334 997 consensus 98.18
KOG1805 1100 consensus 97.86
TIGR01448 769 recD_rel helicase, RecD/TraA family; InterPro: IPR00634 97.83
PRK12901 1111 secA preprotein translocase subunit SecA; Reviewed 97.74
TIGR00963 904 secA preprotein translocase, SecA subunit; InterPro: IP 97.6
pfam07517381 SecA_DEAD SecA DEAD-like domain. SecA protein binds to 97.6
PRK12902 946 secA preprotein translocase subunit SecA; Reviewed 97.59
PRK09200 799 preprotein translocase subunit SecA; Reviewed 97.5
KOG0951 1674 consensus 97.43
PRK12900 983 secA preprotein translocase subunit SecA; Reviewed 97.42
PRK12326 775 preprotein translocase subunit SecA; Reviewed 97.39
CHL00122 891 secA preprotein translocase subunit SecA; Validated 97.39
KOG09521230 consensus 97.38
PRK12904 833 preprotein translocase subunit SecA; Reviewed 97.32
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 97.29
PRK12903 885 secA preprotein translocase subunit SecA; Reviewed 97.23
PRK12906 823 secA preprotein translocase subunit SecA; Reviewed 97.21
PRK13107 908 preprotein translocase subunit SecA; Reviewed 97.14
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 97.14
pfam12340229 DUF3638 Protein of unknown function (DUF3638). This dom 97.06
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 96.48
PRK10416499 cell division protein FtsY; Provisional 96.05
PRK08074 932 bifunctional ATP-dependent DNA helicase/DNA polymerase 98.79
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 98.74
smart00488289 DEXDc2 DEAD-like helicases superfamily. 98.68
smart00489289 DEXDc3 DEAD-like helicases superfamily. 98.68
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polymerase 98.68
TIGR00631 667 uvrb excinuclease ABC, B subunit; InterPro: IPR004807 A 98.67
KOG1802 935 consensus 98.67
KOG1803 649 consensus 98.47
PRK10875 607 recD exonuclease V subunit alpha; Provisional 98.42
TIGR01407 944 dinG_rel DnaQ family exonuclease/DinG family helicase, 98.27
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4. 98.27
PRK05298 657 excinuclease ABC subunit B; Provisional 98.16
pfam09848 348 DUF2075 Uncharacterized conserved protein (DUF2075). Th 98.11
COG0556 663 UvrB Helicase subunit of the DNA excision repair comple 98.07
PRK12402337 replication factor C small subunit 2; Reviewed 97.62
COG1875436 NYN ribonuclease and ATPase of PhoH family domains [Gen 97.52
PRK07270 557 DNA polymerase III subunits gamma and tau; Validated 97.46
COG1199 654 DinG Rad3-related DNA helicases [Transcription / DNA re 97.45
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 97.4
PRK00440318 rfc replication factor C small subunit; Reviewed 97.3
KOG0989346 consensus 97.08
PRK07940 395 DNA polymerase III subunit delta'; Validated 96.84
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 96.72
PRK10867 453 signal recognition particle protein; Provisional 96.68
PRK08058329 DNA polymerase III subunit delta'; Validated 96.65
PRK05564313 DNA polymerase III subunit delta'; Validated 96.54
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, RNA h 96.54
PRK05707 328 DNA polymerase III subunit delta'; Validated 96.51
pfam00580 494 UvrD-helicase UvrD/REP helicase. The Rep family helicas 96.46
COG3972 660 Superfamily I DNA and RNA helicases [General function p 96.12
PRK07471 363 DNA polymerase III subunit delta'; Validated 96.11
smart00382148 AAA ATPases associated with a variety of cellular activ 96.06
PRK06871324 DNA polymerase III subunit delta'; Validated 96.05
PRK08699 325 DNA polymerase III subunit delta'; Validated 96.03
KOG0740428 consensus 96.01
TIGR02538577 type_IV_pilB type IV-A pilus assembly ATPase PilB; Inte 96.0
KOG0738491 consensus 95.78
PRK06964 342 DNA polymerase III subunit delta'; Validated 95.77
TIGR01425 453 SRP54_euk signal recognition particle protein SRP54; In 95.75
PRK06090319 DNA polymerase III subunit delta'; Validated 95.75
PRK11054 684 helD DNA helicase IV; Provisional 95.75
PRK04195 403 replication factor C large subunit; Provisional 95.62
KOG0737386 consensus 95.62
PRK10490 895 sensor protein KdpD; Provisional 95.53
TIGR01074 677 rep ATP-dependent DNA helicase Rep; InterPro: IPR005752 95.5
TIGR00604 813 rad3 DNA repair helicase (rad3); InterPro: IPR013020 Al 95.32
PRK11773 722 uvrD DNA-dependent helicase II; Provisional 95.28
PRK00411 394 cdc6 cell division control protein 6; Reviewed 95.24
PRK07399314 DNA polymerase III subunit delta'; Validated 95.09
KOG1807 1025 consensus 95.05
PRK00771 433 signal recognition particle protein Srp54; Provisional 94.99
COG3973 747 Superfamily I DNA and RNA helicases [General function p 94.96
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pilus a 94.74
PRK07993 334 DNA polymerase III subunit delta'; Validated 94.74
TIGR02533495 type_II_gspE general secretory pathway protein E; Inter 94.69
pfam05970 418 DUF889 PIF1 helicase. The PIF1 helicase inhibits telome 94.53
pfam07015231 VirC1 VirC1 protein. This family consists of several ba 94.38
COG2205 890 KdpD Osmosensitive K+ channel histidine kinase [Signal 94.27
COG0210 655 UvrD Superfamily I DNA and RNA helicases [DNA replicati 93.85
COG3267269 ExeA Type II secretory pathway, component ExeA (predict 93.84
PRK13849231 putative crown gall tumor protein VirC1; Provisional 93.77
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 93.62
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 93.52
KOG0739439 consensus 93.47
KOG0987 540 consensus 93.33
COG1484254 DnaC DNA replication protein [DNA replication, recombin 93.33
PRK08116262 hypothetical protein; Validated 93.25
KOG0780 483 consensus 93.12
PRK04328250 hypothetical protein; Provisional 92.94
pfam06745231 KaiC KaiC. This family represents a conserved region wi 92.93
COG0470325 HolB ATPase involved in DNA replication [DNA replicatio 92.88
PRK07952242 DNA replication protein DnaC; Validated 92.86
PRK10436461 hypothetical protein; Provisional 92.8
COG0541 451 Ffh Signal recognition particle GTPase [Intracellular t 92.7
PRK06526254 transposase; Provisional 92.67
PRK06921265 hypothetical protein; Provisional 92.49
PRK08939306 primosomal protein DnaI; Reviewed 92.3
PRK07276290 DNA polymerase III subunit delta'; Validated 92.27
PRK12377248 putative replication protein; Provisional 92.2
PRK09183258 transposase/IS protein; Provisional 92.15
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway is th 92.11
TIGR00376 709 TIGR00376 DNA helicase, putative; InterPro: IPR004483 E 92.02
pfam01935218 DUF87 Domain of unknown function DUF87. The function of 92.0
cd01124187 KaiC KaiC is a circadian clock protein primarily found 91.9
COG1702348 PhoH Phosphate starvation-inducible protein PhoH, predi 91.77
TIGR02782315 TrbB_P P-type conjugative transfer ATPase TrbB; InterPr 91.72
PRK10263 1355 DNA translocase FtsK; Provisional 91.51
PRK06835330 DNA replication protein DnaC; Validated 91.48
PRK03992390 proteasome-activating nucleotidase; Provisional 91.45
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 91.19
TIGR00959 439 ffh signal recognition particle protein; InterPro: IPR0 91.0
KOG1133 821 consensus 90.96
PRK08181269 transposase; Validated 90.77
TIGR01075 741 uvrD DNA helicase II; InterPro: IPR005753 The SOS respo 90.56
PRK00652334 lpxK tetraacyldisaccharide 4'-kinase; Reviewed 90.37
PRK04132 863 replication factor C small subunit; Provisional 90.33
PRK07133 718 DNA polymerase III subunits gamma and tau; Validated 97.75
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 97.11
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA replic 96.8
CHL00181287 cbbX CbbX; Provisional 95.5
PRK07132 303 DNA polymerase III subunit delta'; Validated 93.41
PRK05917290 DNA polymerase III subunit delta'; Validated 92.55
pfam05707183 Zot Zonular occludens toxin (Zot). This family consists 91.89
PRK12898 673 secA preprotein translocase subunit SecA; Reviewed 97.62
PRK12899 969 secA preprotein translocase subunit SecA; Reviewed 96.83
KOG1132 945 consensus 97.56
PRK13342 417 recombination factor protein RarA; Reviewed 95.3
PRK13341 726 recombination factor protein RarA/unknown domain fusion 91.69
pfam06733168 DEAD_2 DEAD_2. This represents a conserved region withi 94.86
COG1199 654 DinG Rad3-related DNA helicases [Transcription / DNA re 90.01
TIGR00345 330 arsA arsenite-activated ATPase (arsA); InterPro: IPR003 93.18
KOG0730693 consensus 91.88
>KOG0392 consensus Back     alignment and domain information
>pfam00176 SNF2_N SNF2 family N-terminal domain Back     alignment and domain information
>KOG0385 consensus Back     alignment and domain information
>KOG0384 consensus Back     alignment and domain information
>KOG0387 consensus Back     alignment and domain information
>KOG0391 consensus Back     alignment and domain information
>KOG0389 consensus Back     alignment and domain information
>KOG0390 consensus Back     alignment and domain information
>KOG0386 consensus Back     alignment and domain information
>KOG0388 consensus Back     alignment and domain information
>KOG4439 consensus Back     alignment and domain information
>KOG1000 consensus Back     alignment and domain information
>KOG1015 consensus Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG1002 consensus Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1016 consensus Back     alignment and domain information
>KOG1001 consensus Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25; InterPro: IPR001161 Xeroderma pigmentosum (XP) is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG; InterPro: IPR004609 The ATP-dependent DNA helicase RecG 3 Back     alignment and domain information
>KOG0383 consensus Back     alignment and domain information
>KOG0298 consensus Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG1123 consensus Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor; InterPro: IPR004576 All proteins in this family for which functions are known are DNA-dependent ATPases that function in the process of transcription-coupled DNA repair in which the repair of the transcribed strand of actively transcribed genes is repaired at a higher rate than the repair of non-transcribed regions of the genome and than the non-transcribed strand of the same gene Back     alignment and domain information
>KOG0952 consensus Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family; InterPro: IPR004589 The ATP-dependent DNA helicase RecQ (3 Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ; InterPro: IPR006293 The ATP-dependent DNA helicase RecQ (3 Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0343 consensus Back     alignment and domain information
>KOG0351 consensus Back     alignment and domain information
>KOG0950 consensus Back     alignment and domain information
>KOG0949 consensus Back     alignment and domain information
>KOG0344 consensus Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0922 consensus Back     alignment and domain information
>KOG0328 consensus Back     alignment and domain information
>KOG0352 consensus Back     alignment and domain information
>KOG1513 consensus Back     alignment and domain information
>KOG4284 consensus Back     alignment and domain information
>KOG0920 consensus Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit; InterPro: IPR006344 This family describes the exodeoxyribonuclease V alpha subunit, RecD Back     alignment and domain information
>pfam02399 Herpes_ori_bp Origin of replication binding protein Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB; InterPro: IPR010225 This entry represents HrpB, one of two related predicted DEAH-box ATP-dependent helicases of unknown function found in many proteobacteria, but also in a few species of other lineages Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>KOG0923 consensus Back     alignment and domain information
>KOG0341 consensus Back     alignment and domain information
>KOG0925 consensus Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>pfam03354 Terminase_1 Phage Terminase Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>pfam00265 TK Thymidine kinase Back     alignment and domain information
>pfam00448 SRP54 SRP54-type protein, GTPase domain Back     alignment and domain information
>PRK05986 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated Back     alignment and domain information
>pfam02572 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>TIGR02928 TIGR02928 orc1/cdc6 family replication initiation protein; InterPro: IPR014277 This set of DNA binding proteins shows homology to the origin recognition complex subunit 1/cell division control protein 6 family in eukaryotes Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA; InterPro: IPR014136 This entry represents the Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG2109 BtuR ATP:corrinoid adenosyltransferase [Coenzyme metabolism] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>pfam04851 ResIII Type III restriction enzyme, res subunit Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>KOG0354 consensus Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>pfam00270 DEAD DEAD/DEAH box helicase Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family; InterPro: IPR004473 There are four classes of restriction endonucleases: types I, II,III and IV Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0947 consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0330 consensus Back     alignment and domain information
>KOG0331 consensus Back     alignment and domain information
>pfam07652 Flavi_DEAD Flavivirus DEAD domain Back     alignment and domain information
>KOG0948 consensus Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>KOG0951 consensus Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0338 consensus Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG0335 consensus Back     alignment and domain information
>KOG0342 consensus Back     alignment and domain information
>KOG0348 consensus Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>KOG0340 consensus Back     alignment and domain information
>KOG0353 consensus Back     alignment and domain information
>PRK09694 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3; InterPro: IPR006474 This entry represents a highly conserved core region of the Cas3 sequences Back     alignment and domain information
>KOG0347 consensus Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype; InterPro: IPR013444 This entry represents a CRISPR-associated putative DEAH-box helicase, or Cas3, subtype found in Actinomyces naeslundii MG1, Geobacter sulfurreducens PCA, Gemmata obscuriglobus UQM 2246, and Desulfotalea psychrophila Back     alignment and domain information
>pfam02562 PhoH PhoH-like protein Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>KOG0339 consensus Back     alignment and domain information
>KOG0336 consensus Back     alignment and domain information
>TIGR00595 priA primosomal protein N'; InterPro: IPR005259 All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination Back     alignment and domain information
>KOG0926 consensus Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA; InterPro: IPR010222 This entry represents HrpA, one of two related but uncharacterised DEAH-box ATP-dependent helicases in many Proteobacteria and a few high-GC Gram-positive bacteria Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunits gamma and tau; InterPro: IPR012763 This entry represents the well-conserved first N-terminal domain of DnaX, approx Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information