254780130

254780130

hypothetical protein CLIBASIA_00045

GeneID in NCBI database:8209105Locus tag:CLIBASIA_00045
Protein GI in NCBI database:254780130Protein Accession:YP_003064543.1
Gene range:+(6832, 7449)Protein Length:205aa
Gene description:hypothetical protein
COG prediction:[K] [L] Superfamily II DNA/RNA helicases, SNF2 family
KEGG prediction:hypothetical protein
SEED prediction:DNA helicase, phage-associated
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-----
MKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIHV
cHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccccccccEEEcccHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHccccHHHHHHHHHHHHccccEEEEEEHHHccccccHHHHccEEEEEcccccHHHHHHHHHHHHHHHHHHccccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
ccHHHHHHHHHHHHcccccEEHHHHHHHHHHHHHHHcccEEEcccccEEEEcHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHcccccEcccccHHHHHHHcccccEEEEEcccccccccccccccEEEEccccccHHHHHHHHHHHcccHHHHccccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHccccc
MKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQlangavyydeeKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKafpqgrtldkdpctiqewnegkipllfahpascghglnlqyggNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIHV
MKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLlnalkketihv
MKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIHV
MKQYHKFQREL***********FNSASKTVKCLQLANGAVYYDEEKHW*EVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQ*************WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKK*****
MKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIHV
MKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWxxxxxxxxxxxxxxxxxxxxxPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIHV
MKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIHV
MKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIHV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target205 hypothetical protein CLIBASIA_00045 [Candidatus Liberib
255764515458 SNF2 related [Candidatus Liberibacter asiaticus st 1e-122
>gi|255764515|ref|YP_003065608.2| SNF2 related [Candidatus Liberibacter asiaticus str. psy62] Length = 458 Back     alignment
 Score =  430 bits (1105), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 205/205 (100%), Positives = 205/205 (100%)

Query: 1   MKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALE 60
           MKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALE
Sbjct: 254 MKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALE 313

Query: 61  VIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCG 120
           VIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCG
Sbjct: 314 VIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCG 373

Query: 121 HGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELV 180
           HGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELV
Sbjct: 374 HGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELV 433

Query: 181 LQRLRTKSTIQDLLLNALKKETIHV 205
           LQRLRTKSTIQDLLLNALKKETIHV
Sbjct: 434 LQRLRTKSTIQDLLLNALKKETIHV 458

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target205 hypothetical protein CLIBASIA_00045 [Candidatus Liberib
317120757460 SNF2 Dead box helicase [Candidatus Liberibacter asiatic 1 1e-119
255764515458 SNF2 related [Candidatus Liberibacter asiaticus str. ps 1 1e-119
317120700461 SNF2 Dead box helicase [Liberibacter phage SC1] Length 1 1e-118
317120844461 SNF2 Dead box helicase [Candidatus Liberibacter asiatic 1 1e-116
315122937456 SNF2 related protein [Candidatus Liberibacter solanacea 1 1e-88
315121969456 SNF2 related protein [Candidatus Liberibacter solanacea 1 4e-88
212712312463 hypothetical protein PROVALCAL_03400 [Providencia alcal 1 1e-71
238920126433 hypothetical protein NT01EI_2232 [Edwardsiella ictaluri 1 2e-71
323159216435 DEAD box helicase [Escherichia coli E128010] Length = 4 1 6e-71
218555139464 hypothetical protein ECIAI1_2669 [Escherichia coli IAI1 1 7e-71
>gi|317120757|gb|ADV02578.1| SNF2 Dead box helicase [Candidatus Liberibacter asiaticus] Length = 460 Back     alignment and organism information
 Score =  430 bits (1106), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 205/205 (100%), Positives = 205/205 (100%)

Query: 1   MKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALE 60
           MKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALE
Sbjct: 256 MKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALE 315

Query: 61  VIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCG 120
           VIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCG
Sbjct: 316 VIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCG 375

Query: 121 HGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELV 180
           HGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELV
Sbjct: 376 HGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELV 435

Query: 181 LQRLRTKSTIQDLLLNALKKETIHV 205
           LQRLRTKSTIQDLLLNALKKETIHV
Sbjct: 436 LQRLRTKSTIQDLLLNALKKETIHV 460


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|255764515|ref|YP_003065608.2| SNF2 related [Candidatus Liberibacter asiaticus str. psy62] Length = 458 Back     alignment and organism information
>gi|317120700|gb|ADV02523.1| SNF2 Dead box helicase [Liberibacter phage SC1] Length = 461 Back     alignment and organism information
>gi|317120844|gb|ADV02665.1| SNF2 Dead box helicase [Candidatus Liberibacter asiaticus] Length = 461 Back     alignment and organism information
>gi|315122937|ref|YP_004063426.1| SNF2 related protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 456 Back     alignment and organism information
>gi|315121969|ref|YP_004062458.1| SNF2 related protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 456 Back     alignment and organism information
>gi|212712312|ref|ZP_03320440.1| hypothetical protein PROVALCAL_03400 [Providencia alcalifaciens DSM 30120] Length = 463 Back     alignment and organism information
>gi|238920126|ref|YP_002933641.1| hypothetical protein NT01EI_2232 [Edwardsiella ictaluri 93-146] Length = 433 Back     alignment and organism information
>gi|323159216|gb|EFZ45206.1| DEAD box helicase [Escherichia coli E128010] Length = 435 Back     alignment and organism information
>gi|218555139|ref|YP_002388052.1| hypothetical protein ECIAI1_2669 [Escherichia coli IAI1] Length = 464 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target205 hypothetical protein CLIBASIA_00045 [Candidatus Liberib
KOG0390776 KOG0390, KOG0390, KOG0390, DNA repair protein, SNF2 fam 7e-06
KOG1000689 KOG1000, KOG1000, KOG1000, Chromatin remodeling protein 8e-04
KOG4439901 KOG4439, KOG4439, KOG4439, RNA polymerase II transcript 0.004
COG0553866 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 f 4e-07
KOG03921549 KOG0392, KOG0392, KOG0392, SNF2 family DNA-dependent AT 8e-04
>gnl|CDD|35611 KOG0390, KOG0390, KOG0390, DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|36218 KOG1000, KOG1000, KOG1000, Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|39640 KOG4439, KOG4439, KOG4439, RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription, Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|30899 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|35613 KOG0392, KOG0392, KOG0392, SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 205 hypothetical protein CLIBASIA_00045 [Candidatus Liberib
KOG03921549 consensus 100.0
KOG0385 971 consensus 100.0
KOG0384 1373 consensus 100.0
KOG0390776 consensus 100.0
KOG0387 923 consensus 100.0
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family [Tra 100.0
KOG0386 1157 consensus 99.95
KOG0389941 consensus 100.0
KOG1002791 consensus 99.98
KOG4439901 consensus 99.98
KOG0391 1958 consensus 99.97
KOG03881185 consensus 99.97
PRK04914 955 ATP-dependent helicase HepA; Validated 99.96
KOG1015 1567 consensus 99.96
KOG1000689 consensus 99.94
KOG1001674 consensus 99.93
KOG1016 1387 consensus 99.85
PRK13766 764 Hef nuclease; Provisional 99.75
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recombinati 99.73
KOG02981394 consensus 99.72
PRK11192417 ATP-dependent RNA helicase SrmB; Provisional 99.43
PRK01297472 ATP-dependent RNA helicase RhlB; Provisional 99.42
PRK11776459 ATP-dependent RNA helicase DbpA; Provisional 99.38
PRK10590457 ATP-dependent RNA helicase RhlE; Provisional 99.37
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.3
KOG0354 746 consensus 99.3
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.24
PTZ00110602 helicase; Provisional 99.17
KOG0331519 consensus 99.14
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA replicat 99.1
KOG0333673 consensus 99.1
KOG0330476 consensus 99.01
KOG0328400 consensus 98.84
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Transcript 98.78
KOG0332477 consensus 98.5
TIGR00603756 rad25 DNA repair helicase rad25; InterPro: IPR001161 Xe 98.46
KOG0350620 consensus 98.44
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, reco 98.42
KOG0336629 consensus 98.37
PRK01172 674 ski2-like helicase; Provisional 98.26
TIGR01389 607 recQ ATP-dependent DNA helicase RecQ; InterPro: IPR0062 98.23
KOG1123776 consensus 98.21
KOG0343 758 consensus 98.21
KOG0326459 consensus 98.19
KOG0341610 consensus 98.16
COG1201 814 Lhr Lhr-like helicases [General function prediction onl 98.13
KOG0335482 consensus 98.06
KOG0334 997 consensus 98.06
TIGR00614 497 recQ_fam ATP-dependent DNA helicase, RecQ family; Inter 98.02
KOG0338 691 consensus 97.99
KOG0327397 consensus 97.89
KOG0342543 consensus 97.84
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 97.79
COG1202 830 Superfamily II helicase, archaea-specific [General func 97.79
KOG0347 731 consensus 97.5
KOG0339 731 consensus 97.46
PRK10917677 ATP-dependent DNA helicase RecG; Provisional 97.08
pfam11496278 HDA2-3 Class II histone deacetylase complex subunits 2 96.82
KOG0952 1230 consensus 96.59
TIGR01587424 cas3_core CRISPR-associated helicase Cas3; InterPro: IP 96.1
COG1205 851 Distinct helicase family with a unique C-terminal domai 95.8
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanisms] 93.4
PRK10689 1148 transcription-repair coupling factor; Provisional 92.97
COG1197 1139 Mfd Transcription-repair coupling factor (superfamily I 91.83
cd00079131 HELICc Helicase superfamily c-terminal domain; associat 99.85
PRK04537 574 ATP-dependent RNA helicase RhlB; Provisional 99.36
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.04
PRK13767 878 ATP-dependent helicase; Provisional 98.7
KOG0344593 consensus 98.37
KOG0351 941 consensus 98.3
KOG0340442 consensus 97.88
KOG4284 980 consensus 97.87
KOG0345 567 consensus 97.7
KOG0953 700 consensus 97.58
KOG0349725 consensus 97.37
KOG0352 641 consensus 97.21
KOG0353 695 consensus 97.03
PRK11448 1126 hsdR type I restriction enzyme EcoKI subunit R; Provisi 96.99
COG4098441 comFA Superfamily II DNA/RNA helicase required for DNA 95.8
TIGR02621 975 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-sub 95.6
TIGR00643721 recG ATP-dependent DNA helicase RecG; InterPro: IPR0046 95.17
PRK12899 969 secA preprotein translocase subunit SecA; Reviewed 94.97
PRK12906 823 secA preprotein translocase subunit SecA; Reviewed 94.59
COG4096 875 HsdR Type I site-specific restriction-modification syst 94.52
PRK12903 885 secA preprotein translocase subunit SecA; Reviewed 94.06
PRK12900 983 secA preprotein translocase subunit SecA; Reviewed 93.89
PRK09200 799 preprotein translocase subunit SecA; Reviewed 93.88
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 93.86
COG1200677 RecG RecG-like helicase [DNA replication, recombination 93.79
PRK12898673 secA preprotein translocase subunit SecA; Reviewed 93.33
PRK12901 1111 secA preprotein translocase subunit SecA; Reviewed 93.07
KOG0346 569 consensus 92.89
KOG0951 1674 consensus 92.77
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. subt 92.5
KOG0337 529 consensus 91.94
PRK12326 775 preprotein translocase subunit SecA; Reviewed 91.58
PRK13107 908 preprotein translocase subunit SecA; Reviewed 91.41
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 91.28
pfam0027178 Helicase_C Helicase conserved C-terminal domain. The Pr 99.24
smart0049082 HELICc helicase superfamily c-terminal domain. 99.13
PRK00254 717 ski2-like helicase; Provisional 98.15
PRK02362 736 ski2-like helicase; Provisional 97.95
COG1204 766 Superfamily II helicase [General function prediction on 96.48
KOG0950 1008 consensus 90.28
KOG0948 1041 consensus 90.04
KOG0383696 consensus 98.52
KOG0348 708 consensus 98.22
KOG1513 1300 consensus 97.39
KOG0949 1330 consensus 93.7
TIGR00596 939 rad1 DNA repair protein (rad1); InterPro: IPR006167 All 93.49
COG1110 1187 Reverse gyrase [DNA replication, recombination, and rep 90.51
>KOG0392 consensus Back     alignment and domain information
>KOG0385 consensus Back     alignment and domain information
>KOG0384 consensus Back     alignment and domain information
>KOG0390 consensus Back     alignment and domain information
>KOG0387 consensus Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0386 consensus Back     alignment and domain information
>KOG0389 consensus Back     alignment and domain information
>KOG1002 consensus Back     alignment and domain information
>KOG4439 consensus Back     alignment and domain information
>KOG0391 consensus Back     alignment and domain information
>KOG0388 consensus Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG1015 consensus Back     alignment and domain information
>KOG1000 consensus Back     alignment and domain information
>KOG1001 consensus Back     alignment and domain information
>KOG1016 consensus Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0298 consensus Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0354 consensus Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0331 consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0333 consensus Back     alignment and domain information
>KOG0330 consensus Back     alignment and domain information
>KOG0328 consensus Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0332 consensus Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25; InterPro: IPR001161 Xeroderma pigmentosum (XP) is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer Back     alignment and domain information
>KOG0350 consensus Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0336 consensus Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ; InterPro: IPR006293 The ATP-dependent DNA helicase RecQ (3 Back     alignment and domain information
>KOG1123 consensus Back     alignment and domain information
>KOG0343 consensus Back     alignment and domain information
>KOG0326 consensus Back     alignment and domain information
>KOG0341 consensus Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>KOG0335 consensus Back     alignment and domain information
>KOG0334 consensus Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family; InterPro: IPR004589 The ATP-dependent DNA helicase RecQ (3 Back     alignment and domain information
>KOG0338 consensus Back     alignment and domain information
>KOG0327 consensus Back     alignment and domain information
>KOG0342 consensus Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>KOG0347 consensus Back     alignment and domain information
>KOG0339 consensus Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>pfam11496 HDA2-3 Class II histone deacetylase complex subunits 2 and 3 Back     alignment and domain information
>KOG0952 consensus Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3; InterPro: IPR006474 This entry represents a highly conserved core region of the Cas3 sequences Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>KOG0344 consensus Back     alignment and domain information
>KOG0351 consensus Back     alignment and domain information
>KOG0340 consensus Back     alignment and domain information
>KOG4284 consensus Back     alignment and domain information
>KOG0345 consensus Back     alignment and domain information
>KOG0953 consensus Back     alignment and domain information
>KOG0349 consensus Back     alignment and domain information
>KOG0352 consensus Back     alignment and domain information
>KOG0353 consensus Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype; InterPro: IPR013444 This entry represents a CRISPR-associated putative DEAH-box helicase, or Cas3, subtype found in Actinomyces naeslundii MG1, Geobacter sulfurreducens PCA, Gemmata obscuriglobus UQM 2246, and Desulfotalea psychrophila Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG; InterPro: IPR004609 The ATP-dependent DNA helicase RecG 3 Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0346 consensus Back     alignment and domain information
>KOG0951 consensus Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>KOG0337 consensus Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>pfam00271 Helicase_C Helicase conserved C-terminal domain Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>KOG0950 consensus Back     alignment and domain information
>KOG0948 consensus Back     alignment and domain information
>KOG0383 consensus Back     alignment and domain information
>KOG0348 consensus Back     alignment and domain information
>KOG1513 consensus Back     alignment and domain information
>KOG0949 consensus Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1); InterPro: IPR006167 All proteins in this family, for which functions are known, are components in a multiprotein endonuclease complex, usually made up of Rad1 and Rad10 homologues Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target205 hypothetical protein CLIBASIA_00045 [Candidatus Liberib
1z5z_A271 Sulfolobus Solfataricus Swi2SNF2 ATPASE C-Terminal 2e-22
1z6a_A500 Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN 3e-22
1z63_A500 Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COM 8e-22
1z3i_X644 Structure Of The Swi2SNF2 CHROMATIN REMODELING DOMA 7e-16
3mwy_W800 Crystal Structure Of The Chromodomain-Atpase Portio 6e-15
>gi|66361321|pdb|1Z5Z|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE C-Terminal Domain Length = 271 Back     alignment and structure
 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 34/211 (16%), Positives = 69/211 (32%), Gaps = 23/211 (10%)

Query: 3   QYHKFQRELYCDLQG--ENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALE 60
            Y      L+ ++             S  +K  Q+ +                 K+    
Sbjct: 44  MYKAEVENLFNNIDSVTGIKRKGMILSTLLKLKQIVDHPALLK-GGEQSVRRSGKMIRTM 102

Query: 61  VIIEK--ANAAPIIVAYHFNSDLARLQKAFPQG------------RTLDKDPCTIQEWNE 106
            IIE+       I +   F      ++    +                ++D    +  N 
Sbjct: 103 EIIEEALDEGDKIAIFTQFVDMGKIIRNIIEKELNTEVPFLYGELSKKERDDIISKFQNN 162

Query: 107 GKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVF 166
             +  +     + G G+NL    N ++ F  WW+       +E     R  + G  R V 
Sbjct: 163 PSVKFIVLSVKAGGFGINLTS-ANRVIHFDRWWNPA-----VEDQATDRVYRIGQTRNVI 216

Query: 167 VYYLIAQNTIDELVLQRLRTKSTIQDLLLNA 197
           V+ LI+  T++E + Q L  K ++   ++++
Sbjct: 217 VHKLISVGTLEEKIDQLLAFKRSLFKDIISS 247


>gi|66361330|pdb|1Z6A|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN Length = 500 Back     alignment and structure
>gi|67464359|pdb|1Z63|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COMPLEX With Dsdna Length = 500 Back     alignment and structure
>gi|62738897|pdb|1Z3I|X Chain X, Structure Of The Swi2SNF2 CHROMATIN REMODELING DOMAIN OF Eukaryotic Rad54 Length = 644 Back     alignment and structure
>gi|307776522|pdb|3MWY|W Chain W, Crystal Structure Of The Chromodomain-Atpase Portion Of The Yeast Chd1 Chromatin Remodeler Length = 800 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target205 hypothetical protein CLIBASIA_00045 [Candidatus Liberib
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPase, d 1e-15
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA complex, 1e-13
1z3i_X644 Similar to RAD54-like; recombination ATPase helicase, r 1e-11
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA bindi 3e-10
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, tran 2e-14
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, recombina 2e-06
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA repli 3e-06
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 hel 2e-05
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Length = 800 Back     alignment and structure
 Score = 78.0 bits (191), Expect = 1e-15
 Identities = 31/160 (19%), Positives = 61/160 (38%), Gaps = 20/160 (12%)

Query: 52  HDEKIKALEVIIE--KANAAPIIVAYHFNSDLARLQKAFPQ---------GRTLDKD-PC 99
              K+  L+ ++   K +   +++       L  L               G         
Sbjct: 554 SSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRI 613

Query: 100 TIQEWNEG--KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQR 157
           +I  +N       +      + G G+NL    + +V F   W+ +   Q + R    R  
Sbjct: 614 SIDHFNSPDSNDFVFLLSTRAGGLGINLM-TADTVVIFDSDWNPQADLQAMARA--HRIG 670

Query: 158 QAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNA 197
           Q   K  V VY L++++T++E VL+R R K  ++  +++ 
Sbjct: 671 Q---KNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISL 707


>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Length = 500 Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination/DNA binding complex; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Length = 644 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase/recombination complex; 2.00A {Sulfolobus solfataricus P2} SCOP: c.37.1.19 Length = 271 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombination, hydrolase; 2.90A {Pyrococcus furiosus dsm 3638} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Length = 328 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target205 hypothetical protein CLIBASIA_00045 [Candidatus Liberib
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, recombina 100.0
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPase, d 100.0
1z3i_X644 Similar to RAD54-like; recombination ATPase helicase, r 100.0
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA complex, 100.0
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 hel 99.95
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, tran 99.97
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA repli 99.82
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA bindi 99.79
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-beta, h 99.79
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA helic 99.78
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural geno 99.78
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA helic 99.73
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, dime 99.73
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-box pro 99.65
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphoryl 99.6
3gfp_A189 DEAD box protein 5; mRNA export, ATPase, RECA-fold, ATP 99.58
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, struct 99.5
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene 99.39
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, phos 99.37
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helic 99.32
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA complex, 99.29
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged helix 99.28
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-binding, 99.25
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-binding 99.22
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA 99.2
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase DEAD 99.19
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-beta fol 99.14
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealing, mi 99.14
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, nucle 99.1
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP-depen 99.08
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural geno 99.05
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-box pr 99.05
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nucleot 97.82
3h1t_A590 Type I site-specific restriction-modification system, R 97.75
1yks_A 440 Genome polyprotein [contains: flavivirin protease NS3 c 97.66
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, SF2 AT 97.58
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription, hyd 97.46
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, RNA r 97.42
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, membrane 97.39
3jux_A 822 Protein translocase subunit SECA; protein translocation 96.52
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-RNA he 96.38
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein trans 96.23
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helicase, 95.87
3kqn_A 437 Serine protease/ntpase/helicase NS3; helicase-substrate 95.05
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPase, t 94.37
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, 98.94
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winged-hel 98.69
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP 98.59
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helicase, 98.53
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fold, A 97.9
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 3.24 97.89
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction 95.9
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, flavivirin 97.06
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus toko 94.78
2vsf_A602 XPD, DNA repair helicase RAD3 related protein; NER, TFI 93.94
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase/recombination complex; 2.00A {Sulfolobus solfataricus P2} SCOP: c.37.1.19 Back     alignment and structure
Probab=100.00  E-value=6.6e-39  Score=233.57  Aligned_cols=190  Identities=18%  Similarity=0.225  Sum_probs=157.1

Q ss_pred             HHHHHHHHHHHHHHCCCCEEH--HHHHHHHHHHHHHCCCCHHCCCCCCCCCCCHHHHHHHHHHHHHC--CCCCEEEHHHH
Q ss_conf             358999999999735783209--99999999998860770003445654205723433499998614--89971105789
Q gi|254780130|r    2 KQYHKFQRELYCDLQGENIEA--FNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKA--NAAPIIVAYHF   77 (205)
Q Consensus         2 k~Y~~l~~~~~~~~~~~~i~a--~~~~~~~~kL~Ql~~g~~~~d~~~~~~~~~~~Kl~~l~~ii~~~--~~~kviVf~~f   77 (205)
                      +.|+++..+....++......  ...++.+++|+|+|+||...+... .....++|+.++.+++++.  .+.|+||||+|
T Consensus        43 ~~Y~~~~~~~~~~~~~~~~~~~~~~~l~~l~~Lrqic~~p~~~~~~~-~~~~~s~Kl~~l~~il~~~~~~~~kvIVFs~~  121 (271)
T 1z5z_A           43 AMYKAEVENLFNNIDSVTGIKRKGMILSTLLKLKQIVDHPALLKGGE-QSVRRSGKMIRTMEIIEEALDEGDKIAIFTQF  121 (271)
T ss_dssp             HHHHHHHHHHHHHTTTCCHHHHHHHHHHHHHHHHHHTTCTHHHHCSC-CCSTTCHHHHHHHHHHHHHHHTTCCEEEEESC
T ss_pred             HHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCHHCCCC-CCCCCCHHHHHHHHHHHHHHHCCCEEEEEEEC
T ss_conf             99999999999988631251015799999999999806962310566-53001558999999999866358859999804


Q ss_pred             HHHHHHHHHHH-----------HCCCCHHHHHHHHHHHHCC-CCCEEEECHHHHHHHHHHHHHCCEEEEECCCCCHHHHH
Q ss_conf             99999987653-----------0477823489999997278-98699972144323322432067589726899988802
Q gi|254780130|r   78 NSDLARLQKAF-----------PQGRTLDKDPCTIQEWNEG-KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQ  145 (205)
Q Consensus        78 ~~~l~~l~~~~-----------~~~~~~~~r~~~i~~f~~~-~~~Vll~~~~a~g~GlnL~~a~~~vI~~~~~~n~~~~~  145 (205)
                      ...++.+...+           .|+.+..+|+.+++.|+++ ...|+++++++||+|+|||. |+++||++++|||..+.
T Consensus       122 ~~~~~~~~~~~~~~~~~~~~~i~G~~s~~~R~~~i~~f~~~~~~~vl~~~~~~~~~GlnL~~-a~~vi~~d~~wn~~~~~  200 (271)
T 1z5z_A          122 VDMGKIIRNIIEKELNTEVPFLYGELSKKERDDIISKFQNNPSVKFIVLSVKAGGFGINLTS-ANRVIHFDRWWNPAVED  200 (271)
T ss_dssp             HHHHHHHHHHHHHHHCSCCCEECTTSCHHHHHHHHHHHHHCTTCCEEEEECCTTCCCCCCTT-CSEEEECSCCSCTTTC-
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCHH-HHHHHHCCCCCCHHHHH
T ss_conf             08999999999985498479996753088778888643303540235651000166765244-31222207899978999


Q ss_pred             HHHHHHHHHHHHCCCCCCCEEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             25555766654202657753999998388958999999999999999999999
Q gi|254780130|r  146 QMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNAL  198 (205)
Q Consensus       146 Qa~~Ri~~~r~hR~GQ~~~v~v~~l~~~~tiEe~i~~~l~~K~~~~~~~l~~~  198 (205)
                      ||++|+     ||+||+++|.||+|+++||||++|++++..|..+++.+++..
T Consensus       201 Qa~~R~-----~R~GQ~~~v~v~~li~~~Tiee~i~~~l~~K~~l~~~~~~~~  248 (271)
T 1z5z_A          201 QATDRV-----YRIGQTRNVIVHKLISVGTLEEKIDQLLAFKRSLFKDIISSG  248 (271)
T ss_dssp             ------------------CCEEEEEEETTSHHHHHHHHHHHCHHHHTTGGGGT
T ss_pred             HHCCCC-----CCCCCCCCEEEEEEEECCCHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             881888-----666898733999987489999999999999999999986288



>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination/DNA binding complex; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombination, hydrolase; 2.90A {Pyrococcus furiosus dsm 3638} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP- binding, helicase, nucleotide-binding; 2.80A {Thermus thermophilus HB27} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, acetylation, ATP-binding, DNA-binding; 1.91A {Homo sapiens} Back     alignment and structure
>3gfp_A DEAD box protein 5; mRNA export, ATPase, RECA-fold, ATP-binding, cytoplasm, helicase, hydrolase, membrane, mRNA transport; 1.80A {Saccharomyces cerevisiae} PDB: 2kbf_A Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural genomics consortium, SGC, alternative initiation ATP-binding; 2.80A {Homo sapiens} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, cytoplasm, nucleus, phosphoprotein, RNA-binding, ATP-binding; 3.50A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, helicase, hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic transport, mRNA export, protein interaction; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural genomics consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase, transferase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 1m6n_A 1m74_A* 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>3kqn_A Serine protease/ntpase/helicase NS3; helicase-substrate transition-state complex, HCV, NS3 protein, helicase, DNA-binding; HET: ADP; 2.05A {Hepatitis c virus} PDB: 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 2zjo_A* 8ohm_A 1a1v_A* 2f55_A 1hei_A 1jr6_A 1onb_A Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-binding, nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, plasmid, helicase, hydrolase, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2w74_B* Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, flavivirin protease NS3 catalytic subunit...; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>2vsf_A XPD, DNA repair helicase RAD3 related protein; NER, TFIIH, hydrolase, ATP-binding, nucleotide-binding, iron sulfur cluster; HET: DNA; 2.9A {Thermoplasma acidophilum} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 205 hypothetical protein CLIBASIA_00045 [Candidatus Liberib
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeo 7e-07
d1z5za1244 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily 2e-06
d1z3ix1346 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (D 7e-06
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA helica 2e-04
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: DNA repair protein RAD25
species: Archaeoglobus fulgidus [TaxId: 2234]
 Score = 48.0 bits (113), Expect = 7e-07
 Identities = 33/185 (17%), Positives = 62/185 (33%), Gaps = 15/185 (8%)

Query: 1   MKQYHKFQRELYCDLQGENIEAFNSAS------KTVKCLQLANGAVYYDEEKHWKEVHDE 54
             +Y K ++     L+   I    +         +    +       ++E +        
Sbjct: 20  RVEYEKREKVYKQFLRARGITLRRAEDFNKIVMASGYDERAYEALRAWEEARRIAFNSKN 79

Query: 55  KIKALEVIIEKANAAPIIVAYHFNSDLARLQK----AFPQGRTLDKDPCTIQEWNEGKIP 110
           KI+ L  I+E+     II+    N  + R+ K         RT  ++   I E       
Sbjct: 80  KIRKLREILERHRKDKIIIFTRHNELVYRISKVFLIPAITHRTSREEREEILEGFRTGRF 139

Query: 111 LLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYL 170
                      G+++    N+ V  S      E+ Q + RI     R +  K+   +Y L
Sbjct: 140 RAIVSSQVLDEGIDVP-DANVGVIMSGSGSAREYIQRLGRIL----RPSKGKKEAVLYEL 194

Query: 171 IAQNT 175
           I++ T
Sbjct: 195 ISRGT 199


>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 244 Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 346 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target205 hypothetical protein CLIBASIA_00045 [Candidatus Liberib
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solfatari 100.0
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 79 100.0
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId 99.89
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyrococcus 99.86
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapi 99.76
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's yeast 99.74
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanococcus 99.71
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces cere 99.69
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human (Homo 99.64
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapiens) 99.59
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562]} 99.54
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon Arch 99.15
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus caldot 99.12
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus thermop 99.04
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV), dif 98.29
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV), dif 98.05
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escherichia 97.15
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 1106 97.09
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding domains { 96.94
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11089]} 95.54
d1nkta4219 Translocation ATPase SecA, nucleotide-binding domains { 93.38
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} 98.86
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 2336] 98.18
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Helicase of the SNF2/Rad54 hamily
species: Sulfolobus solfataricus [TaxId: 2287]
Probab=100.00  E-value=2.1e-42  Score=251.66  Aligned_cols=191  Identities=18%  Similarity=0.225  Sum_probs=160.8

Q ss_pred             HHHHHHHHHHHHHHCCCCEE--HHHHHHHHHHHHHHCCCCHHCCCCCCCCCCCHHHHHHHHHHHHHC--CCCCEEEHHHH
Q ss_conf             35899999999973578320--999999999998860770003445654205723433499998614--89971105789
Q gi|254780130|r    2 KQYHKFQRELYCDLQGENIE--AFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKA--NAAPIIVAYHF   77 (205)
Q Consensus         2 k~Y~~l~~~~~~~~~~~~i~--a~~~~~~~~kL~Ql~~g~~~~d~~~~~~~~~~~Kl~~l~~ii~~~--~~~kviVf~~f   77 (205)
                      +.|+++.++....++.....  ..+.++.+++|+|+|+||...++.. .....++|++++.+++.+.  +|+||||||+|
T Consensus        16 ~~Y~~~~~~~~~~~~~~~~~~~~~~iL~~l~~Lrqic~hP~l~~~~~-~~~~~S~K~~~l~~~l~~~~~~g~kviIFs~~   94 (244)
T d1z5za1          16 AMYKAEVENLFNNIDSVTGIKRKGMILSTLLKLKQIVDHPALLKGGE-QSVRRSGKMIRTMEIIEEALDEGDKIAIFTQF   94 (244)
T ss_dssp             HHHHHHHHHHHHHTTTCCHHHHHHHHHHHHHHHHHHTTCTHHHHCSC-CCSTTCHHHHHHHHHHHHHHHTTCCEEEEESC
T ss_pred             HHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCC-CCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEC
T ss_conf             99999999999987611240027899999999876522875212333-10212068999999887641466625999601


Q ss_pred             HHHHHHHHHHH-----------HCCCCHHHHHHHHHHHHCC-CCCEEEECHHHHHHHHHHHHHCCEEEEECCCCCHHHHH
Q ss_conf             99999987653-----------0477823489999997278-98699972144323322432067589726899988802
Q gi|254780130|r   78 NSDLARLQKAF-----------PQGRTLDKDPCTIQEWNEG-KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQ  145 (205)
Q Consensus        78 ~~~l~~l~~~~-----------~~~~~~~~r~~~i~~f~~~-~~~Vll~~~~a~g~GlnL~~a~~~vI~~~~~~n~~~~~  145 (205)
                      ...++.|...+           .|+.+.+.|+.+++.|+++ +.+|+++++++||+|+|||. |+++||+|++|||..+.
T Consensus        95 ~~~~~~l~~~l~~~~~~~~~~i~G~~~~~~R~~~i~~F~~~~~~~vll~~~~~~g~Glnl~~-a~~vi~~~~~wn~~~~~  173 (244)
T d1z5za1          95 VDMGKIIRNIIEKELNTEVPFLYGELSKKERDDIISKFQNNPSVKFIVLSVKAGGFGINLTS-ANRVIHFDRWWNPAVED  173 (244)
T ss_dssp             HHHHHHHHHHHHHHHCSCCCEECTTSCHHHHHHHHHHHHHCTTCCEEEEECCTTCCCCCCTT-CSEEEECSCCSCTTTC-
T ss_pred             EEHHHHHHHHHHHHCCCEEEEEECCCCHHCCCHHHHHHHCCCCCHHCCCCCCCCCCCCCCCH-HHHHHHCCCHHHHHHHH
T ss_conf             00677899998761351289996664200011045544301210010143112356621120-01432047124467776


Q ss_pred             HHHHHHHHHHHHCCCCCCCEEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             255557666542026577539999983889589999999999999999999998
Q gi|254780130|r  146 QMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK  199 (205)
Q Consensus       146 Qa~~Ri~~~r~hR~GQ~~~v~v~~l~~~~tiEe~i~~~l~~K~~~~~~~l~~~~  199 (205)
                      ||++|+     ||+||+++|+||+|+++||+|+.|++++..|..+++.+++..+
T Consensus       174 Qa~~R~-----~R~Gq~~~v~i~~l~~~~Tiee~i~~~~~~K~~~~~~~~~~~~  222 (244)
T d1z5za1         174 QATDRV-----YRIGQTRNVIVHKLISVGTLEEKIDQLLAFKRSLFKDIISSGD  222 (244)
T ss_dssp             ------------------CCEEEEEEETTSHHHHHHHHHHHCHHHHTTGGGGTT
T ss_pred             HHCCEE-----EECCCCCCEEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHCCH
T ss_conf             542501-----5649997259999861899999999999999999999871873



>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure