254780132

254780132

guanylate kinase

GeneID in NCBI database:8209107Locus tag:CLIBASIA_00055
Protein GI in NCBI database:254780132Protein Accession:YP_003064545.1
Gene range:+(7803, 8363)Protein Length:186aa
Gene description:guanylate kinase
COG prediction:[F] Guanylate kinase
KEGG prediction:gmk; guanylate kinase (EC:2.7.4.8)
SEED prediction:Guanylate kinase (EC 2.7.4.8)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Purine conversions
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180------
MAHIFVLIGASGVGKTTIAKQVVLNSEYLVMPVGVTTRRPRVDEKQYIDYRFISQSQFKGWKHTGLFIETTKVRDEYYGYLKEDINNPMEHGYDILLILTHQGLAPLKKLYEDQVTSIFIAPPSEAELIQRRIKRREDIPFNLDPDLFGKNHSYSFTIVNNHLPTACRQVGLIREFVKRGKKANYD
ccEEEEEEccccccHHHHHHHHHHccccEEEEEEEcccccccccccccccccccHHHHHHHHHccccEEEHHHccccccccHHHHHHHHHccccEEEEccHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHcccccHHHHHHHHHHHHHHccEEEEcccHHHHHHHHHHHHHHHHHHcccccc
ccEEEEEEccccccHHHHHHHHHHccccEEEEcEEEcccccccccEcccEEEccHHHHHHHHHcccEEEEEEEccEEEEEEHHHHHHHHHHccEEEEEccHHHHHHHHccHHHccEEEEEEcccHHHHHHHHHccccccHHHHHHHHHHHHHHccEEEEcccHHHHHHHHHHHHHHHHHHHHcccc
MAHIFVLIgasgvgktTIAKQVVLNseylvmpvgvttrrprvdekqyidYRFIsqsqfkgwkhtglfietTKVRDEYYGYLkedinnpmehgYDILLILTHQGLAPLKKLYEDQVTSIFIAPPSEAELIQRRIKRredipfnldpdlfgknhsySFTIVnnhlptacRQVGLIREFVKrgkkanyd
MAHIFVLigasgvgkttIAKQVvlnseylvmpvgvttrrprvdekqyIDYRFisqsqfkgwkhtglfiettKVRDEYYGYLKEDINNPMEHGYDILLILTHQGLAPLKKLYEDQVTSIFIAPPSEAELIQRRIKRREDIPFNLDPDLFGKNHSYSFTIVNNHlptacrqvglirefvkrgkkanyd
MAHIFVLIGASGVGKTTIAKQVVLNSEYLVMPVGVTTRRPRVDEKQYIDYRFISQSQFKGWKHTGLFIETTKVRDEYYGYLKEDINNPMEHGYDILLILTHQGLAPLKKLYEDQVTSIFIAPPSEAELIQRRIKRREDIPFNLDPDLFGKNHSYSFTIVNNHLPTACRQVGLIREFVKRGKKANYD
MAHIFVLIGASGVGKTTIAKQVVLNSEYLVMPVGVTTRRPRVDEKQYIDYRFISQSQFKGWKHTGLFIETTKVRDEYYGYLKEDINNPMEHGYDILLILTHQGLAPLKKLYEDQVTSIFIAPPSEAELIQRRIKRREDIPFNLDPDLFGKNHSYSFTIVNNHLPTACRQVGLIREFVKRGK*****
MAHIFVLIGASGVGKTTIAKQVVLNSEYLVMPVGVTTRRPRVDEKQYIDYRFISQSQFKGWKHTGLFIETTKVRDEYYGYLKEDINNPMEHGYDILLILTHQGLAPLKKLYEDQVTSIFIAPPSEAELIQRRIKRREDIPFNLDPDLFGKNHSYSFTIVNNHLPTACRQVGLIREFVK********
MAHIFVLIGASGVGKTTIAKQVVLNSEYLVMPVGVTTRRPRVDEKQYIDYRFISQSQFKGWKHTGLFIETTKVRDEYYGYLKEDINNPMEHGYDILLILTHQGLAPLKKLYEDQVTSIFIAPPSEAELIQRRIKRREDIPFNLDPDLFGKNHSYSFTIVNNHLPTACRQVGLIREFVKRGK*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
hhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAHIFVLIGASGVGKTTIAKQVVLNSEYLVMPVGVTTRRPRVDEKQYIDYRFISQSQFKGWKHTGLFIETTKVRDEYYGYLKEDINNPMEHGYDILLILTHQGLAPLKKLYEDQVTSIFIAPPSEAELIQRRIKRREDIPFNLDPDLFGKNHSYSFTIVNNHLPTACRQVGLIREFVKRGKKANYD
MAHIFVLIGASGVGKTTIAKQVVLNSEYLVMPVGVTTRRPRVDEKQYIDYRFISQSQFKGWKHTGLFIETTKVRDEYYGYLKEDINNPMEHGYDILLILTHQGLAPLKKLYEDQVTSIFIAPPSEAELIQRRIKRREDIPFNLDPDLFGKNHSYSFTIVNNHLPTACRQVGLIREFVKRGKKANYD
MAHIFVLIGASGVGKTTIAKQVVLNSEYLVMPVGVTTRRPRVDEKQYIDYRFISQSQFKGWKHTGLFIETTKVRDEYYGYLKEDINNPMEHGYDILLILTHQGLAPLKKLYEDQVTSIFIAPPSEAELIQRRIKRREDIPFNLDPDLFGKNHSYSFTIVNNHLPTACRQVGLIREFVKRGKKANYD

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

Original result of BLAST against C. L. asiaticus genome

IdentityAlignment graphLength Definition E-value
Target186 guanylate kinase [Candidatus Liberibacter asiaticus str
254781197185 guanylate kinase [Candidatus Liberibacter asiaticu 1e-103
255764507222 guanylate kinase [Candidatus Liberibacter asiaticu 5e-18
>gi|254781197|ref|YP_003065610.1| guanylate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 185 Back     alignment 
 Score =  366 bits (939), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 175/181 (96%), Positives = 178/181 (98%)

Query: 1   MAHIFVLIGASGVGKTTIAKQVVLNSEYLVMPVGVTTRRPRVDEKQYIDYRFISQSQFKG 60
           MAHIFVLIGASGVG+TTIAKQVVLNSEYLVMPVGVTTRRPRVDEKQYIDYRFISQSQFKG
Sbjct: 1   MAHIFVLIGASGVGETTIAKQVVLNSEYLVMPVGVTTRRPRVDEKQYIDYRFISQSQFKG 60

Query: 61  WKHTGLFIETTKVRDEYYGYLKEDINNPMEHGYDILLILTHQGLAPLKKLYEDQVTSIFI 120
           WKHTGLFIETTKVRDEYYGYLKEDINNPMEHGYDILLILTHQGLAPLKKLYEDQVTSIFI
Sbjct: 61  WKHTGLFIETTKVRDEYYGYLKEDINNPMEHGYDILLILTHQGLAPLKKLYEDQVTSIFI 120

Query: 121 APPSEAELIQRRIKRREDIPFNLDPDLFGKNHSYSFTIVNNHLPTACRQVGLIREFVKRG 180
           APPSEAELIQRRIKRRED PFNLDPDLFGKNHSYSFTIVNNHLPTACRQVG IREFVK+ 
Sbjct: 121 APPSEAELIQRRIKRREDTPFNLDPDLFGKNHSYSFTIVNNHLPTACRQVGFIREFVKQH 180

Query: 181 K 181
           +
Sbjct: 181 R 181
>gi|255764507|ref|YP_003065323.2| guanylate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 222 Back     alignment 
 Score = 82.0 bits (201), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 46/128 (35%), Positives = 66/128 (51%)

Query: 4   IFVLIGASGVGKTTIAKQVVLNSEYLVMPVGVTTRRPRVDEKQYIDYRFISQSQFKGWKH 63
           + ++   SGVGK+TIA+ ++   +   M + VTTR  R +E    DY F+S S+F   K 
Sbjct: 17  MLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVDGKDYYFLSLSRFNELKK 76

Query: 64  TGLFIETTKVRDEYYGYLKEDINNPMEHGYDILLILTHQGLAPLKKLYEDQVTSIFIAPP 123
              FIE  +V   +YG L++ I   +  G D+L  +  QG   L K     V S FI PP
Sbjct: 77  ANAFIEKAEVHGNFYGTLRDPIEETISKGKDMLFDIDWQGAQNLHKQMGSNVLSFFILPP 136

Query: 124 SEAELIQR 131
           +  EL  R
Sbjct: 137 TMQELCSR 144

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

Original result of PSI-BLAST first 2 iterations

IdentityAlignment graphLength Definition Round E-value
Target186 guanylate kinase [Candidatus Liberibacter asiaticus str
317120702185 guanylate kinase [Liberibacter phage SC1] Length = 185 1 1e-100
254781197185 guanylate kinase [Candidatus Liberibacter asiaticus str 1 1e-100
317120745190 guanylate kinase [Liberibacter phage SC2] Length = 190 1 3e-49
315121971144 guanylate kinase [Candidatus Liberibacter solanacearum 1 6e-34
295111668186 guanylate kinase [Synergistetes bacterium SGP1] Length 1 1e-20
148652389204 guanylate kinase [Psychrobacter sp. PRwf-1] Length = 20 1 3e-20
163782716215 guanylate kinase [Hydrogenivirga sp. 128-5-R1-1] Length 1 7e-20
294102074185 guanylate kinase [Aminobacterium colombiense DSM 12261] 1 1e-19
330813910209 guanylate kinase [Candidatus Pelagibacter sp. IMCC9063] 1 5e-19
330723927192 Guanylate kinase Gmk [Mycoplasma hyorhinis MCLD] Length 1 7e-19
>gi|317120702|gb|ADV02525.1| guanylate kinase [Liberibacter phage SC1] Length = 185 Back     alignment and organism information
 Score =  367 bits (943), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 176/181 (97%), Positives = 178/181 (98%)

Query: 1   MAHIFVLIGASGVGKTTIAKQVVLNSEYLVMPVGVTTRRPRVDEKQYIDYRFISQSQFKG 60
           MAHIFVLIGASGVGKTTIAKQVVLNSEYLVMPVGVTTRRPRVDEKQYIDYRFISQSQFKG
Sbjct: 1   MAHIFVLIGASGVGKTTIAKQVVLNSEYLVMPVGVTTRRPRVDEKQYIDYRFISQSQFKG 60

Query: 61  WKHTGLFIETTKVRDEYYGYLKEDINNPMEHGYDILLILTHQGLAPLKKLYEDQVTSIFI 120
           WKHTGLFIETTKVRDEYYGYLKEDINNPMEHGYDILLILTHQGLAPLKKLYEDQVTSIFI
Sbjct: 61  WKHTGLFIETTKVRDEYYGYLKEDINNPMEHGYDILLILTHQGLAPLKKLYEDQVTSIFI 120

Query: 121 APPSEAELIQRRIKRREDIPFNLDPDLFGKNHSYSFTIVNNHLPTACRQVGLIREFVKRG 180
           APPSEAELIQRRIKRRED PFNLDPDLFGKNHSYSFTIVNNHLPTACRQVG IREFVK+ 
Sbjct: 121 APPSEAELIQRRIKRREDTPFNLDPDLFGKNHSYSFTIVNNHLPTACRQVGFIREFVKQH 180

Query: 181 K 181
           +
Sbjct: 181 R 181



Species: Liberibacter phage SC1
Genus: 
Family: Podoviridae
Order: Caudovirales
Class: 
Phylum: 
Superkingdom: Viruses
>gi|254781197|ref|YP_003065610.1| guanylate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 185 Back     alignment and organism information
>gi|317120745|gb|ADV02567.1| guanylate kinase [Liberibacter phage SC2] Length = 190 Back     alignment and organism information
>gi|315121971|ref|YP_004062460.1| guanylate kinase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 144 Back     alignment and organism information
>gi|295111668|emb|CBL28418.1| guanylate kinase [Synergistetes bacterium SGP1] Length = 186 Back     alignment and organism information
>gi|148652389|ref|YP_001279482.1| guanylate kinase [Psychrobacter sp. PRwf-1] Length = 204 Back     alignment and organism information
>gi|163782716|ref|ZP_02177712.1| guanylate kinase [Hydrogenivirga sp. 128-5-R1-1] Length = 215 Back     alignment and organism information
>gi|294102074|ref|YP_003553932.1| guanylate kinase [Aminobacterium colombiense DSM 12261] Length = 185 Back     alignment and organism information
>gi|330813910|ref|YP_004358149.1| guanylate kinase [Candidatus Pelagibacter sp. IMCC9063] Length = 209 Back     alignment and organism information
>gi|330723927|gb|AEC46297.1| Guanylate kinase Gmk [Mycoplasma hyorhinis MCLD] Length = 192 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Original result of RPS-BLASTagainst CDD database part II

IdentityAlignment graphLength Definition E-value
Target186 guanylate kinase [Candidatus Liberibacter asiaticus str
TIGR03263180 TIGR03263, guanyl_kin, guanylate kinase 3e-26
PRK00300205 PRK00300, gmk, guanylate kinase; Provisional 7e-25
smart00072184 smart00072, GuKc, Guanylate kinase homologues 1e-20
pfam00625182 pfam00625, Guanylate_kin, Guanylate kinase 2e-17
PRK14738206 PRK14738, gmk, guanylate kinase; Provisional 3e-16
PRK14737186 PRK14737, gmk, guanylate kinase; Provisional 8e-16
KOG0609542 KOG0609, KOG0609, KOG0609, Calcium/calmodulin-dependent 1e-14
COG0194191 COG0194, Gmk, Guanylate kinase [Nucleotide transport an 1e-25
cd00071137 cd00071, GMPK, Guanosine monophosphate kinase (GMPK, EC 5e-20
KOG0707231 KOG0707, KOG0707, KOG0707, Guanylate kinase [Nucleotide 3e-07
PLN02772398 PLN02772, PLN02772, guanylate kinase 4e-07
>gnl|CDD|132307 TIGR03263, guanyl_kin, guanylate kinase Back     alignment and domain information
>gnl|CDD|178968 PRK00300, gmk, guanylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|128386 smart00072, GuKc, Guanylate kinase homologues Back     alignment and domain information
>gnl|CDD|144280 pfam00625, Guanylate_kin, Guanylate kinase Back     alignment and domain information
>gnl|CDD|184809 PRK14738, gmk, guanylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|173199 PRK14737, gmk, guanylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|35829 KOG0609, KOG0609, KOG0609, Calcium/calmodulin-dependent serine protein kinase/membrane-associated guanylate kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|30543 COG0194, Gmk, Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|73180 cd00071, GMPK, Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>gnl|CDD|35926 KOG0707, KOG0707, KOG0707, Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|178371 PLN02772, PLN02772, guanylate kinase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

Original result of HHsearch against CDD database

IdentityAlignment graphLength Definition Probability
Target 186 guanylate kinase [Candidatus Liberibacter asiaticus str
PRK00300208 gmk guanylate kinase; Provisional 100.0
COG0194191 Gmk Guanylate kinase [Nucleotide transport and metaboli 100.0
TIGR03263180 guanyl_kin guanylate kinase. Members of this family are 100.0
pfam00625182 Guanylate_kin Guanylate kinase. 100.0
smart00072184 GuKc Guanylate kinase homologues. Active enzymes cataly 100.0
PRK10078184 ribose 1,5-bisphosphokinase; Provisional 100.0
KOG0609542 consensus 100.0
KOG0707231 consensus 100.0
TIGR02322183 phosphon_PhnN phosphonate metabolism protein/1,5-bispho 99.97
COG3709192 Uncharacterized component of phosphonate metabolism [In 99.94
KOG0708359 consensus 99.76
PRK08356195 hypothetical protein; Provisional 98.86
PRK11545177 gntK gluconate kinase 1; Provisional 98.86
PRK09825176 idnK D-gluconate kinase; Provisional 98.75
PRK08233182 hypothetical protein; Provisional 98.7
PRK02496185 adk adenylate kinase; Provisional 98.66
pfam07931174 CPT Chloramphenicol phosphotransferase-like protein. Th 98.63
PRK12339197 2-phosphoglycerate kinase; Provisional 98.63
PRK05480209 uridine kinase; Provisional 98.59
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), 98.58
PRK06696227 uridine kinase; Validated 98.56
PRK01184183 hypothetical protein; Provisional 98.55
PRK04182178 cytidylate kinase; Provisional 98.47
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). Cm-i 98.46
TIGR01359189 UMP_CMP_kin_fam UMP-CMP kinase family; InterPro: IPR006 98.46
PRK00131175 aroK shikimate kinase; Reviewed 98.46
PRK04220306 2-phosphoglycerate kinase; Provisional 98.42
PRK00279215 adk adenylate kinase; Reviewed 98.4
PRK03839180 putative kinase; Provisional 98.39
TIGR01313175 therm_gnt_kin carbohydrate kinase, thermoresistant gluc 98.37
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and metabo 98.33
COG1936180 Predicted nucleotide kinase (related to CMP and AMP kin 98.33
COG0563178 Adk Adenylate kinase and related kinases [Nucleotide tr 98.27
PRK13947171 shikimate kinase; Provisional 98.27
PRK13974212 thymidylate kinase; Provisional 98.24
KOG3354191 consensus 98.22
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport and m 98.21
PRK03731172 aroL shikimate kinase II; Reviewed 98.18
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members 98.16
PRK05541176 adenylylsulfate kinase; Provisional 98.16
PRK00625173 shikimate kinase; Provisional 98.09
PRK00889175 adenylylsulfate kinase; Provisional 98.08
PRK13946195 shikimate kinase; Provisional 98.01
PRK05057172 aroK shikimate kinase I; Reviewed 98.01
PRK03846198 adenylylsulfate kinase; Provisional 98.01
PRK04040189 adenylate kinase; Provisional 97.96
PRK08154304 anaerobic benzoate catabolism transcriptional regulator 97.85
KOG3079195 consensus 97.75
TIGR00235220 udk uridine kinase; InterPro: IPR000764 Uridine kinase 97.65
PRK13973216 thymidylate kinase; Provisional 97.6
COG0703172 AroK Shikimate kinase [Amino acid transport and metabol 97.57
PRK12338 320 hypothetical protein; Provisional 97.56
KOG3347176 consensus 97.56
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 97.53
PRK12337492 2-phosphoglycerate kinase; Provisional 97.51
PRK13808297 adenylate kinase; Provisional 97.48
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transport an 97.39
COG3265161 GntK Gluconate kinase [Carbohydrate transport and metab 97.33
TIGR01360191 aden_kin_iso1 adenylate kinase; InterPro: IPR006267 Mem 97.25
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 96.94
KOG3220225 consensus 96.83
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-binding 96.53
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified in ca 96.52
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 is ma 96.36
PRK05506613 bifunctional sulfate adenylyltransferase subunit 1/aden 96.31
COG0645170 Predicted kinase [General function prediction only] 96.2
PRK05416 292 hypothetical protein; Provisional 96.05
pfam03668 284 ATP_bind_2 P-loop ATPase protein family. This family co 95.97
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), 100.0
PTZ00301210 uridine kinase; Provisional 98.63
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phosphoryl t 98.51
TIGR02173173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR 98.41
pfam00485196 PRK Phosphoribulokinase / Uridine kinase family. In Ara 98.35
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_like) 98.35
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and metabol 98.3
COG0572218 Udk Uridine kinase [Nucleotide transport and metabolism 98.22
PRK07667190 uridine kinase; Provisional 98.02
COG4088261 Predicted nucleotide kinase [Nucleotide transport and m 97.92
PRK07429 331 phosphoribulokinase; Provisional 97.92
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversible pho 97.91
PRK06547184 hypothetical protein; Provisional 97.86
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involved in 97.8
PRK04195 403 replication factor C large subunit; Provisional 97.76
KOG1384 348 consensus 97.75
pfam00406186 ADK Adenylate kinase. 97.73
TIGR00455187 apsK adenylylsulfate kinase; InterPro: IPR002891 Enzyme 97.68
TIGR00041211 DTMP_kinase thymidylate kinase; InterPro: IPR000062 Thy 97.66
pfam08433266 KTI12 Chromatin associated protein KTI12. This is a fam 97.43
KOG1969 877 consensus 97.4
pfam06414191 Zeta_toxin Zeta toxin. This family consists of several 97.28
COG4639168 Predicted kinase [General function prediction only] 97.22
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 97.03
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 96.85
COG0529197 CysC Adenylylsulfate kinase and related kinases [Inorga 96.73
pfam03976229 PPK2 Polyphosphate kinase 2 (PPK2). Inorganic polyphosp 96.65
TIGR02533495 type_II_gspE general secretory pathway protein E; Inter 96.51
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucleotide 96.38
PRK09435325 arginine/ornithine transport system ATPase; Provisional 96.37
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 96.1
TIGR02528144 EutP ethanolamine utilization protein, EutP; InterPro: 95.95
PRK00091 304 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 98.41
PRK00698204 tmk thymidylate kinase; Validated 98.35
PRK13975198 thymidylate kinase; Provisional 98.22
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme in 98.05
TIGR00955 671 3a01204 Pigment precourser permease; InterPro: IPR00528 97.94
PRK13949169 shikimate kinase; Provisional 97.82
PRK10522547 multidrug transporter membrane component/ATP-binding co 97.81
pfam02223186 Thymidylate_kin Thymidylate kinase. 97.8
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 97.79
TIGR01846703 type_I_sec_HlyB type I secretion system ATPase; InterPr 97.78
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 97.78
TIGR02315253 ABC_phnC phosphonate ABC transporter, ATP-binding prote 97.77
PTZ00088225 adenylate kinase 1; Provisional 97.76
COG0324 308 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase 97.75
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 97.72
TIGR02203603 MsbA_lipidA lipid A export permease/ATP-binding protein 97.71
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, DevA 97.71
TIGR01186 372 proV glycine betaine/L-proline transport ATP binding su 97.68
PRK13948182 shikimate kinase; Provisional 97.68
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also known 97.67
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the 97.64
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 97.64
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 97.58
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 97.57
TIGR01842556 type_I_sec_PrtD type I secretion system ATPase; InterPr 97.56
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 97.55
TIGR02857570 CydD ABC transporter, CydDC cysteine exporter (CydDC-E) 97.54
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 97.54
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 97.54
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 97.53
PRK08118167 topology modulation protein; Reviewed 97.53
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in the shi 97.52
COG1136226 SalX ABC-type antimicrobial peptide transport system, A 97.5
PRK06761281 hypothetical protein; Provisional 97.49
cd03246173 ABCC_Protease_Secretion This family represents the ABC 97.48
TIGR00968241 3a0106s01 sulfate ABC transporter, ATP-binding protein; 97.47
cd03258233 ABC_MetN_methionine_transporter MetN (also known as Yus 97.47
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 97.46
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 97.45
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 97.45
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 97.44
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 97.41
PRK10751170 molybdopterin-guanine dinucleotide biosynthesis protein 97.41
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein; Int 97.38
PRK10419266 nikE nickel transporter ATP-binding protein; Provisiona 97.38
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the glycine 97.36
COG4988559 CydD ABC-type transport system involved in cytochrome b 97.34
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transport s 97.33
PRK13976202 thymidylate kinase; Provisional 97.33
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 97.29
PRK11701258 phnK phosphonates transport ATP-binding protein; Provis 97.28
TIGR00017223 cmk cytidylate kinase; InterPro: IPR003136 This family 97.28
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) is a 97.24
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein foun 97.23
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 97.22
PRK13542224 consensus 97.22
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthesis pr 97.21
PRK11153 343 metN DL-methionine transporter ATP-binding subunit; Pro 97.2
KOG0061 613 consensus 97.19
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, contai 97.17
COG3842 352 PotA ABC-type spermidine/putrescine transport systems, 97.15
COG3840231 ThiQ ABC-type thiamine transport system, ATPase compone 97.15
TIGR01351232 adk adenylate kinases; InterPro: IPR006259 Most members 97.14
COG4619223 ABC-type uncharacterized transport system, ATPase compo 97.14
cd03216163 ABC_Carb_Monos_I This family represents the domain I of 97.11
TIGR02868566 CydC ABC transporter, CydDC cysteine exporter (CydDC-E) 97.06
PRK11308 327 dppF dipeptide transporter ATP-binding subunit; Provisi 97.06
COG1127263 Ttg2A ABC-type transport system involved in resistance 97.02
PRK05342 411 clpX ATP-dependent protease ATP-binding subunit ClpX; P 97.02
cd01894157 EngA1 EngA1 subfamily. This CD represents the first GTP 96.98
TIGR01978248 sufC FeS assembly ATPase SufC; InterPro: IPR010230 Iron 96.98
PRK11022 327 dppD dipeptide transporter ATP-binding subunit; Provisi 96.97
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein present in 96.93
TIGR01187 331 potA polyamine ABC transporter, ATP-binding protein; In 96.93
KOG2004 906 consensus 96.92
cd01895174 EngA2 EngA2 subfamily. This CD represents the second GT 96.91
TIGR02788328 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR 96.89
PRK09087226 hypothetical protein; Validated 96.86
PRK09473 330 oppD oligopeptide transporter ATP-binding component; Pr 96.84
PRK05291445 trmE tRNA modification GTPase TrmE; Reviewed 96.81
cd01896233 DRG The developmentally regulated GTP-binding protein ( 96.8
PRK00089 296 era GTP-binding protein Era; Reviewed 96.78
COG4618580 ArpD ABC-type protease/lipase transport system, ATPase 96.76
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamily of 96.76
PRK13851343 type IV secretion system protein VirB11; Provisional 96.75
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This fami 96.73
COG1618179 Predicted nucleotide kinase [Nucleotide transport and m 96.71
) of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 from SWISSPROT) and Drosophila melanogaster (Fruit fly) Cinnamon (P39205 from SWISSPROT) . The MobB domain is similar to that of the urease accessory protein UreG and the hydrogenase accessory protein HypB, both GTP hydrolases involved in loading nickel into the metallocentres of their respective target enzymes. It is involved in the final step of molybdenum-cofactor biosynthesis. While its precise function has not been identified it is thought to be involved in the transfer of a guanine dinucleotide moiety to molybdopterin, as it shows GTP-binding and weak GTPase activity . The MobB protein (P32125 from SWISSPROT) from Escherichia coli, which is comprised of this domain, is a homodimer . Each molecule is composed of two distinct regions - an outer region comprised of 6 beta-strands and three alpha helices, and an inner region comprised of a two-strand beta hairpin followed by an alpha helix. These regions require interaction with the second monomer to allow proper folding to occur. The two monomers are intertwined and form an extensive 16-stranded beta-sheet. While the active site could not be positively identified, the presence of highly conserved residues suggests the substrate binding site occurs in the central solvent channel.; GO: 0005525 GTP binding, 0006777 Mo-molybdopterin cofactor biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00176">TIGR00176165 mobB molybdopterin-guanine dinucleotide biosynthesis pr 96.71
PRK13900332 type IV secretion system ATPase VirB11; Provisional 96.7
pfam03266168 DUF265 Protein of unknown function, DUF265. 96.69
PRK00093438 engA GTP-binding protein EngA; Reviewed 96.67
cd01878204 HflX HflX subfamily. A distinct conserved domain with a 96.67
COG1118 345 CysA ABC-type sulfate/molybdate transport systems, ATPa 96.66
TIGR02770239 nickel_nikD nickel import ATP-binding protein NikD; Int 96.66
pfam03215 490 Rad17 Rad17 cell cycle checkpoint protein. 96.64
PRK13342 417 recombination factor protein RarA; Reviewed 96.63
PRK13341 726 recombination factor protein RarA/unknown domain fusion 96.62
PTZ00243 1560 ABC transporter; Provisional 96.61
pfam02421188 FeoB_N Ferrous iron transport protein B. Escherichia co 96.58
PRK13695174 putative NTPase; Provisional 96.54
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protein Ysx 96.54
cd01898170 Obg Obg subfamily. The Obg nucleotide binding protein s 96.52
cd03116159 MobB Molybdenum is an essential trace element in the fo 96.51
KOG1191531 consensus 96.43
COG0486454 ThdF Predicted GTPase [General function prediction only 96.43
PRK09183258 transposase/IS protein; Provisional 96.43
COG4107258 PhnK ABC-type phosphonate transport system, ATPase comp 96.42
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 96.41
PRK00093 438 engA GTP-binding protein EngA; Reviewed 96.38
PRK00454196 engB GTPase EngB; Reviewed 96.36
TIGR00956 1466 3a01205 Pleiotropic Drug Resistance (PDR) Family protei 96.3
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK 96.26
TIGR02782315 TrbB_P P-type conjugative transfer ATPase TrbB; InterPr 96.26
PRK04213195 GTP-binding protein; Provisional 96.23
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK 96.22
TIGR00929 931 VirB4_CagE type IV secretion/conjugal transfer ATPase, 96.19
PRK08181269 transposase; Validated 96.19
cd01881176 Obg_like The Obg-like subfamily consists of five well-d 96.17
cd01859156 MJ1464 MJ1464. This family represents archaeal GTPase t 96.17
PRK06526254 transposase; Provisional 96.13
pfam09439181 SRPRB Signal recognition particle receptor beta subunit 96.1
PRK13764 605 ATPase; Provisional 96.06
PRK12377248 putative replication protein; Provisional 96.04
PRK05201 442 hslU ATP-dependent protease ATP-binding subunit; Provis 96.03
cd04105203 SR_beta Signal recognition particle receptor, beta subu 96.0
PRK13409 590 putative ATPase RIL; Provisional 96.0
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 95.96
TIGR00635305 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR 95.9
PRK09270230 frcK putative fructose transport system kinase; Reviewe 98.28
PRK06762166 hypothetical protein; Provisional 98.06
PRK00023225 cmk cytidylate kinase; Provisional 97.99
PRK12289351 ribosome-associated GTPase; Reviewed 97.94
pfam03193161 DUF258 Protein of unknown function, DUF258. 97.78
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein PhnL; 97.77
TIGR02673215 FtsE cell division ATP-binding protein FtsE; InterPro: 97.73
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtilis) r 97.73
PRK01889353 ribosome-associated GTPase; Reviewed 97.69
COG1126240 GlnQ ABC-type polar amino acid transport system, ATPase 97.61
COG1162301 Predicted GTPases [General function prediction only] 97.55
PRK11860662 bifunctional 3-phosphoshikimate 1-carboxyvinyltransfera 97.55
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-binding pro 97.5
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-bindi 97.47
PRK10070 400 glycine betaine transporter ATP-binding subunit; Provis 97.46
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is of f 97.45
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 97.43
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IISP) Fa 97.42
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 97.41
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 97.39
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 97.39
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.39
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 97.38
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 97.38
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 97.37
PRK11831269 putative ABC transporter ATP-binding protein YrbF; Prov 97.37
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 97.36
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 97.36
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 97.34
PRK10771233 thiQ thiamine transporter ATP-binding subunit; Provisio 97.34
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-associate 97.33
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 97.33
PRK10851 352 sulfate/thiosulfate transporter subunit; Provisional 97.33
cd03271261 ABC_UvrA_II The excision repair protein UvrA domain II; 97.32
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 97.32
COG3839 338 MalK ABC-type sugar transport systems, ATPase component 97.32
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 97.3
cd03234226 ABCG_White The White subfamily represents ABC transport 97.3
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 97.3
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding com 97.29
PRK00098298 ribosome-associated GTPase; Reviewed 97.29
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-type tra 97.29
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 97.28
PRK11264248 putative amino-acid ABC transporter ATP-binding protein 97.27
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 97.27
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 97.27
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; Provi 97.27
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.25
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 97.25
PRK09580248 sufC cysteine desulfurase ATPase component; Reviewed 97.25
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 97.24
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 97.24
TIGR00630 956 uvra excinuclease ABC, A subunit; InterPro: IPR004602 A 97.24
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 97.24
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 97.24
COG1428216 Deoxynucleoside kinases [Nucleotide transport and metab 97.23
PRK11000 369 maltose/maltodextrin transporter ATP-binding protein; P 97.23
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 97.22
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 97.21
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 97.21
PRK12288344 ribosome-associated GTPase; Reviewed 97.21
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provisiona 97.21
PRK13634276 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.2
PRK11650 358 ugpC glycerol-3-phosphate transporter ATP-binding subun 97.2
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 97.2
cd03235213 ABC_Metallic_Cations ABC component of the metal-type tr 97.19
PRK13547273 hmuV hemin importer ATP-binding subunit; Provisional 97.19
PRK09452 378 potA putrescine/spermidine ABC transporter ATPase prote 97.18
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, ATP- 97.18
PRK10744257 phosphate transporter subunit; Provisional 97.18
PRK11124242 artP arginine transporter ATP-binding subunit; Provisio 97.18
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein; Rev 97.17
PRK10619257 histidine/lysine/arginine/ornithine transporter subunit 97.17
PRK09984262 phosphonate/organophosphate ester transporter subunit; 97.17
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNa 97.17
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding subunit 97.16
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) i 97.16
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.16
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.16
PRK13548257 hmuV hemin importer ATP-binding subunit; Provisional 97.15
PRK13544208 consensus 97.15
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phos 97.15
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; Provi 97.14
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pigment 97.14
cd03217200 ABC_FeS_Assembly ABC-type transport system involved in 97.14
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 97.14
PRK09536 409 btuD corrinoid ABC transporter ATPase; Reviewed 97.13
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.13
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transport sy 97.12
PRK13633281 cobalt transporter ATP-binding subunit; Provisional 97.11
PRK10908222 cell division protein FtsE; Provisional 97.11
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.11
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-like (P 97.1
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 97.1
PRK12269 863 bifunctional cytidylate kinase/ribosomal protein S1; Pr 97.1
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 97.1
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleotide e 97.09
PRK10418254 nikD nickel transporter ATP-binding protein; Provisiona 97.09
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are similar to 97.08
PRK13632273 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.08
PRK13640283 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.08
PRK09700 510 D-allose transporter ATP-binding protein; Provisional 97.06
PRK11231255 fecE iron-dicitrate transporter ATP-binding subunit; Pr 97.06
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.06
PRK11607 377 potG putrescine transporter ATP-binding subunit; Provis 97.05
PRK13650276 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.05
PRK13651304 cobalt transporter ATP-binding subunit; Provisional 97.05
pfam10662143 PduV-EutP Ethanolamine utilisation - propanediol utilis 97.05
PRK13641286 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.04
PRK13647273 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.04
COG3638258 ABC-type phosphate/phosphonate transport system, ATPase 97.04
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of the L 97.03
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.03
PRK03695245 vitamin B12-transporter ATPase; Provisional 97.03
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.03
PRK11614237 livF leucine/isoleucine/valine transporter ATP-binding 97.01
PRK09544251 znuC high-affinity zinc transporter ATPase; Reviewed 97.01
PRK12402 337 replication factor C small subunit 2; Reviewed 97.0
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 97.0
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 96.99
PRK10261 623 glutathione transporter ATP-binding protein; Provisiona 96.99
PRK10895241 putative ABC transporter ATP-binding protein YhbG; Prov 96.97
PRK13768253 GTPase; Provisional 96.97
PRK10535 648 macrolide transporter ATP-binding /permease protein; Pr 96.97
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Trans 96.97
pfam01583157 APS_kinase Adenylylsulphate kinase. Enzyme that catalys 96.96
PRK13539206 cytochrome c biogenesis protein CcmA; Provisional 96.96
PRK10938 490 putative molybdenum transport ATP-binding protein ModF; 96.95
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.95
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 96.94
PRK13549 513 xylose transporter ATP-binding subunit; Provisional 96.94
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.93
PRK11300255 livG leucine/isoleucine/valine transporter ATP-binding 96.93
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 96.93
PRK11144 352 modC molybdate transporter ATP-binding protein; Provisi 96.93
PRK10246 1047 exonuclease subunit SbcC; Provisional 96.93
PRK10253265 iron-enterobactin transporter ATP-binding protein; Prov 96.92
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.92
PTZ00265 1467 multidrug resistance protein (mdr1); Provisional 96.91
PRK13636285 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.91
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.91
PRK10762 501 D-ribose transporter ATP binding protein; Provisional 96.9
COG1125309 OpuBA ABC-type proline/glycine betaine transport system 96.9
PRK00440318 rfc replication factor C small subunit; Reviewed 96.89
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the transpo 96.88
TIGR00630 956 uvra excinuclease ABC, A subunit; InterPro: IPR004602 A 96.87
PTZ002651467 multidrug resistance protein (mdr1); Provisional 96.87
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 96.86
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding prote 96.85
PRK05564 313 DNA polymerase III subunit delta'; Validated 96.84
PRK09518 714 bifunctional cytidylate kinase/GTP-binding protein; Rev 96.84
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 96.82
PRK00349 944 uvrA excinuclease ABC subunit A; Reviewed 96.81
PRK10982 491 galactose/methyl galaxtoside transporter ATP-binding pr 96.81
PRK13546264 teichoic acids export protein ATP-binding subunit; Prov 96.78
PRK06217185 hypothetical protein; Validated 96.78
PRK08058 329 DNA polymerase III subunit delta'; Validated 96.76
cd03215182 ABC_Carb_Monos_II This family represents domain II of t 96.76
COG2884223 FtsE Predicted ATPase involved in cell division [Cell d 96.76
cd03269210 ABC_putative_ATPase This subfamily is involved in drug 96.75
PRK11288 501 araG L-arabinose transporter ATP-binding protein; Provi 96.73
TIGR00618 1063 sbcc exonuclease SbcC; InterPro: IPR004592 All proteins 96.73
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily conserv 96.72
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is the 96.72
PRK11147 632 ABC transporter ATPase component; Reviewed 96.71
COG1131293 CcmA ABC-type multidrug transport system, ATPase compon 96.71
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.7
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 96.69
PRK10636 638 putative ABC transporter ATP-binding protein; Provision 96.68
TIGR00602 670 rad24 checkpoint protein rad24; InterPro: IPR004582 To 96.67
KOG0744423 consensus 96.67
cd03218232 ABC_YhbG The ABC transporters belonging to the YhbG fam 96.67
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyze 96.66
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain I; N 96.66
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transport sys 96.66
PRK11147 632 ABC transporter ATPase component; Reviewed 96.66
smart00382148 AAA ATPases associated with a variety of cellular activ 96.66
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.65
TIGR00956 1466 3a01205 Pleiotropic Drug Resistance (PDR) Family protei 96.65
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein super 96.64
PRK00635 1809 excinuclease ABC subunit A; Provisional 96.63
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Provisi 96.63
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding prote 96.6
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transport s 96.59
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 96.58
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 96.57
cd03230173 ABC_DR_subfamily_A This family of ATP-binding proteins 96.55
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporte 96.55
PRK06851 368 hypothetical protein; Provisional 96.53
COG0283222 Cmk Cytidylate kinase [Nucleotide transport and metabol 96.52
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 96.51
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter 96.49
pfam07728139 AAA_5 AAA domain (dynein-related subfamily). This Pfam 96.48
PRK11819 556 putative ABC transporter ATP-binding protein; Reviewed 96.48
COG1117253 PstB ABC-type phosphate transport system, ATPase compon 96.47
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phosphory 96.46
cd03264211 ABC_drug_resistance_like ABC-type multidrug transport s 96.45
COG1123539 ATPase components of various ABC-type transport systems 96.44
PRK10636 638 putative ABC transporter ATP-binding protein; Provision 96.43
PRK03918 882 chromosome segregation protein; Provisional 96.41
KOG0055 1228 consensus 96.41
COG0419 908 SbcC ATPase involved in DNA repair [DNA replication, re 96.41
PRK10938490 putative molybdenum transport ATP-binding protein ModF; 96.4
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily represent 96.38
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase component o 96.37
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component of a 96.33
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC transporte 96.33
PRK11819556 putative ABC transporter ATP-binding protein; Reviewed 96.32
cd03227162 ABC_Class2 ABC-type Class 2 contains systems involved i 96.31
KOG00551228 consensus 96.3
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related protein 1) 96.25
PRK13537304 lipooligosaccharide transporter ATP-binding subunit; Pr 96.23
PRK13536306 nodulation factor exporter subunit NodI; Provisional 96.21
pfam00004131 AAA ATPase family associated with various cellular acti 96.2
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 96.19
PRK10865857 protein disaggregation chaperone; Provisional 96.19
COG4778235 PhnL ABC-type phosphonate transport system, ATPase comp 96.19
PRK05707 328 DNA polymerase III subunit delta'; Validated 96.18
CHL00095823 clpC Clp protease ATP binding subunit 96.17
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 96.16
PRK00349 944 uvrA excinuclease ABC subunit A; Reviewed 96.15
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 96.14
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 96.13
COG1122235 CbiO ABC-type cobalt transport system, ATPase component 96.12
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 96.12
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 96.04
PRK10261623 glutathione transporter ATP-binding protein; Provisiona 96.01
PRK00635 1809 excinuclease ABC subunit A; Provisional 96.01
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 96.0
PRK01156 895 chromosome segregation protein; Provisional 95.99
COG4987573 CydC ABC-type transport system involved in cytochrome b 95.98
PRK13549513 xylose transporter ATP-binding subunit; Provisional 95.98
PRK13833323 conjugal transfer protein TrbB; Provisional 95.97
COG1100219 GTPase SAR1 and related small G proteins [General funct 95.97
cd03115173 SRP The signal recognition particle (SRP) mediates the 95.94
PRK11331459 5-methylcytosine-specific restriction enzyme subunit Mc 95.93
pfam00931285 NB-ARC NB-ARC domain. 95.92
PRK00081199 coaE dephospho-CoA kinase; Reviewed 98.23
pfam01121179 CoaE Dephospho-CoA kinase. This family catalyses the ph 97.16
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.24) ca 96.52
pfam01202158 SKI Shikimate kinase. 96.24
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding protein; 98.14
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 98.08
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 98.02
COG1132567 MdlB ABC-type multidrug transport system, ATPase and pe 97.94
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 97.94
TIGR00763 941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 97.93
PRK07261171 topology modulation protein; Provisional 97.89
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 97.84
PRK10789569 putative multidrug transporter membrane\ATP-binding com 97.83
TIGR01193710 bacteriocin_ABC ABC-type bacteriocin transporter; Inter 97.78
PRK10790593 putative multidrug transporter membrane\ATP-binding com 97.7
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 97.68
TIGR00958770 3a01208 antigen peptide transporter 2; InterPro: IPR005 97.6
TIGR00972248 3a0107s01c2 phosphate ABC transporter, ATP-binding prot 97.49
KOG0056790 consensus 97.47
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, LssB fa 97.4
TIGR01192592 chvA glucan exporter ATP-binding protein; InterPro: IPR 97.34
TIGR00382 452 clpX ATP-dependent Clp protease, ATP-binding subunit Cl 97.27
KOG0058716 consensus 97.26
PRK03003474 engA GTP-binding protein EngA; Reviewed 97.14
KOG0057591 consensus 96.96
TIGR00174 307 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 96.95
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Posttra 96.91
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttransla 96.72
COG1160444 Predicted GTPases [General function prediction only] 96.6
COG4175 386 ProV ABC-type proline/glycine betaine transport system, 96.52
KOG1970 634 consensus 96.47
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [Posttr 96.24
PRK09518714 bifunctional cytidylate kinase/GTP-binding protein; Rev 96.12
COG4525259 TauB ABC-type taurine transport system, ATPase componen 96.06
KOG3209 984 consensus 97.43
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>pfam00625 Guanylate_kin Guanylate kinase Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>KOG0609 consensus Back     alignment and domain information
>KOG0707 consensus Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN; InterPro: IPR012699 Members of this family resemble PhnN of phosphonate utilization operons, where different such operons confer the ability to use somewhat different profiles of C-P bond-containing compounds , including phosphites as well as phosphonates Back     alignment and domain information
>COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0708 consensus Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PRK11545 gntK gluconate kinase 1; Provisional Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>pfam07931 CPT Chloramphenicol phosphotransferase-like protein Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK05480 uridine kinase; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family; InterPro: IPR006266 This subfamily of the adenylate kinase superfamily contains examples of UMP-CMP kinase, as well as others proteins with unknown specificity, some currently designated adenylate kinase Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family; InterPro: IPR006001 This family of proteins includes thermoresistant and thermosensitve isozymes of gluconate kinase (gluconokinase) in E Back     alignment and domain information
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK13974 thymidylate kinase; Provisional Back     alignment and domain information
>KOG3354 consensus Back     alignment and domain information
>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>KOG3079 consensus Back     alignment and domain information
>TIGR00235 udk uridine kinase; InterPro: IPR000764 Uridine kinase (pyrimidine ribonucleoside kinase) is the rate-limiting enzyme in the pyrimidine salvage pathway Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>KOG3347 consensus Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK12337 2-phosphoglycerate kinase; Provisional Back     alignment and domain information