254780133

254780133

hypothetical protein CLIBASIA_00060

GeneID in NCBI database:8209108Locus tag:CLIBASIA_00060
Protein GI in NCBI database:254780133Protein Accession:YP_003064546.1
Gene range:+(8356, 8547)Protein Length:63aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:not defined as a protein in SEED
Pathway involved in KEGG:not defined
Subsystem involved in KEGG:not defined
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60---
MTEKANKRYSLIRRVDIRDIAVIASETNTRIEIELEGAIYRFEPMIRGDNPCLIVDNDNPLDL
cccccccEEEEEEEEEcEEEEEEEcccccEEEEEEccEEEEEEcccccccEEEEEEccccccc
ccHHHcHHHHHEEEccHHHHEHEEcccccEEEEEEEEEEEEEcccccccccEEEEEccccccc
mtekankrYSLIRRVDIRDIAVIASETNTRIEIELEGaiyrfepmirgdnpclivdndnpldl
mtekankryslirrvdirdiaviasetntrieielegaiyrfepmirgdnpclivdndnpldl
MTEKANKRYSLirrvdirdiaviaSETNTRIEIELEGAIYRFEPMIRGDNPCLIVDNDNPLDL
*************RVDIRDIAVIASETNTRIEIELEGAIYRFEPMIRGDN*************
MTEKANKRYSLIRRVDIRDIAVIASETNTRIEIELEGAIYRFEPMIRGDNPCLIVDNDNPLDL
*T*KANKRYSLIRRVDIRDIAVIASETNTRIEIELEGAIYRFEPMIRGDNPCLIVDNDN****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTEKANKRYSLIRRVDIRDIAVIASETNTRIEIELEGAIYRFEPMIRGDNPCLIVDNDNPLDL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target63 hypothetical protein CLIBASIA_00060 [Candidatus Liberib
31512200067 hypothetical protein CKC_01250 [Candidatus Liberibacter 1 3e-07
31512259361 hypothetical protein CKC_04225 [Candidatus Liberibacter 1 4e-04
>gi|315122000|ref|YP_004062489.1| hypothetical protein CKC_01250 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 67 Back     alignment and organism information
 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 33/50 (66%)

Query: 14 RVDIRDIAVIASETNTRIEIELEGAIYRFEPMIRGDNPCLIVDNDNPLDL 63
          R+ IRD A IA E N RIEIE +G IYRFEP+ +  NP    DN NPL L
Sbjct: 13 RISIRDTARIAKENNIRIEIERDGTIYRFEPLSKRKNPPAEEDNSNPLGL 62


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315122593|ref|YP_004063082.1| hypothetical protein CKC_04225 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 61 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00