254780137

254780137

malic enzyme

GeneID in NCBI database:8209112Locus tag:CLIBASIA_00080
Protein GI in NCBI database:254780137Protein Accession:YP_003064550.1
Gene range:-(12818, 15157)Protein Length:779aa
Gene description:malic enzyme
COG prediction:[C] Malic enzyme
KEGG prediction:maeB; malic enzyme (EC:1.1.1.40); K00029 malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
SEED prediction:NADP-dependent malic enzyme (EC 1.1.1.40)
Pathway involved in KEGG:Pyruvate metabolism [PATH:las00620]
Subsystem involved in SEED:Pyruvate metabolism I: anaplerotic reactions, PEP
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED8 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------78
MEKRSSKKTKNPSFQEGDSLFKQALLYHQYPSPGKLEVNATKMLNDQKDLSLAYSPGVAAPSMMIAEDPSKAAMYTNRSNLVAVVSNGSAVLGLGDIGPLASKPVMEGKAVLFKKFAGINVFDIEINAKDVDTMVSTIVALEPTFGGINLEDIKAPECFEVERILSQKLKIPFLHDDQHGTAVTVTAATLNGMKLVGKKFSDIKIVTLGAGAAALACLNLLVTMGVRRENIWVYDLEGLVYEGREKKFDKWKSVYAQKSGPKPLSETMNNADVFLGLSVAGALDPAILKFMAEKPLIMVLANPNPEAMPDEIKKVRPDAMICTGRSDFSNQVNNVLCFPYIFRGALDCGATAITEEMKVAAARAMAVLVRDVPPDVVFDNFAKESPVFGPNYLIPSPFDPNLISYIAPAVAKAAEEAGVASSPIEDYEVYRDSLKRFSFPGRSLMKKIFSIAKGTDSKRILFSAGEDERVLRATQILIKENIARPVLIGSLLTIQDNIRRHDLQIIATKDFDVIDLNNKQSLKDYVDSYRSLSAEKGISLDSIYDLLRSNTTLLGSLALKRGEGDGMICMCDSESGYNSHLTDIHKIIGMGLGISHYSAMSMCIVRDNFLFFTDTHVSAEPSAMEIADSTILASQAICSLGMRPKVSVLFHSNSGSHCIKSSLKMRDSFEKICELSKNLEVDAIVQEEVCLSEIFCDKDVPNTSSSQDAQLLVFPNIDSANIALEMAKSVTNGLHIGTLLLGAALPVHIVPSSVSVREIIDMVALVMASNNSNSSKEKM
ccccccccccccccccHHHHHHHHHHHHccccccEEEEEEEEEEcccccccEEEcccHHHHHHHHHHHHHHHHcccccccEEEEEEccccEEccccccccccccHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHccccccccHHHcccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccccEEEEEEEcccHHHHHHHHHHHHcccccccEEEEEccccEEccccccccHHHHHHHHccccccHHHHHccccEEEEccccccccHHHHHHHccccEEEEcccccccccHHHHHHccccEEEEEcccccccccccEEEcccccHHEEEcccccccHHHHHHHHHHHHHHHccccHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHcccccccccccEEEcccccHHHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHHHHcccccccccEEEEEEEEccccEEEEEEccccccccHHHHHHHHHHHHHHHHHccccccEEEEEccccccccccHHHHHHHHHHHHHHHccccEEEccEEHHHcccHHHHHHHcccccccccccEEEEccHHHHHHHHHHHHHHccccEEcHHHHcccccEEEccccccHHHHHHHHHHHHHHHHHHHHcccc
ccccccccccccccccHHHHHHHHHHHHccccccEEEEEcccccccHHHHHHHcccccccHHHHHHHcHHHHHHHcccccEEEEEEcccEEEccccccHcccccccccccEEEEHcccccEEEEEEccccHHHHHHHHHHcccccccccHHHccccHHHHHHHHHHHHccccccEccccHHHHHHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHHcccccccEEEEEcccEEEEcccccccHHHHHHHHHcccccHHHHHccccEEEEccccccccHHHHHHHccccEEEEEccccccccHHHHHHHcccEEEEccccccccccccccccHHHHHcHcccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccHcHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHcccccEEEEccHHHHHHHHHHHccEEcccccEEEEcccccHHHHHHHHHHHHHHHcccccHHHHHHHHHccccEHHHHHHHcccccEEEEEEEccccHHHHHHHHHHHHcccccccHHHHHHEEEccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccccHHHHHHHHHHHHHHHHccccEEcccccccHHHcHHHHHHHccccccccccEEEEcccHHHHHHHHHHHHHHccccEEccEEEcccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHccc
mekrsskktknpsfqegdSLFKQALLyhqypspgkleVNATKMLNdqkdlslayspgvaapsmmiaedpskaamytnRSNLVAVVSNgsavlglgdigplaskpvmegKAVLFKKfaginvfdieinakdvdTMVSTIVAleptfgginledikapecfEVERILSQKlkipflhddqhgtAVTVTAATLNGMklvgkkfsdikiVTLGAGAAALACLNLLVTMgvrreniwvydleglvyegrEKKFDKWKSVyaqksgpkplsetmnnADVFLGLSVAGALDPAILKFMAEKPLimvlanpnpeampdeikkvrpdamictgrsdfsnqvnnvlcfpyifrgaldcgaTAITEEMKVAAARAMAVLVrdvppdvvfdnfakespvfgpnylipspfdpnlisYIAPAVAKAAEeagvasspiedyEVYRDSlkrfsfpgrsLMKKIFSIAkgtdskrilfsagEDERVLRATQILIKeniarpvlIGSLLTIQdnirrhdlqiiatkdfdvidlnnkqsLKDYVDSYRSLSAEKGISLDSIYDLLRSNTTLLGSLAlkrgegdgmicmcdsesgynshlTDIHKIIGMGLGISHYSAMSMCIvrdnflfftdthvsaepsameiadstILASQAICslgmrpkvsvlfhsnsgshciksSLKMRDSFEKICELSKNLEVDAIVQEEVCLseifcdkdvpntsssqdaqllvfpnidSANIALEMAKSVTNGLHIGTLLLGaalpvhivpssvsVREIIDMVALVMAsnnsnsskekm
mekrsskktknpsfqegDSLFKQALLYHQYPSPGKLEVNATKMLNDQKDLSLAYSPGVAAPSMMIAEDPSKAAMYTNRSNLVAVVSNGSAVLGLGDIGPLASKPVMEGKAVLFKKFAGINVFDIEINAKDVDTMVSTIVALEPTFGGINLEDIKAPECFEVERILSQKLKIPFLHDDQHGTAVTVTAATLNGMKLVGKKFSDIKIVTLGAGAAALACLNLLVTMGVRRENIWVYDLEGLVYEGREKKFDKWKSVyaqksgpkplsetMNNADVFLGLSVAGALDPAILKFMAEKPLIMVLANPNPEAMPDEIKKVRPDAMICTgrsdfsnqvnNVLCFPYIFRGALDCGATAITEEMKVAAARAMAVLVRDVPPDVVFDNFAKESPVFGPNYLIPSPFDPNLISYIAPAVAKAAEEagvasspiedyEVYRDSLKrfsfpgrsLMKKIFsiakgtdskrilfsagedeRVLRATQIlikeniarpvliGSLLTIQDNIRRHDLQIiatkdfdvidlnnKQSLKDYVDSYRSLSAEKGISLDSIYDLLRSNTTLLGSLALKRGEGDGMICMCDSESGYNSHLTDIHKIIGMGLGISHYSAMSMCIVRDNFLFFTDTHVSAEPSAMEIADSTILASQAICSLGMRPKVSVLFHSnsgshcikssLKMRDSFEKICELSKNLEVDAIVQEEVCLSEIFCDKDVPNTSSSQDAQLLVFPNIDSANIALEMAKSVTNGLHIGTLLLGAALPVHIVPSSVSVREIIDMVALVmasnnsnsskekm
MEKRSSKKTKNPSFQEGDSLFKQALLYHQYPSPGKLEVNATKMLNDQKDLSLAYSPGVAAPSMMIAEDPSKAAMYTNRSNLVAVVSNGSAVLGLGDIGPLASKPVMEGKAVLFKKFAGINVFDIEINAKDVDTMVSTIVALEPTFGGINLEDIKAPECFEVERILSQKLKIPFLHDDQHGTAVTVTAATLNGMKLVGKKFSDIKIVTlgagaaalaclnllVTMGVRRENIWVYDLEGLVYEGREKKFDKWKSVYAQKSGPKPLSETMNNADVFLGLSVAGALDPAILKFMAEKPLIMVLANPNPEAMPDEIKKVRPDAMICTGRSDFSNQVNNVLCFPYIFRGALDCGATAITEEMKvaaaramavlvrdvPPDVVFDNFAKESPVFGPNYLIPSPFDPNLISYIapavakaaeeagvaSSPIEDYEVYRDSLKRFSFPGRSLMKKIFSIAKGTDSKRILFSAGEDERVLRATQILIKENIARPVLIGSLLTIQDNIRRHDLQIIATKDFDVIDLNNKQSLKDYVDSYRSLSAEKGISLDSIYDLLRSNTTLLGSLALKRGEGDGMICMCDSESGYNSHLTDIHKIIGMGLGISHYSAMSMCIVRDNFLFFTDTHVSAEPSAMEIADSTILASQAICSLGMRPKVSVLFHSNSGSHCIKSSLKMRDSFEKICELSKNLEVDAIVQEEVCLSEIFCDKDVPNTSSSQDAQLLVFPNIDSANIALEMAKSVTNGLHIGTLLLGAALPVHIVPSSVSVREIIDMVALVMASNNSNSSKEKM
************************LLYHQYPSPGKLEVNATKMLNDQKDLSLAYSPGVAAPSMMIAEDPSKAAMYTNRSNLVAVVSNGSAVLGLGDIGPLASKPVMEGKAVLFKKFAGINVFDIEINAKDVDTMVSTIVALEPTFGGINLEDIKAPECFEVERILSQKLKIPFLHDDQHGTAVTVTAATLNGMKLVGKKFSDIKIVTLGAGAAALACLNLLVTMGVRRENIWVYDLEGLVYEGREKKFDKWKSVYAQKSGPKPLSETMNNADVFLGLSVAGALDPAILKFMAEKPLIMVLANPNPEAMPDEIKKVRPDAMICTGRSDFSNQVNNVLCFPYIFRGALDCGATAITEEMKVAAARAMAVLVRDVPPDVVFDNFAKESPVFGPNYLIPSPFDPNLISYIAPAVAKAAEEAGVASSPIEDYEVYRDSLKRFSFPGRSLMKKIFSIAKGTDSKRILFSAGEDERVLRATQILIKENIARPVLIGSLLTIQDNIRRHDLQIIATKDFDVIDLNNKQSLKDYVDSYRSLSAEKGISLDSIYDLLRSNTTLLGSLALKRGEGDGMICMCDSESGYNSHLTDIHKIIGMGLGISHYSAMSMCIVRDNFLFFTDTHVSAEPSAMEIADSTILASQAICSLGMRPKVSVLFHSNS**********MRDSFEKICELSKNLEVDAIVQEEVCLSEIFCDKDVPNTSSSQDAQLLVFPNIDSANIALEMAKSVTNGLHIGTLLLGAALPVHIVPSSVSVREIIDMVALVMASN*********
*************FQEGDSLFKQALLYHQYPSPGKLEVNATKMLNDQKDLSLAYSPGVAAPSMMIAEDPSKAAMYTNRSNLVAVVSNGSAVLGLGDIGPLASKPVMEGKAVLFKKFAGINVFDIEINAKDVDTMVSTIVALEPTFGGINLEDIKAPECFEVERILSQKLKIPFLHDDQHGTAVTVTAATLNGMKLVGKKFSDIKIVTLGAGAAALACLNLLVTMGVRRENIWVYDLEGLVYEGREKKFDKWKSVYAQKSGPKPLSETMNNADVFLGLSVAGALDPAILKFMAEKPLIMVLANPNPEAMPDEIKKVRPDAMICTGRSDFSNQVNNVLCFPYIFRGALDCGATAITEEMKVAAARAMAVLVRDVPPDVVFDNFAKESPVFGPNYLIPSPFDPNLISYIAPAV***********SPIEDYEVYRDSLKRFSFPGRSLMKKIFSIAKGTDSKRILFSAGEDERVLRATQILIKENIARPVLIGSLLTIQDNIRRHDLQIIATKDFDVIDLNNKQSLKDYVDSYRSLSAEKGISLDSIYDLLRSNTTLLGSLALKRGEGDGMICMCDSESGYNSHLTDIHKIIGMGLGISHYSAMSMCIVRDNFLFFTDTHVSAEPSAMEIADSTILASQAICSLGMRPKVSVLFHSNSGSHCIKSSLKMRDSFEKICELSKNLEVDAIVQEEVCLSEIFCDKDVPNTSSSQDAQLLVFPNIDSANIALEMAKSVTNGLHIGTLLLGAALPVHIVPSSVSVREIIDMVALVMAS**********
***********PSFQEGDSLFKQALLYHQYPSPGKLEVNATKMLNDQKDLSLAYSPGVAAPSMMIAEDPSKAAMYTNRSNLVAVVSNGSAVLGLGDIGPLASKPVMEGKAVLFKKFAGINVFDIEINAKDVDTMVSTIVALEPTFGGINLEDIKAPECFEVERILSQKLKIPFLHDDQHGTAVTVTAATLNGMKLVGKKFSDIKIVTLGAGAAALACLNLLVTMGVRRENIWVYDLEGLVYEGREKKFDKWKSVYAQKSGPKPLSETMNNADVFLGLSVAGALDPAILKFMAEKPLIMVLANPNPEAMPDEIKKVRPDAMICTGRSDFSNQVNNVLCFPYIFRGALDCGATAITEEMKVAAARAMAVLVRDVPPDVVFDNFAKESPVFGPNYLIPSPFDPNLISYIAPAVAKAAEEAGVASSPIEDYEVYRDSLKRFSFPGRSLMKKIFSIAKGTDSKRILFSAGEDERVLRATQILIKENIARPVLIGSLLTIQDNIRRHDLQIIATKDFDVIDLNNKQSLKDYVDSYRSLSAEKGISLDSIYDLLRSNTTLLGSLALKRGEGDGMICMCDSESGYNSHLTDIHKIIGMGLGISHYSAMSMCIVRDNFLFFTDTHVSAEPSAMEIADSTILASQAICSLGMRPKVSVLFHSNSGSHCIKSSLKMRDSFEKICELSKNLEVDAIVQEEVCLSEIFCDKDVPNTSSSQDAQLLVFPNIDSANIALEMAKSVTNGLHIGTLLLGAALPVHIVPSSVSVREIIDMVALVMASNNSNS*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKRSSKKTKNPSFQEGDSLFKQALLYHQYPSPGKLEVNATKMLNDQKDLSLAYSPGVAAPSMMIAEDPSKAAMYTNRSNLVAVVSNGSAVLGLGDIGPLASKPVMEGKAVLFKKFAGINVFDIEINAKDVDTMVSTIVALEPTFGGINLEDIKAPECFEVERILSQKLKIPFLHDDQHGTAVTVTAATLNGMKLVGKKFSDIKIVTLGAGAAALACLNLLVTMGVRRENIWVYDLEGLVYEGREKKFDKWKSVYAQKSGPKPLSETMNNADVFLGLSVAGALDPAILKFMAEKPLIMVLANPNPEAMPDEIKKVRPDAMICTGRSDFSNQVNNVLCFPYIFRGALDCGATAITEEMKVAAARAMAVLVRDVPPDVVFDNFAKESPVFGPNYLIPSPFDPNLISYIAPAVAKAAEEAGVASSPIEDYEVYRDSLKRFSFPGRSLMKKIFSIAKGTDSKRILFSAGEDERVLRATQILIKENIARPVLIGSLLTIQDNIRRHDLQIIATKDFDVIDLNNKQSLKDYVDSYRSLSAEKGISLDSIYDLLRSNTTLLGSLALKRGEGDGMICMCDSESGYNSHLTDIHKIIGMGLGISHYSAMSMCIVRDNFLFFTDTHVSAEPSAMEIADSTILASQAICSLGMRPKVSVLFHSNSGSHCIKSSLKMRDSFEKICELSKNLEVDAIVQEEVCLSEIFCDKDVPNTSSSQDAQLLVFPNIDSANIALEMAKSVTNGLHIGTLLLGAALPVHIVPSSVSVREIIDMVALVMASNNSNSSKEKM
MEKRSSKKTKNPSFQEGDSLFKQALLYHQYPSPGKLEVNATKMLNDQKDLSLAYSPGVAAPSMMIAEDPSKAAMYTNRSNLVAVVSNGSAVLGLGDIGPLASKPVMEGKAVLFKKFAGINVFDIEINAKDVDTMVSTIVALEPTFGGINLEDIKAPECFEVERILSQKLKIPFLHDDQHGTAVTVTAATLNGMKLVGKKFSDIKIVTLGAGAAALACLNLLVTMGVRRENIWVYDLEGLVYEGREKKFDKWKSVYAQKSGPKPLSETMNNADVFLGLSVAGALDPAILKFMAEKPLIMVLANPNPEAMPDEIKKVRPDAMICTGRSDFSNQVNNVLCFPYIFRGALDCGATAITEEMKVAAARAMAVLVRDVPPDVVFDNFAKESPVFGPNYLIPSPFDPNLISYIAPAVAKAAEEAGVASSPIEDYEVYRDSLKRFSFPGRSLMKKIFSIAKGTDSKRILFSAGEDERVLRATQILIKENIARPVLIGSLLTIQDNIRRHDLQIIATKDFDVIDLNNKQSLKDYVDSYRSLSAEKGISLDSIYDLLRSNTTLLGSLALKRGEGDGMICMCDSESGYNSHLTDIHKIIGMGLGISHYSAMSMCIVRDNFLFFTDTHVSAEPSAMEIADSTILASQAICSLGMRPKVSVLFHSNSGSHCIKSSLKMRDSFEKICELSKNLEVDAIVQEEVCLSEIFCDKDVPNTSSSQDAQLLVFPNIDSANIALEMAKSVTNGLHIGTLLLGAALPVHIVPSSVSVREIIDMVALVMASNNSNSSKEKM
MEKRSSKKTKNPSFQEGDSLFKQALLYHQYPSPGKLEVNATKMLNDQKDLSLAYSPGVAAPSMMIAEDPSKAAMYTNRSNLVAVVSNGSAVLGLGDIGPLASKPVMEGKAVLFKKFAGINVFDIEINAKDVDTMVSTIVALEPTFGGINLEDIKAPECFEVERILSQKLKIPFLHDDQHGTAVTVTAATLNGMKLVGKKFSDIKIVTLGAGAAALACLNLLVTMGVRRENIWVYDLEGLVYEGREKKFDKWKSVYAQKSGPKPLSETMNNADVFLGLSVAGALDPAILKFMAEKPLIMVLANPNPEAMPDEIKKVRPDAMICTGRSDFSNQVNNVLCFPYIFRGALDCGATAITEEMKVAAARAMAVLVRDVPPDVVFDNFAKESPVFGPNYLIPSPFDPNLISYIAPAVAKAAEEAGVASSPIEDYEVYRDSLKRFSFPGRSLMKKIFSIAKGTDSKRILFSAGEDERVLRATQILIKENIARPVLIGSLLTIQDNIRRHDLQIIATKDFDVIDLNNKQSLKDYVDSYRSLSAEKGISLDSIYDLLRSNTTLLGSLALKRGEGDGMICMCDSESGYNSHLTDIHKIIGMGLGISHYSAMSMCIVRDNFLFFTDTHVSAEPSAMEIADSTILASQAICSLGMRPKVSVLFHSNSGSHCIKSSLKMRDSFEKICELSKNLEVDAIVQEEVCLSEIFCDKDVPNTSSSQDAQLLVFPNIDSANIALEMAKSVTNGLHIGTLLLGAALPVHIVPSSVSVREIIDMVALVMASNNSNSSKEKM

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target779 malic enzyme [Candidatus Liberibacter asiaticus str. ps
315122738779 malic enzyme [Candidatus Liberibacter solanacearum CLso 1 0.0
190892042770 malate dehydrogenase (oxaloacetate decarboxylating) (NA 1 0.0
241204926770 malic enzyme [Rhizobium leguminosarum bv. trifolii WSM1 1 0.0
327190632770 malate dehydrogenase (oxaloacetate decarboxylating) (NA 1 0.0
116252418770 malic enzyme [Rhizobium leguminosarum bv. viciae 3841] 1 0.0
86357970770 malic enzyme [Rhizobium etli CFN 42] Length = 770 1 0.0
209549586770 malic enzyme [Rhizobium leguminosarum bv. trifolii WSM2 1 0.0
163759634771 phosphate acetyltransferase [Hoeflea phototrophica DFL- 1 0.0
222086203770 malate dehydrogenase (oxaloacetate decarboxylating) (NA 1 0.0
227822235770 malic enzyme [Sinorhizobium fredii NGR234] Length = 770 1 0.0
>gi|315122738|ref|YP_004063227.1| malic enzyme [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 779 Back     alignment and organism information
 Score = 1129 bits (2920), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 567/765 (74%), Positives = 660/765 (86%)

Query: 11  NPSFQEGDSLFKQALLYHQYPSPGKLEVNATKMLNDQKDLSLAYSPGVAAPSMMIAEDPS 70
           +P FQ+ D LFKQALLYHQYPSPGKLE+NATK+LN+  DLSLAYSPGVAAP M+IAEDPS
Sbjct: 11  DPQFQKEDDLFKQALLYHQYPSPGKLEINATKILNNLNDLSLAYSPGVAAPCMIIAEDPS 70

Query: 71  KAAMYTNRSNLVAVVSNGSAVLGLGDIGPLASKPVMEGKAVLFKKFAGINVFDIEINAKD 130
           KA MYT RSNLVAV+SNGSAVLGLG+IGPLASKPVMEGKAVLFKKFAGINVFDIEI+AKD
Sbjct: 71  KAQMYTTRSNLVAVISNGSAVLGLGNIGPLASKPVMEGKAVLFKKFAGINVFDIEIDAKD 130

Query: 131 VDTMVSTIVALEPTFGGINLEDIKAPECFEVERILSQKLKIPFLHDDQHGTAVTVTAATL 190
           VDTMVSTI ALEPTFGGINLEDIK+PECFEVE+ILSQKLKIP  HDDQHGTAVTVTAA L
Sbjct: 131 VDTMVSTISALEPTFGGINLEDIKSPECFEVEKILSQKLKIPCFHDDQHGTAVTVTAAAL 190

Query: 191 NGMKLVGKKFSDIKIVTLGAGAAALACLNLLVTMGVRRENIWVYDLEGLVYEGREKKFDK 250
           NGMKL+GKKFSDIK+VTLGAGAAALACLNLLVTMGVRRENIW++DLEGLVY+GR++K D+
Sbjct: 191 NGMKLIGKKFSDIKVVTLGAGAAALACLNLLVTMGVRRENIWIHDLEGLVYKGRKRKIDQ 250

Query: 251 WKSVYAQKSGPKPLSETMNNADVFLGLSVAGALDPAILKFMAEKPLIMVLANPNPEAMPD 310
           WKS YAQ  G K L+ETM +AD+FLGLS AGAL P +LK+MA  PLIM LANP PE MPD
Sbjct: 251 WKSFYAQDGGFKTLAETMQDADLFLGLSAAGALKPDVLKYMAPNPLIMTLANPIPEIMPD 310

Query: 311 EIKKVRPDAMICTGRSDFSNQVNNVLCFPYIFRGALDCGATAITEEMKVAAARAMAVLVR 370
             +++RPDAMICTGRSDF NQVNNVLCFPYIFRGALDCGAT+I EEMKVAAA AMA LVR
Sbjct: 311 VAREIRPDAMICTGRSDFPNQVNNVLCFPYIFRGALDCGATSINEEMKVAAAHAMAALVR 370

Query: 371 DVPPDVVFDNFAKESPVFGPNYLIPSPFDPNLISYIAPAVAKAAEEAGVASSPIEDYEVY 430
           DVP D+V+++F+ E PVFG +YLIPSPF+PNLI YIAPAVAKAAEE GVASSPI+DYE Y
Sbjct: 371 DVPLDIVYNDFSTEYPVFGSDYLIPSPFNPNLILYIAPAVAKAAEETGVASSPIKDYEAY 430

Query: 431 RDSLKRFSFPGRSLMKKIFSIAKGTDSKRILFSAGEDERVLRATQILIKENIARPVLIGS 490
           RDSLK+F FPGRSLMK IFSIAK  D KRILFS+GEDER+LR+ QILIKE +ARPVL+GS
Sbjct: 431 RDSLKQFLFPGRSLMKNIFSIAKNADLKRILFSSGEDERILRSAQILIKEKMARPVLVGS 490

Query: 491 LLTIQDNIRRHDLQIIATKDFDVIDLNNKQSLKDYVDSYRSLSAEKGISLDSIYDLLRSN 550
              IQ+NIR  DLQI+  KDFD+IDLN++++L++YVD YR+L+ EK IS DS++ +LRSN
Sbjct: 491 PSVIQNNIRCLDLQILPEKDFDIIDLNSQETLENYVDLYRALTGEKDISSDSVHTILRSN 550

Query: 551 TTLLGSLALKRGEGDGMICMCDSESGYNSHLTDIHKIIGMGLGISHYSAMSMCIVRDNFL 610
            TL+GSLALK GE D MIC C SE  Y+SHLTDI+KIIG   GIS++SAMS+ + +D  +
Sbjct: 551 ATLVGSLALKSGEADVMICTCGSEDQYDSHLTDINKIIGKKSGISNHSAMSILVAKDQII 610

Query: 611 FFTDTHVSAEPSAMEIADSTILASQAICSLGMRPKVSVLFHSNSGSHCIKSSLKMRDSFE 670
           FF DTHVS +PSA EIA++T+LASQA+ S GM P VS+L  SN GSH  KSSLKM ++ E
Sbjct: 611 FFADTHVSVDPSAREIAENTVLASQAVRSFGMNPLVSLLSRSNFGSHNTKSSLKMHEALE 670

Query: 671 KICELSKNLEVDAIVQEEVCLSEIFCDKDVPNTSSSQDAQLLVFPNIDSANIALEMAKSV 730
           +I ELS++L+VD  +Q E   SEIFC+  V +TS SQDA+LL+FPNIDSANI+LEM KS+
Sbjct: 671 QIRELSRDLKVDEKIQGEADFSEIFCNNAVRDTSLSQDAKLLIFPNIDSANISLEMVKSI 730

Query: 731 TNGLHIGTLLLGAALPVHIVPSSVSVREIIDMVALVMASNNSNSS 775
           TNGL+IG +LLG+ALPVHI+P++V+VREIIDMVAL +A N  NS+
Sbjct: 731 TNGLYIGKVLLGSALPVHILPAAVNVREIIDMVALAIAENCRNSA 775


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|190892042|ref|YP_001978584.1| malate dehydrogenase (oxaloacetate decarboxylating) (NADP+) protein [Rhizobium etli CIAT 652] Length = 770 Back     alignment and organism information
>gi|241204926|ref|YP_002976022.1| malic enzyme [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 770 Back     alignment and organism information
>gi|327190632|gb|EGE57720.1| malate dehydrogenase (oxaloacetate decarboxylating) (NADP+) protein [Rhizobium etli CNPAF512] Length = 770 Back     alignment and organism information
>gi|116252418|ref|YP_768256.1| malic enzyme [Rhizobium leguminosarum bv. viciae 3841] Length = 770 Back     alignment and organism information
>gi|86357970|ref|YP_469862.1| malic enzyme [Rhizobium etli CFN 42] Length = 770 Back     alignment and organism information
>gi|209549586|ref|YP_002281503.1| malic enzyme [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 770 Back     alignment and organism information
>gi|163759634|ref|ZP_02166719.1| phosphate acetyltransferase [Hoeflea phototrophica DFL-43] Length = 771 Back     alignment and organism information
>gi|222086203|ref|YP_002544735.1| malate dehydrogenase (oxaloacetate decarboxylating) (NADP+) protein [Agrobacterium radiobacter K84] Length = 770 Back     alignment and organism information
>gi|227822235|ref|YP_002826206.1| malic enzyme [Sinorhizobium fredii NGR234] Length = 770 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target779 malic enzyme [Candidatus Liberibacter asiaticus str. ps
PRK12862763 PRK12862, PRK12862, malic enzyme; Reviewed 0.0
PRK07232752 PRK07232, PRK07232, bifunctional malic enzyme oxidoredu 0.0
PRK12861764 PRK12861, PRK12861, malic enzyme; Reviewed 0.0
cd05311226 cd05311, NAD_bind_2_malic_enz, NAD(P) binding domain of 2e-78
pfam03949255 pfam03949, Malic_M, Malic enzyme, NAD binding domain 8e-65
cd05312279 cd05312, NAD_bind_1_malic_enz, NAD(P) binding domain of 7e-29
cd00762254 cd00762, NAD_bind_malic_enz, NAD(P) binding domain of m 2e-24
COG0280327 COG0280, Pta, Phosphotransacetylase [Energy production 4e-57
pfam01515319 pfam01515, PTA_PTB, Phosphate acetyl/butaryl transferas 4e-46
TIGR00651303 TIGR00651, pta, phosphate acetyltransferase 2e-25
PRK09653324 PRK09653, eutD, phosphotransacetylase; Reviewed 3e-25
pfam00390182 pfam00390, malic, Malic enzyme, N-terminal domain 3e-34
KOG1257582 KOG1257, KOG1257, KOG1257, NADP+-dependent malic enzyme 5e-32
PRK13529563 PRK13529, PRK13529, malate dehydrogenase; Provisional 4e-29
PLN03129581 PLN03129, PLN03129, NADP-dependent malic enzyme; Provis 1e-27
PTZ00317559 PTZ00317, PTZ00317, NADP-dependent malic enzyme; Provis 2e-25
PRK05632684 PRK05632, PRK05632, phosphate acetyltransferase; Review 2e-09
COG0281432 COG0281, SfcA, Malic enzyme [Energy production and conv 1e-149
>gnl|CDD|183799 PRK12862, PRK12862, malic enzyme; Reviewed Back     alignment and domain information
>gnl|CDD|180898 PRK07232, PRK07232, bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed Back     alignment and domain information
>gnl|CDD|183798 PRK12861, PRK12861, malic enzyme; Reviewed Back     alignment and domain information
>gnl|CDD|133453 cd05311, NAD_bind_2_malic_enz, NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>gnl|CDD|146532 pfam03949, Malic_M, Malic enzyme, NAD binding domain Back     alignment and domain information
>gnl|CDD|133454 cd05312, NAD_bind_1_malic_enz, NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>gnl|CDD|133442 cd00762, NAD_bind_malic_enz, NAD(P) binding domain of malic enzyme Back     alignment and domain information
>gnl|CDD|30628 COG0280, Pta, Phosphotransacetylase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|144928 pfam01515, PTA_PTB, Phosphate acetyl/butaryl transferase Back     alignment and domain information
>gnl|CDD|161978 TIGR00651, pta, phosphate acetyltransferase Back     alignment and domain information
>gnl|CDD|182020 PRK09653, eutD, phosphotransacetylase; Reviewed Back     alignment and domain information
>gnl|CDD|144108 pfam00390, malic, Malic enzyme, N-terminal domain Back     alignment and domain information
>gnl|CDD|36471 KOG1257, KOG1257, KOG1257, NADP+-dependent malic enzyme [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|184116 PRK13529, PRK13529, malate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|178675 PLN03129, PLN03129, NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>gnl|CDD|185552 PTZ00317, PTZ00317, NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>gnl|CDD|180175 PRK05632, PRK05632, phosphate acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|30629 COG0281, SfcA, Malic enzyme [Energy production and conversion] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 779 malic enzyme [Candidatus Liberibacter asiaticus str. ps
PRK07232753 malic enzyme; Reviewed 100.0
PRK12862761 malic enzyme; Reviewed 100.0
PRK12861762 malic enzyme; Reviewed 100.0
COG0281432 SfcA Malic enzyme [Energy production and conversion] 100.0
PRK13529563 malate dehydrogenase; Provisional 100.0
PTZ00317570 malic enzyme; Provisional 100.0
KOG1257582 consensus 100.0
PRK05632702 phosphate acetyltransferase; Reviewed 100.0
pfam01515319 PTA_PTB Phosphate acetyl/butaryl transferase. This fami 100.0
PRK09653324 eutD phosphotransacetylase; Reviewed 100.0
COG0280327 Pta Phosphotransacetylase [Energy production and conver 100.0
TIGR00651322 pta phosphate acetyltransferase; InterPro: IPR004614 Ph 100.0
PRK05805301 phosphate butyryltransferase; Validated 100.0
PRK11890312 phosphate acetyltransferase; Provisional 100.0
PRK07742299 phosphate butyryltransferase; Validated 100.0
TIGR02706295 P_butyryltrans phosphate butyryltransferase; InterPro: 100.0
PRK08190465 bifunctional enoyl-CoA hydratase/phosphate acetyltransf 100.0
TIGR02709271 branched_ptb branched-chain phosphotransacylase; InterP 99.95
PRK13845437 putative glycerol-3-phosphate acyltransferase PlsX; Pro 99.78
PRK02848341 consensus 99.09
PRK00232334 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Revi 99.06
PRK03743333 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Vali 98.98
PRK05312336 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Prov 98.94
PRK03877328 consensus 98.83
PRK01909329 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Vali 98.81
PRK02746332 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Prov 98.76
PRK04607330 consensus 98.67
PRK03367329 consensus 98.51
PRK04507323 consensus 98.51
PRK03371326 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase 2; Pr 98.3
PRK03946304 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Prov 98.25
COG1995332 PdxA Pyridoxal phosphate biosynthesis protein [Coenzyme 98.02
TIGR00557325 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Inte 93.48
cd05312279 NAD_bind_1_malic_enz NAD(P) binding domain of malic enz 100.0
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of malic enz 100.0
pfam03949255 Malic_M Malic enzyme, NAD binding domain. 100.0
cd00762254 NAD_bind_malic_enz NAD(P) binding domain of malic enzym 100.0
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 92.85
TIGR03270202 methan_mark_4 putative methanogen marker protein 4. Mem 99.97
COG4002256 Predicted phosphotransacetylase [General function predi 98.71
pfam00390182 malic Malic enzyme, N-terminal domain. 99.97
PRK05331317 putative glycerol-3-phosphate acyltransferase PlsX; Pro 99.82
pfam02504322 FA_synthesis Fatty acid synthesis protein. The plsX gen 99.79
PRK13846316 putative glycerol-3-phosphate acyltransferase PlsX; Pro 99.78
COG0416338 PlsX Fatty acid/phospholipid biosynthesis enzyme [Lipid 99.75
TIGR00182344 plsX fatty acid/phospholipid synthesis protein PlsX; In 99.66
pfam04166299 PdxA Pyridoxal phosphate biosynthetic protein PdxA. In 98.83
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of amino a 98.85
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate de 97.92
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of gluta 97.91
pfam01262150 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domai 97.76
pfam00208237 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine de 97.71
pfam01488134 Shikimate_DH Shikimate / quinate 5-dehydrogenase. This 97.67
PRK05476427 S-adenosyl-L-homocysteine hydrolase; Provisional 97.62
pfam05221430 AdoHcyase S-adenosyl-L-homocysteine hydrolase. 97.51
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycas 97.41
PTZ00075476 S-adenosyl-L-homocysteine hydrolase; Provisional 97.33
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate de 97.31
TIGR01318480 gltD_gamma_fam glutamate synthase, small subunit; Inter 97.29
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimat 96.96
pfam00670162 AdoHcyase_NAD S-adenosyl-L-homocysteine hydrolase, NAD 96.61
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucin 96.54
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-lactate 96.37
pfam02056183 Glyco_hydro_4 Family 4 glycosyl hydrolase. 96.13
pfam02826176 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogen 95.82
COG0334411 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Ami 95.78
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene tetr 95.75
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-lactate 95.75
cd05298437 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- 95.74
cd05297423 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolase 95.61
cd05197425 GH4_glycoside_hydrolases Glycoside Hydrases Family 4. G 95.43
cd05296419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; P 95.11
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain o 94.99
PTZ00082322 L-lactate dehydrogenase; Provisional 94.99
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrog 94.99
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 94.73
PRK08293288 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.66
PRK00141476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.59
TIGR02356210 adenyl_thiF thiazole biosynthesis adenylyltransferase T 94.52
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methy 94.43
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-lactate 94.3
pfam02882159 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydro 94.13
pfam01210159 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehyd 94.02
PRK06141313 ornithine cyclodeaminase; Validated 93.9
PRK03369487 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.87
PRK09260289 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.86
PRK09117282 consensus 93.8
TIGR00507286 aroE shikimate 5-dehydrogenase; InterPro: IPR011342 The 93.65
PRK08762379 molybdopterin biosynthesis protein MoeB; Validated 93.56
PRK05690245 molybdopterin biosynthesis protein MoeB; Provisional 93.47
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 93.29
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochond 93.22
TIGR03366280 HpnZ_proposed putative phosphonate catabolism associate 93.18
PTZ00117313 malate dehydrogenase; Provisional 93.17
COG1486442 CelF Alpha-galactosidases/6-phospho-beta-glucosidases, 93.06
TIGR01381689 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Ap 93.0
PRK06407302 ornithine cyclodeaminase; Provisional 92.96
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases and s 92.83
PRK01438481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.82
pfam00056142 Ldh_1_N lactate/malate dehydrogenase, NAD binding domai 92.71
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Members 92.68
PRK06223312 malate dehydrogenase; Reviewed 92.05
PTZ00325313 malate dehydrogenase; Provisional 91.98
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 91.94
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate dehydr 91.69
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 91.26
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene-tetra 91.14
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 91.11
KOG0685498 consensus 90.8
TIGR00050253 rRNA_methyl_1 RNA methyltransferase, TrmH family, group 90.41
PRK05086312 malate dehydrogenase; Provisional 90.26
PRK08306296 dipicolinate synthase subunit A; Reviewed 97.97
PRK00258275 aroE shikimate 5-dehydrogenase; Reviewed 97.69
PRK09424510 pntA NAD(P) transhydrogenase subunit alpha; Provisional 97.62
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Meth 90.84
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 97.53
PRK09414446 glutamate dehydrogenase; Provisional 97.23
PRK00045429 hemA glutamyl-tRNA reductase; Reviewed 97.2
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of gl 97.0
PTZ00079469 NADP-specific glutamate dehydrogenase; Provisional 96.96
PRK13940414 glutamyl-tRNA reductase; Provisional 96.91
TIGR01035436 hemA glutamyl-tRNA reductase; InterPro: IPR000343 Tetra 96.69
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 96.52
PRK10792288 bifunctional 5,10-methylene-tetrahydrofolate dehydrogen 96.37
PRK12549284 shikimate 5-dehydrogenase; Reviewed 96.09
PRK12548289 shikimate 5-dehydrogenase; Provisional 95.97
PRK00257379 erythronate-4-phosphate dehydrogenase; Validated 95.9
PRK00676338 hemA glutamyl-tRNA reductase; Validated 95.66
PRK12550272 shikimate 5-dehydrogenase; Reviewed 95.18
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transport an 94.93
COG0111324 SerA Phosphoglycerate dehydrogenase and related dehydro 92.62
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 96.96
TIGR02853288 spore_dpaA dipicolinic acid synthetase, A subunit; Inte 96.1
PRK13581524 D-3-phosphoglycerate dehydrogenase; Provisional 95.14
COG0499420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabol 96.45
TIGR00936422 ahcY adenosylhomocysteinase; InterPro: IPR000043 S-aden 92.72
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/shikima 96.38
COG0686371 Ald Alanine dehydrogenase [Amino acid transport and met 96.09
pfam02423312 OCD_Mu_crystall Ornithine cyclodeaminase/mu-crystallin 94.81
COG3288356 PntA NAD/NADP transhydrogenase alpha subunit [Energy pr 93.41
COG5322351 Predicted dehydrogenase [General function prediction on 93.28
PRK12475337 thiamine/molybdopterin biosynthesis MoeB-like protein; 94.6
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1-like 93.55
KOG0029501 consensus 93.45
PRK08644209 thiamine biosynthesis protein ThiF; Provisional 93.32
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 93.17
pfam00899134 ThiF ThiF family. This family contains a repeated domai 91.9
PRK09754400 phenylpropionate dioxygenase ferredoxin reductase subun 91.71
PRK06130310 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.58
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.25
PRK13984604 putative oxidoreductase; Provisional 91.02
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like prot 90.71
PRK13243333 glyoxylate reductase; Reviewed 94.59
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 94.42
PRK06487317 glycerate dehydrogenase; Provisional 93.79
PRK09880343 L-idonate 5-dehydrogenase; Provisional 92.99
PRK10083339 putative dehydrogenase; Provisional 92.98
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 90.13
KOG0743457 consensus 92.15
cd01966417 Nitrogenase_NifN_1 Nitrogenase_nifN1: A subgroup of the 91.78
>PRK07232 malic enzyme; Reviewed Back     alignment and domain information
>PRK12862 malic enzyme; Reviewed Back     alignment and domain information
>PRK12861 malic enzyme; Reviewed Back     alignment and domain information
>COG0281 SfcA Malic enzyme [Energy production and conversion] Back     alignment and domain information
>PRK13529 malate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00317 malic enzyme; Provisional Back     alignment and domain information
>KOG1257 consensus Back     alignment and domain information
>PRK05632 phosphate acetyltransferase; Reviewed Back     alignment and domain information
>pfam01515 PTA_PTB Phosphate acetyl/butaryl transferase Back     alignment and domain information
>PRK09653 eutD phosphotransacetylase; Reviewed Back     alignment and domain information
>COG0280 Pta Phosphotransacetylase [Energy production and conversion] Back     alignment and domain information
>TIGR00651 pta phosphate acetyltransferase; InterPro: IPR004614 Phosphate acetyltransferase (2 Back     alignment and domain information
>PRK05805 phosphate butyryltransferase; Validated Back     alignment and domain information
>PRK11890 phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK07742 phosphate butyryltransferase; Validated Back     alignment and domain information
>TIGR02706 P_butyryltrans phosphate butyryltransferase; InterPro: IPR014079 Members of this family are phosphate butyryltransferase enzymes, also called phosphotransbutyrylase Back     alignment and domain information
>PRK08190 bifunctional enoyl-CoA hydratase/phosphate acetyltransferase; Validated Back     alignment and domain information
>TIGR02709 branched_ptb branched-chain phosphotransacylase; InterPro: IPR014081 This entry distinguishes branched-chain phosphotransacylases like that of Enterococcus faecalis from closely related subfamilies of phosphate butyryltransferase 2 Back     alignment and domain information
>PRK13845 putative glycerol-3-phosphate acyltransferase PlsX; Provisional Back     alignment and domain information
>PRK02848 consensus Back     alignment and domain information
>PRK00232 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK03743 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK05312 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK03877 consensus Back     alignment and domain information
>PRK01909 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK02746 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK04607 consensus Back     alignment and domain information
>PRK03367 consensus Back     alignment and domain information
>PRK04507 consensus Back     alignment and domain information
>PRK03371 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase 2; Provisional Back     alignment and domain information
>PRK03946 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG1995 PdxA Pyridoxal phosphate biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>TIGR00557 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; InterPro: IPR005255 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>pfam03949 Malic_M Malic enzyme, NAD binding domain Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR03270 methan_mark_4 putative methanogen marker protein 4 Back     alignment and domain information
>COG4002 Predicted phosphotransacetylase [General function prediction only] Back     alignment and domain information
>pfam00390 malic Malic enzyme, N-terminal domain Back     alignment and domain information
>PRK05331 putative glycerol-3-phosphate acyltransferase PlsX; Provisional Back     alignment and domain information
>pfam02504 FA_synthesis Fatty acid synthesis protein Back     alignment and domain information
>PRK13846 putative glycerol-3-phosphate acyltransferase PlsX; Provisional Back     alignment and domain information
>COG0416 PlsX Fatty acid/phospholipid biosynthesis enzyme [Lipid metabolism] Back     alignment and domain information
>TIGR00182 plsX fatty acid/phospholipid synthesis protein PlsX; InterPro: IPR003664 The plsX gene is part of the bacterial fab gene cluster which encodes several key fatty acid biosynthetic enzymes Back     alignment and domain information
>pfam04166 PdxA Pyridoxal phosphate biosynthetic protein PdxA Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>pfam01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain Back     alignment and domain information
>pfam00208 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine dehydrogenase Back     alignment and domain information
>pfam01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>pfam05221 AdoHcyase S-adenosyl-L-homocysteine hydrolase Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PTZ00075 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase, small subunit; InterPro: IPR006006 One pathway for the assimilation of ammonia and glutamate biosynthesis involves glutamate synthase (1 Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>pfam00670 AdoHcyase_NAD S-adenosyl-L-homocysteine hydrolase, NAD binding domain Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>pfam02056 Glyco_hydro_4 Family 4 glycosyl hydrolase Back     alignment and domain information
>pfam02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 Back     alignment and domain information
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF; InterPro: IPR012731 Members of the HesA/MoeB/ThiF family of proteins (IPR000594 from INTERPRO) include a number of members encoded in the midst of thiamine biosynthetic operons Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>pfam02882 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain Back     alignment and domain information
>pfam01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09117 consensus Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase; InterPro: IPR011342 The shikimate pathway links the metabolism of carbohydrates to the biosynthesis of aromatic compounds and is essential for the biosynthesis of aromatic amino acids and other aromatic compounds in bacteria, eukaryotic microorganisms and plants Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>COG1486 CelF Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p; InterPro: IPR006285 This is a family of eukaryotic proteins found in animals, plants, and yeasts that includes Apg7p (YHR171W) from Saccharomyces cerevisiae and GSA7 from Pichia pastoris Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>pfam00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>KOG0685 consensus Back     alignment and domain information
>TIGR00050 rRNA_methyl_1 RNA methyltransferase, TrmH family, group 1; InterPro: IPR004384 These proteins are part of the trmH (spoU) family of rRNA methylases Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase; InterPro: IPR000343 Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit; InterPro: IPR014215 This predicted Rossman fold-containing protein is the A subunit of dipicolinic acid synthetase as found in most, though not all, endospore-forming low-GC Gram-positive bacteria; it is absent in Clostridium Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase; InterPro: IPR000043 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>pfam02423 OCD_Mu_crystall Ornithine cyclodeaminase/mu-crystallin family Back     alignment and domain information
>COG3288 PntA NAD/NADP transhydrogenase alpha subunit [Energy production and conversion] Back     alignment and domain information
>COG5322 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>KOG0029 consensus Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information