254780138

254780138

ABC transporter

GeneID in NCBI database:8209113Locus tag:CLIBASIA_00085
Protein GI in NCBI database:254780138Protein Accession:YP_003064551.1
Gene range:+(15442, 16563)Protein Length:373aa
Gene description:ABC transporter
COG prediction:[Q] ABC-type transport system involved in resistance to organic solvents, permease component
KEGG prediction:ABC transporter; K02066 putative ABC transport system permease protein
SEED prediction:ABC-type transport system involved in resistance to organic solvents, permease component USSDB6A
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM4 TM-Helix
TOPPRED5 TM-Helix
HMMTOP6 TM-Helix
MEMSAT6 TM-Helix
MEMSAT_SVM6 TM-Helix
PHOBIUS5 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370---
MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI
cccccEEEEEEEccccHHHHcccHHHHHHHHHcccccccEEEEccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
ccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHcccccEEEEccHHHHHHHHHHHHHHHHHHHcccccHHccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHcHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
MSENGITVFRfagnwkspeiseIADDVVMAINKSiqsdsaivdlsAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHrkkiknqkpqrsfFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNtgefcassykFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGvhsnslgkkVTTCVVQSISIVIIIDSLFAIFYFAIGI
msengitvfrfagnwkspeiSEIADDVVMAINKSIqsdsaivdlsAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFThrkkiknqkpqRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI
MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCvvqsisiviiidsLFAIFYFAIGI
*****ITVFRFAGNWKSPEISEIAD***********SDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLIS********************FKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI
MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI
****GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI
MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI
MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target373 ABC transporter [Candidatus Liberibacter asiaticus str.
315122740211 ABC transporter [Candidatus Liberibacter solanacearum C 1 1e-103
222086200386 ABC transporter [Agrobacterium radiobacter K84] Length 1 7e-78
241204915394 hypothetical protein Rleg_2195 [Rhizobium leguminosarum 1 4e-77
116252407389 transmembrane component of ABC transporter [Rhizobium l 1 2e-76
254710104391 Sulfate transporter/antisigma-factor [Brucella pinniped 1 2e-74
254693733391 hypothetical protein Babob3T_03544 [Brucella abortus bv 1 2e-74
189024185390 Sulfate transporter/antisigma-factor [Brucella abortus 1 2e-74
327190640383 putative ABC transporter, permease protein [Rhizobium e 1 2e-74
190892035389 probable ABC transporter, permease protein [Rhizobium e 1 2e-74
23501899391 toulene ABC transporter permease [Brucella suis 1330] L 1 2e-74
>gi|315122740|ref|YP_004063229.1| ABC transporter [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 211 Back     alignment and organism information
 Score =  378 bits (971), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 206/211 (97%)

Query: 163 VGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAG 222
           +GV+GVPV+ILISFVTGAVIAQQGAFQLS FGAEIF+IDLMSILQLREIGVLLTAVM+AG
Sbjct: 1   MGVTGVPVIILISFVTGAVIAQQGAFQLSNFGAEIFAIDLMSILQLREIGVLLTAVMVAG 60

Query: 223 RSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGA 282
           RSGSAIVAEIGSMKINEEID+++T+G+D VR+LISPRIWALIISLPLLTILAN+SAI+GA
Sbjct: 61  RSGSAIVAEIGSMKINEEIDSLKTIGIDLVRVLISPRIWALIISLPLLTILANYSAIVGA 120

Query: 283 SIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSL 342
           SI++WKYYDIPF+VFF+RFHSTATL N+FTGLIKAPFMACAIGIVAMKEGF VG +S+SL
Sbjct: 121 SIIVWKYYDIPFSVFFARFHSTATLGNVFTGLIKAPFMACAIGIVAMKEGFGVGTNSDSL 180

Query: 343 GKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           GK+VTTCVVQSIS+VIIIDSLFAIFYFAIGI
Sbjct: 181 GKRVTTCVVQSISMVIIIDSLFAIFYFAIGI 211


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222086200|ref|YP_002544732.1| ABC transporter [Agrobacterium radiobacter K84] Length = 386 Back     alignment and organism information
>gi|241204915|ref|YP_002976011.1| hypothetical protein Rleg_2195 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 394 Back     alignment and organism information
>gi|116252407|ref|YP_768245.1| transmembrane component of ABC transporter [Rhizobium leguminosarum bv. viciae 3841] Length = 389 Back     alignment and organism information
>gi|254710104|ref|ZP_05171915.1| Sulfate transporter/antisigma-factor [Brucella pinnipedialis B2/94] Length = 391 Back     alignment and organism information
>gi|254693733|ref|ZP_05155561.1| hypothetical protein Babob3T_03544 [Brucella abortus bv. 3 str. Tulya] Length = 391 Back     alignment and organism information
>gi|189024185|ref|YP_001934953.1| Sulfate transporter/antisigma-factor [Brucella abortus S19] Length = 390 Back     alignment and organism information
>gi|327190640|gb|EGE57728.1| putative ABC transporter, permease protein [Rhizobium etli CNPAF512] Length = 383 Back     alignment and organism information
>gi|190892035|ref|YP_001978577.1| probable ABC transporter, permease protein [Rhizobium etli CIAT 652] Length = 389 Back     alignment and organism information
>gi|23501899|ref|NP_698026.1| toulene ABC transporter permease [Brucella suis 1330] Length = 391 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target373 ABC transporter [Candidatus Liberibacter asiaticus str.
pfam02405215 pfam02405, DUF140, Domain of unknown function DUF140 9e-58
TIGR00056259 TIGR00056, TIGR00056, conserved hypothetical integral m 3e-51
PLN03100292 PLN03100, PLN03100, Permease subunit of ER-derived-lipi 1e-17
COG0767267 COG0767, Ttg2B, ABC-type transport system involved in r 6e-58
>gnl|CDD|145511 pfam02405, DUF140, Domain of unknown function DUF140 Back     alignment and domain information
>gnl|CDD|129166 TIGR00056, TIGR00056, conserved hypothetical integral membrane protein Back     alignment and domain information
>gnl|CDD|178648 PLN03100, PLN03100, Permease subunit of ER-derived-lipid transporter; Provisional Back     alignment and domain information
>gnl|CDD|31110 COG0767, Ttg2B, ABC-type transport system involved in resistance to organic solvents, permease component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 373 ABC transporter [Candidatus Liberibacter asiaticus str.
TIGR00056275 TIGR00056 conserved hypothetical protein; InterPro: IPR 100.0
COG0767267 Ttg2B ABC-type transport system involved in resistance 100.0
pfam02405215 DUF140 Domain of unknown function DUF140. This domain h 100.0
cd06844100 STAS Sulphate Transporter and Anti-Sigma factor antagon 98.32
cd0704399 STAS_anti-anti-sigma_factors Sulphate Transporter and A 98.25
COG311399 Predicted NTP binding protein (contains STAS domain) [G 98.24
pfam01740106 STAS STAS domain. The STAS (after Sulphate Transporter 98.06
TIGR02886106 spore_II_AA anti-sigma F factor antagonist; InterPro: I 97.74
COG1366117 SpoIIAA Anti-anti-sigma regulatory factor (antagonist o 97.58
cd07042107 STAS_SulP_like_sulfate_transporter Sulphate Transporter 97.35
cd07041109 STAS_RsbR_RsbS_like Sulphate Transporter and Anti-Sigma 96.69
TIGR00377109 ant_ant_sig anti-anti-sigma factor; InterPro: IPR003658 96.03
>TIGR00056 TIGR00056 conserved hypothetical protein; InterPro: IPR003453 This domain has no known function nor do any of the proteins that possess it Back     alignment and domain information
>COG0767 Ttg2B ABC-type transport system involved in resistance to organic solvents, permease component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>pfam02405 DUF140 Domain of unknown function DUF140 Back     alignment and domain information
>cd06844 STAS Sulphate Transporter and Anti-Sigma factor antagonist domain found in the C-terminal region of sulphate transporters as well as in bacterial and archaeal proteins involved in the regulation of sigma factors Back     alignment and domain information
>cd07043 STAS_anti-anti-sigma_factors Sulphate Transporter and Anti-Sigma factor antagonist) domain of anti-anti-sigma factors, key regulators of anti-sigma factors by phosphorylation Back     alignment and domain information
>COG3113 Predicted NTP binding protein (contains STAS domain) [General function prediction only] Back     alignment and domain information
>pfam01740 STAS STAS domain Back     alignment and domain information
>TIGR02886 spore_II_AA anti-sigma F factor antagonist; InterPro: IPR014237 This represents the anti-sigma F factor antagonist, also known as stage II sporulation protein AA Back     alignment and domain information
>COG1366 SpoIIAA Anti-anti-sigma regulatory factor (antagonist of anti-sigma factor) [Signal transduction mechanisms] Back     alignment and domain information
>cd07042 STAS_SulP_like_sulfate_transporter Sulphate Transporter and Anti-Sigma factor antagonist domain of SulP-like sulfate transporters, plays a role in the function and regulation of the transport activity, proposed general NTP binding function Back     alignment and domain information
>cd07041 STAS_RsbR_RsbS_like Sulphate Transporter and Anti-Sigma factor antagonist domain of the "stressosome" complex proteins RsbS and RsbR, regulators of the bacterial stress activated alternative sigma factor sigma-B by phosphorylation Back     alignment and domain information
>TIGR00377 ant_ant_sig anti-anti-sigma factor; InterPro: IPR003658 An anti-sigma factor antagonist is an anti-anti-sigma factor, which relieves inhibition of sigma factor activity by the anti-sigma factor Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target373 ABC transporter [Candidatus Liberibacter asiaticus str.
1th8_B116 Anti-sigma F factor antagonist; SPOIIAB, SPOIIAA, anti- 98.04
1sbo_A110 Putative anti-sigma factor antagonist TM1442; open sand 98.03
2ka5_A125 Putative anti-sigma factor antagonist TM_1081; termotog 97.87
1h4x_A117 SPOIIAA, anti-sigma F factor antagonist; cell different 97.85
2vy9_A123 Anti-sigma-factor antagonist; gene regulation, RSBS, st 97.62
3oir_A135 Sulfate transporter sulfate transporter family PR; PSI- 97.35
3mgl_A130 Sulfate permease family protein; PSI2, MCSG, structural 97.05
3oiz_A99 Antisigma-factor antagonist, STAS; PSI-2, midwest cente 96.95
3llo_A143 Prestin; STAS domain, cell shape, glycoprotein, membran 96.89
>1th8_B Anti-sigma F factor antagonist; SPOIIAB, SPOIIAA, anti-ANTI-sigma, sporulation, serine kinase, transcription; HET: ADP; 2.40A {Geobacillus stearothermophilus} SCOP: c.13.2.1 PDB: 1thn_B* 1tid_B* 1til_B* 1auz_A 1buz_A Back     alignment and structure
Probab=98.04  E-value=2.6e-05  Score=54.41  Aligned_cols=86  Identities=16%  Similarity=0.345  Sum_probs=72.5

Q ss_pred             CCCEEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHHH---HCCCCCCCCCCCHHHH
Q ss_conf             5882799984035635522007999986431167880899701051521299999999997---5187643158991269
Q gi|254780138|r    3 ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME---KYHGKIKLQGVSTHIE   79 (373)
Q Consensus         3 ~dG~~vL~LsGdWTl~~l~~l~~~l~~~L~~~~~~~~i~iDls~i~~lDTAGA~lL~~l~~---~~~~~~~~~~l~~~~~   79 (373)
                      +|+..++++.|+.+..+..++++.+.+.+... ..+.+++|+++++++||+|...|.++.+   +.+.+..+.+.++..+
T Consensus        10 ~~~v~vv~l~G~l~~~~~~~l~~~l~~~~~~~-~~~~liiDl~~v~~idssgl~~L~~~~~~~~~~g~~l~l~~~~~~v~   88 (116)
T 1th8_B           10 KQDVLIVRLSGELDHHTAEELREQVTDVLENR-AIRHIVLNLGQLTFMDSSGLGVILGRYKQIKNVGGQMVVCAVSPAVK   88 (116)
T ss_dssp             ETTEEEEEEEEEESHHHHHHHHHHHHHHHHSS-CCCEEEEEEEEEEEECHHHHHHHHHHHHHHHHTTCCEEEESCCHHHH
T ss_pred             ECCEEEEEEEEEEEHHHHHHHHHHHHHHHHHC-CCCEEEEEECCCCEECHHHHHHHHHHHHHHHHCCCEEEEEECCHHHH
T ss_conf             89999999999999899999999999999718-99699999569835167999999999999995899899996898999


Q ss_pred             HHHHHHHHHH
Q ss_conf             9999886422
Q gi|254780138|r   80 QLFSLISFTH   89 (373)
Q Consensus        80 ~Ll~Ll~~~~   89 (373)
                      +.++......
T Consensus        89 ~~l~~~gl~~   98 (116)
T 1th8_B           89 RLFDMSGLFK   98 (116)
T ss_dssp             HHHHHHTGGG
T ss_pred             HHHHHCCCCC
T ss_conf             9999839977



>1sbo_A Putative anti-sigma factor antagonist TM1442; open sandwich, JCSG, structural genomics, joint center for structural genomics, PSI; NMR {Thermotoga maritima} SCOP: c.13.2.1 PDB: 1t6r_A* 1vc1_A Back     alignment and structure
>2ka5_A Putative anti-sigma factor antagonist TM_1081; termotoga marithima, phosphoprotein, structural genomics, PSI-2, protein structure initiative; NMR {Thermotoga maritima} PDB: 3f43_A* Back     alignment and structure
>1h4x_A SPOIIAA, anti-sigma F factor antagonist; cell differentiation, crystallography, phosphorylation, sigma factor, sporulation; HET: SEP; 1.16A {Bacillus sphaericus} SCOP: c.13.2.1 PDB: 1h4z_A 1h4y_A Back     alignment and structure
>2vy9_A Anti-sigma-factor antagonist; gene regulation, RSBS, stressosome, STAS domain, bacillus subtilis; 2.3A {Moorella thermoacetica} Back     alignment and structure
>3oir_A Sulfate transporter sulfate transporter family PR; PSI-2, midwest center for structural genomics, protein struc initiative, MCSG; HET: MSE; 1.85A {Wolinella succinogenes} Back     alignment and structure
>3mgl_A Sulfate permease family protein; PSI2, MCSG, structural genomics, protein structure initiative; 2.25A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3oiz_A Antisigma-factor antagonist, STAS; PSI-2, midwest center for structural genomics, protein struc initiative, MCSG, STAS domain; 1.65A {Rhodobacter sphaeroides} PDB: 3lkl_A Back     alignment and structure
>3llo_A Prestin; STAS domain, cell shape, glycoprotein, membrane, motor prote transmembrane; HET: BOG; 1.57A {Rattus norvegicus} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target373 ABC transporter [Candidatus Liberibacter asiaticus str.
d1vc1a_110 Anti-sigma factor antagonist SpoIIaa {Thermotoga mariti 98.22
d1th8b_115 Anti-sigma factor antagonist SpoIIaa {Bacillus stearoth 98.04
d1h4xa_111 Anti-sigma factor antagonist SpoIIaa {Bacillus sphaeric 97.89
>d1vc1a_ c.13.2.1 (A:) Anti-sigma factor antagonist SpoIIaa {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: SpoIIaa-like
superfamily: SpoIIaa-like
family: Anti-sigma factor antagonist SpoIIaa
domain: Anti-sigma factor antagonist SpoIIaa
species: Thermotoga maritima [TaxId: 2336]
Probab=98.22  E-value=4.2e-06  Score=58.24  Aligned_cols=86  Identities=15%  Similarity=0.334  Sum_probs=73.0

Q ss_pred             CCCCEEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHHHH---CCCCCCCCCCCHHH
Q ss_conf             858827999840356355220079999864311678808997010515212999999999975---18764315899126
Q gi|254780138|r    2 SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK---YHGKIKLQGVSTHI   78 (373)
Q Consensus         2 s~dG~~vL~LsGdWTl~~l~~l~~~l~~~L~~~~~~~~i~iDls~i~~lDTAGA~lL~~l~~~---~~~~~~~~~l~~~~   78 (373)
                      .+++..++++.|+++..+...+++.+.+.+... ..+.+++|+++++.+||+|+..|.++.+.   .+.+..+.+.++..
T Consensus        10 ~~~~~~vv~l~G~l~~~~~~~~~~~l~~~~~~~-~~~~vvid~~~v~~iDssg~~~l~~~~~~~~~~~~~l~l~~~~~~v   88 (110)
T d1vc1a_          10 EQDDKAIVRVQGDIDAYNSSELKEQLRNFISTT-SKKKIVLDLSSVSYMDSAGLGTLVVILKDAKINGKEFILSSLKESI   88 (110)
T ss_dssp             EETTEEEEEEESCBSTTTHHHHHHHHHHHHHHC-CCSEEEEEEEECCCBCHHHHHHHHHHHHHHHHTTCEEEEESCCHHH
T ss_pred             EECCEEEEEEEEEEEHHHHHHHHHHHHHHHHCC-CCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHH
T ss_conf             999999999998999699999999999887458-9879999989997658799999999999999689979999499999


Q ss_pred             HHHHHHHHHH
Q ss_conf             9999988642
Q gi|254780138|r   79 EQLFSLISFT   88 (373)
Q Consensus        79 ~~Ll~Ll~~~   88 (373)
                      +++++.....
T Consensus        89 ~~~l~~~gl~   98 (110)
T d1vc1a_          89 SRILKLTHLD   98 (110)
T ss_dssp             HHHHHHHTGG
T ss_pred             HHHHHHCCCC
T ss_conf             9999985998



>d1th8b_ c.13.2.1 (B:) Anti-sigma factor antagonist SpoIIaa {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1h4xa_ c.13.2.1 (A:) Anti-sigma factor antagonist SpoIIaa {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target373 ABC transporter [Candidatus Liberibacter asiaticus str.
1sbo_A_110 Putative anti-sigma factor antagonist TM1442; open 98.26
1th8_B_116 Anti-sigma F factor antagonist; SPOIIAB, SPOIIAA, 98.11
1h4x_A_117 SPOIIAA, anti-sigma F factor antagonist; cell diff 97.95
2ka5_A_125 Putative anti-sigma factor antagonist TM_1081; ter 97.87
2vy9_A_123 Anti-sigma-factor antagonist; gene regulation, RSB 97.83
3ih8_A_310-456147 Salt-tolerant glutaminase; hydrolase; 2.30A {Micro 96.09
>1sbo_A (A:) Putative anti-sigma factor antagonist TM1442; open sandwich, JCSG, structural genomics, joint center for structural genomics, PSI; NMR {Thermotoga maritima} Back     alignment and structure
Probab=98.26  E-value=7.7e-06  Score=59.15  Aligned_cols=87  Identities=15%  Similarity=0.313  Sum_probs=73.2

Q ss_pred             CCCEEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHHH---HCCCCCCCCCCCHHHH
Q ss_conf             5882799984035635522007999986431167880899701051521299999999997---5187643158991269
Q gi|254780138|r    3 ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME---KYHGKIKLQGVSTHIE   79 (373)
Q Consensus         3 ~dG~~vL~LsGdWTl~~l~~l~~~l~~~L~~~~~~~~i~iDls~i~~lDTAGA~lL~~l~~---~~~~~~~~~~l~~~~~   79 (373)
                      .++..++++.|+++..+...+.+.+.+.+... +.+.+++|+++++++|++|+..|.++.+   ..+.+....+.+++.+
T Consensus        11 ~~~~~vi~l~g~l~~~~~~~~~~~~~~~~~~~-~~~~viiD~s~v~~iDs~g~~~l~~~~~~~~~~g~~l~l~~~~~~v~   89 (110)
T 1sbo_A           11 QDDKAIVRVQGDIDAYNSSELKEQLRNFISTT-SKKKIVLDLSSVSYMDSAGLGTLVVILKDAKINGKEFILSSLKESIS   89 (110)
T ss_dssp             CSSEEEEEEESCBSTTTTTHHHHHHHTHHHHC-SCSEEEEECTTCCCBCHHHHHHHHHHHHHHHHTTCEEEEESCCHHHH
T ss_pred             ECCEEEEEEEEEEEHHHHHHHHHHHHHHHHCC-CCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHH
T ss_conf             99999999999998689899999999998469-99789999757977772599999999999997899899980998999


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99998864222
Q gi|254780138|r   80 QLFSLISFTHR   90 (373)
Q Consensus        80 ~Ll~Ll~~~~~   90 (373)
                      +.++.......
T Consensus        90 ~~l~~~g~~~~  100 (110)
T 1sbo_A           90 RILKLTHLDKI  100 (110)
T ss_dssp             HHHHHTTCGGG
T ss_pred             HHHHHCCCCCE
T ss_conf             99998299866



>1th8_B (B:) Anti-sigma F factor antagonist; SPOIIAB, SPOIIAA, anti-ANTI-sigma, sporulation, serine kinase, transcription; HET: ADP; 2.40A {Geobacillus stearothermophilus} Back     alignment and structure
>1h4x_A (A:) SPOIIAA, anti-sigma F factor antagonist; cell differentiation, crystallography, phosphorylation, sigma factor, sporulation; HET: SEP; 1.16A {Bacillus sphaericus} Back     alignment and structure
>2ka5_A (A:) Putative anti-sigma factor antagonist TM_1081; termotoga marithima, phosphoprotein, structural genomics, PSI-2, protein structure initiative; NMR {Thermotoga maritima} PDB: 3f43_A* Back     alignment and structure
>2vy9_A (A:) Anti-sigma-factor antagonist; gene regulation, RSBS, stressosome, STAS domain, bacillus subtilis; 2.3A {Moorella thermoacetica} Back     alignment and structure
>3ih8_A (A:310-456) Salt-tolerant glutaminase; hydrolase; 2.30A {Micrococcus luteus} PDB: 3if5_A 3ih9_A 3iha_A* 3ihb_A 2dfw_A Back     alignment and structure