254780140

254780140

putative ABC transporter, substrate-binding protein

GeneID in NCBI database:8209115Locus tag:CLIBASIA_00095
Protein GI in NCBI database:254780140Protein Accession:YP_003064553.1
Gene range:+(17371, 18729)Protein Length:452aa
Gene description:putative ABC transporter, substrate-binding protein
COG prediction:[Q] ABC-type transport system involved in resistance to organic solvents, periplasmic component
KEGG prediction:putative ABC transporter, substrate-binding protein; K02067 putative ABC transport system substrate-binding protein
SEED prediction:putative solute-binding component of ABC transporter
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450--
MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPKH
cccccHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEccccccccccccEEEccEEEEEEEEEEEccccccEEEEEEEEccccccccccEEEEEEccccEEEEEEEcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHcccccccccccccccc
cccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEcccccccccccEEEccEEEEEEEEEEEccccccEEEEEEEEccccccccccEEEEEEEccccEEEEEEcccccccccccccccccccccEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcHHHHHccHHHcccHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccEEEEccccccEccccccc
mesknyytsVGLFVVSILFFSFFSIYWlsrsnqydgpmAEVIIRipgsvdglstdssvrfngipvGRIVGLfldqeypnhslakalirpdtplypsttatIRTQGLAGITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISnaentskkisDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHidkmmhttqvtphssdskntfNTITDLITSLDKMIKAIDLQKVNQILENIQVssnnfvkssdQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISalkennslFKDAQRAMHTFRDTSEKINRYIpsignnlqnfsqsGLNDIQNLVRKLQETVNHFDDClnnfernpqdivwgrekgsvkiykpkh
MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENiekpltttiANIETISTVLANNISHIDKMMHTTqvtphssdskntfNTITDLITSLDKMIKAIDLQKVNQILENIQVssnnfvkssdQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLeniadstsnmRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNnfernpqdivwgrekgsvkiykpkh
MESKNYYTSVGlfvvsilffsffsiYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKiistintienitsnLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPKH
***KNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELST********************ITATPSG*********NTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHT***************************************************************VRETTQTFQEV**************************IADS*SNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINN****************AMHTFRDTSEKINRY***************LNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREK**********
MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENT*********HIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHT*********SKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPKH
*ESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIY****
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPKH
MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPKH
MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRFNGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKEKKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVNQILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNISALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERNPQDIVWGREKGSVKIYKPKH

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target452 putative ABC transporter, substrate-binding protein [Ca
254781029 1828 chemotaxis sensory transducer [Candidatus Liberiba 0.018
>gi|254781029|ref|YP_003065442.1| chemotaxis sensory transducer [Candidatus Liberibacter asiaticus str. psy62] Length = 1828 Back     alignment
 Score = 32.3 bits (72), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 109/244 (44%), Gaps = 27/244 (11%)

Query: 136  MITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTIANIETISTVLANNIS 195
            +I+     +N        T+ +I++++ HI  ++    K     I ++  IS V    +S
Sbjct: 1340 IISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMS 1399

Query: 196  HI-DKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIK-AIDL--------QKVNQILEN 245
             I  K    +Q+   S DS     + T L  SLDK     +DL         +  + + +
Sbjct: 1400 EIVSKFDKNSQILIKSHDSLMKAQSETKL--SLDKDANNLVDLTSRLVSKSSEAQKFVMS 1457

Query: 246  IQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAFLE-NI 304
            I V     V+ +D + +TV  V+  T + Q    KID  LS+  ++  S++T   ++ N+
Sbjct: 1458 ILVDVKKIVEQADFLSDTV--VKNMTDSIQSSFIKIDGTLSNIETR--SRDTVRLIDHNL 1513

Query: 305  AD----STSNMRSSISAIREIT-----DQRQKIISTINTIENITSNLND-SSQKFAELMS 354
            AD    +   + S+   ++E +       RQKI STI  IENI S L + S Q     + 
Sbjct: 1514 ADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKSDQSMQVFLD 1573

Query: 355  KINN 358
             +NN
Sbjct: 1574 SLNN 1577

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target452 putative ABC transporter, substrate-binding protein [Ca
315122742448 putative ABC transporter, substrate-binding protein [Ca 1 1e-156
116252405456 solute-binding component of ABC transporter [Rhizobium 1 2e-71
190892033456 putative ABC transporter, substrate-binding protein [Rh 1 2e-71
241204913456 Mammalian cell entry related domain protein [Rhizobium 1 3e-71
327190642456 putative ABC transporter, substrate-binding protein [Rh 1 4e-71
209549576456 hypothetical protein Rleg2_1982 [Rhizobium leguminosaru 1 5e-71
86357962456 putative ABC transporter protein [Rhizobium etli CFN 42 1 1e-70
222086198456 ABC transporter protein [Agrobacterium radiobacter K84] 1 5e-68
325293032456 ABC transporter substrate-binding protein [Agrobacteriu 1 2e-61
222148409455 ABC transporter substrate binding protein [Agrobacteriu 1 2e-61
>gi|315122742|ref|YP_004063231.1| putative ABC transporter, substrate-binding protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 448 Back     alignment and organism information
 Score =  556 bits (1432), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 273/452 (60%), Positives = 351/452 (77%), Gaps = 4/452 (0%)

Query: 1   MESKNYYTSVGLFVVSILFFSFFSIYWLSRSNQYDGPMAEVIIRIPGSVDGLSTDSSVRF 60
           ME KNYYT+VG F +SIL  SF+SIYWLSR++QY+GP  E+IIRIPGSV+GL+ +SSVRF
Sbjct: 1   MEVKNYYTAVGFFAISILLLSFYSIYWLSRNDQYNGPTTELIIRIPGSVEGLAVNSSVRF 60

Query: 61  NGIPVGRIVGLFLDQEYPNHSLAKALIRPDTPLYPSTTATIRTQGLAGITYIELSTLRKE 120
           NGIP+G + GLF+D++ P++S+A+ L+R D PLYPST A I+ QG+ G+TYIELST R E
Sbjct: 61  NGIPIGHVTGLFVDKDNPHYSMAQTLVRVDVPLYPSTKAMIKAQGITGMTYIELSTERTE 120

Query: 121 KKTIFQIATERNQRAMITATPSGINYFISNAENTSKKISDSSRHIQKIIENIEKPLTTTI 180
             T+FQ AT+  + AMITA PSGIN+ +S AE+T  KI+ SS  IQKII N + PL   I
Sbjct: 121 NYTLFQTATKEKKIAMITAIPSGINHLLSTAEDTLNKINVSSDQIQKIINNADNPLNRII 180

Query: 181 ANIETISTVLANNISHIDKMMHTTQVTPHSSDSKNTFNTITDLITSLDKMIKAIDLQKVN 240
            N ETIST+L +N+S +DKM+H       + D   T +  +D ITSL+K IKA+D+QK+N
Sbjct: 181 KNFETISTILVDNVSDLDKMIHRKNNV--AVDFTKTLSNTSDFITSLNKTIKAVDIQKIN 238

Query: 241 QILENIQVSSNNFVKSSDQVINTVHDVRETTQTFQEVGQKIDHLLSDFSSKMKSKETSAF 300
           QI+ENIQV SNNF+KSSDQV NT++D++ETT TFQ VG+K DHLLSD SS++ SKE   F
Sbjct: 239 QIIENIQVVSNNFIKSSDQVTNTINDLQETTHTFQGVGKKADHLLSDVSSQIHSKEAFDF 298

Query: 301 LENIADSTSNMRSSISAIREITDQRQKIISTINTIENITSNLNDSSQKFAELMSKINNIS 360
            ENI++S+SN+R+S SAIREITD  QKII TI+TIE +T NLN+SS K  ELM+ IN+ +
Sbjct: 299 WENISESSSNIRNSTSAIREITDHSQKIILTIDTIEKMTENLNNSSIKLKELMTTINSFT 358

Query: 361 ALKENNSLFKDAQRAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVN 420
             +   SL +DAQ+A+ +F++T+EKIN YIP I  NLQNFS SGL D+QNL+R LQETV 
Sbjct: 359 DSEGKKSLIEDAQKAIRSFQNTTEKINEYIPPIAKNLQNFSNSGLYDLQNLIRNLQETVG 418

Query: 421 HFDDCLNNFERNPQDIVWGREKGSVKIYKPKH 452
           HFDD L+NFERNPQ+I+WG+E  +VK YKPKH
Sbjct: 419 HFDDSLSNFERNPQNIIWGKE--TVKQYKPKH 448


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|116252405|ref|YP_768243.1| solute-binding component of ABC transporter [Rhizobium leguminosarum bv. viciae 3841] Length = 456 Back     alignment and organism information
>gi|190892033|ref|YP_001978575.1| putative ABC transporter, substrate-binding protein [Rhizobium etli CIAT 652] Length = 456 Back     alignment and organism information
>gi|241204913|ref|YP_002976009.1| Mammalian cell entry related domain protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 456 Back     alignment and organism information
>gi|327190642|gb|EGE57730.1| putative ABC transporter, substrate-binding protein [Rhizobium etli CNPAF512] Length = 456 Back     alignment and organism information
>gi|209549576|ref|YP_002281493.1| hypothetical protein Rleg2_1982 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 456 Back     alignment and organism information
>gi|86357962|ref|YP_469854.1| putative ABC transporter protein [Rhizobium etli CFN 42] Length = 456 Back     alignment and organism information
>gi|222086198|ref|YP_002544730.1| ABC transporter protein [Agrobacterium radiobacter K84] Length = 456 Back     alignment and organism information
>gi|325293032|ref|YP_004278896.1| ABC transporter substrate-binding protein [Agrobacterium sp. H13-3] Length = 456 Back     alignment and organism information
>gi|222148409|ref|YP_002549366.1| ABC transporter substrate binding protein [Agrobacterium vitis S4] Length = 455 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target452 putative ABC transporter, substrate-binding protein [Ca
pfam0247080 pfam02470, MCE, mce related protein 8e-09
TIGR00996291 TIGR00996, Mtu_fam_mce, virulence factor Mce family pro 3e-06
smart00283262 smart00283, MA, Methyl-accepting chemotaxis-like domain 4e-04
COG1463359 COG1463, Ttg2C, ABC-type transport system involved in r 8e-18
>gnl|CDD|111376 pfam02470, MCE, mce related protein Back     alignment and domain information
>gnl|CDD|162151 TIGR00996, Mtu_fam_mce, virulence factor Mce family protein Back     alignment and domain information
>gnl|CDD|128579 smart00283, MA, Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer) Back     alignment and domain information
>gnl|CDD|31652 COG1463, Ttg2C, ABC-type transport system involved in resistance to organic solvents, periplasmic component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 452 putative ABC transporter, substrate-binding protein [Ca
COG1463359 Ttg2C ABC-type transport system involved in resistance 99.96
TIGR00996304 Mtu_fam_mce virulence factor Mce family protein; InterP 99.87
COG3008553 PqiB Paraquat-inducible protein B [General function pre 99.16
PRK10807546 paraquat-inducible protein B; Provisional 99.81
pfam0247080 MCE mce related protein. This family of proteins contai 99.46
PRK10807546 paraquat-inducible protein B; Provisional 99.15
COG3008553 PqiB Paraquat-inducible protein B [General function pre 98.65
PRK09793533 methyl-accepting protein IV; Provisional 98.14
KOG09941758 consensus 97.76
pfam00015213 MCPsignal Methyl-accepting chemotaxis protein (MCP) sig 96.94
PRK09793533 methyl-accepting protein IV; Provisional 96.3
smart00283262 MA Methyl-accepting chemotaxis-like domains (chemotaxis 98.0
pfam00015213 MCPsignal Methyl-accepting chemotaxis protein (MCP) sig 97.46
COG0840408 Tar Methyl-accepting chemotaxis protein [Cell motility 97.3
KOG09941758 consensus 97.24
TIGR00996304 Mtu_fam_mce virulence factor Mce family protein; InterP 95.98
COG1463359 Ttg2C ABC-type transport system involved in resistance 95.42
COG0840408 Tar Methyl-accepting chemotaxis protein [Cell motility 94.45
COG1511 780 Predicted membrane protein [Function unknown] 92.72
>COG1463 Ttg2C ABC-type transport system involved in resistance to organic solvents, periplasmic component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR00996 Mtu_fam_mce virulence factor Mce family protein; InterPro: IPR005693 Mycobacterial species are usually slender, curved rods with a unique cell wall of complex waxes and glycolipids Back     alignment and domain information
>COG3008 PqiB Paraquat-inducible protein B [General function prediction only] Back     alignment and domain information
>PRK10807 paraquat-inducible protein B; Provisional Back     alignment and domain information
>pfam02470 MCE mce related protein Back     alignment and domain information
>PRK10807 paraquat-inducible protein B; Provisional Back     alignment and domain information
>COG3008 PqiB Paraquat-inducible protein B [General function prediction only] Back     alignment and domain information
>PRK09793 methyl-accepting protein IV; Provisional Back     alignment and domain information
>KOG0994 consensus Back     alignment and domain information
>pfam00015 MCPsignal Methyl-accepting chemotaxis protein (MCP) signaling domain Back     alignment and domain information
>PRK09793 methyl-accepting protein IV; Provisional Back     alignment and domain information
>smart00283 MA Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer) Back     alignment and domain information
>pfam00015 MCPsignal Methyl-accepting chemotaxis protein (MCP) signaling domain Back     alignment and domain information
>COG0840 Tar Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>KOG0994 consensus Back     alignment and domain information
>TIGR00996 Mtu_fam_mce virulence factor Mce family protein; InterPro: IPR005693 Mycobacterial species are usually slender, curved rods with a unique cell wall of complex waxes and glycolipids Back     alignment and domain information
>COG1463 Ttg2C ABC-type transport system involved in resistance to organic solvents, periplasmic component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG0840 Tar Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>COG1511 Predicted membrane protein [Function unknown] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target452 putative ABC transporter, substrate-binding protein [Ca
2ch7_A309 Methyl-accepting chemotaxis protein; receptor, four-hel 97.81
2ch7_A309 Methyl-accepting chemotaxis protein; receptor, four-hel 96.53
1qu7_A227 Methyl-accepting chemotaxis protein I; serine, four hel 96.08
1qu7_A227 Methyl-accepting chemotaxis protein I; serine, four hel 97.1
>2ch7_A Methyl-accepting chemotaxis protein; receptor, four-helix bundle, signal transduction, methyl-accepting receptor; 2.5A {Thermotoga maritima} SCOP: h.4.5.1 PDB: 2ch7_B Back     alignment and structure
Probab=97.81  E-value=0.002  Score=40.35  Aligned_cols=23  Identities=0%  Similarity=0.211  Sum_probs=7.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999998
Q gi|254780140|r  408 IQNLVRKLQETVNHFDDCLNNFE  430 (452)
Q Consensus       408 ~~~~~~~~~~~~~~l~~~~~~l~  430 (452)
                      +...+.++...+..+...+..+.
T Consensus       273 ~~~~~~~l~~~~~~l~~~~~~l~  295 (309)
T 2ch7_A          273 VNARLQEISASTEEVTSRVQTIR  295 (309)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999



>2ch7_A Methyl-accepting chemotaxis protein; receptor, four-helix bundle, signal transduction, methyl-accepting receptor; 2.5A {Thermotoga maritima} SCOP: h.4.5.1 PDB: 2ch7_B Back     alignment and structure
>1qu7_A Methyl-accepting chemotaxis protein I; serine, four helical-bundle, signaling protein; 2.60A {Escherichia coli} SCOP: h.4.5.1 Back     alignment and structure
>1qu7_A Methyl-accepting chemotaxis protein I; serine, four helical-bundle, signaling protein; 2.60A {Escherichia coli} SCOP: h.4.5.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 452 putative ABC transporter, substrate-binding protei
3fho_A_1-326326 (A:1-326) ATP-dependent RNA helicase DBP5; mRNA ex 1e-05

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target452 putative ABC transporter, substrate-binding protein [Ca
3g67_A_213 Methyl-accepting chemotaxis protein; four-helix bu 96.64
3g67_A_213 Methyl-accepting chemotaxis protein; four-helix bu 96.59
2ch7_A_52-256205 Methyl-accepting chemotaxis protein; receptor, fou 95.22
>3g67_A (A:) Methyl-accepting chemotaxis protein; four-helix bundle, signaling protein; 2.17A {Thermotoga maritima} PDB: 3g6b_A Back     alignment and structure
Probab=96.64  E-value=0.046  Score=31.80  Aligned_cols=58  Identities=9%  Similarity=0.176  Sum_probs=22.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             99999999999999999999999998646428999999999999999999999999878
Q gi|254780140|r  374 RAMHTFRDTSEKINRYIPSIGNNLQNFSQSGLNDIQNLVRKLQETVNHFDDCLNNFERN  432 (452)
Q Consensus       374 ~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~l~~~  432 (452)
                      ..+..+......+...+..+...+..... ...++....+++...+..+...+..+...
T Consensus       151 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~i~~~~~e~~~~~~~i~~~i~~i~~~  208 (213)
T 3g67_A          151 ENLEFMANLFETVGKTLQNMVRFMENNVK-LLQEVRNSLDTSKESLSEKSAEIDSATKV  208 (213)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999999999-99999999999999999999999999999



>3g67_A (A:) Methyl-accepting chemotaxis protein; four-helix bundle, signaling protein; 2.17A {Thermotoga maritima} PDB: 3g6b_A Back     alignment and structure
>2ch7_A (A:52-256) Methyl-accepting chemotaxis protein; receptor, four-helix bundle, signal transduction, methyl-accepting receptor; 2.5A {Thermotoga maritima} Back     alignment and structure