254780141

254780141

putative ABC transporter protein

GeneID in NCBI database:8209116Locus tag:CLIBASIA_00100
Protein GI in NCBI database:254780141Protein Accession:YP_003064554.1
Gene range:+(18754, 19380)Protein Length:208aa
Gene description:putative ABC transporter protein
COG prediction:[R] ABC-type uncharacterized transport system, auxiliary component
KEGG prediction:putative ABC transporter protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSLPLSDN
cHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEcccccccccccccccEEEEEccccccccccccEEEEEcccHHHHHccccccccHHHHHHHHHHHHHHHcccEEccccccccccccEEEEEEEEEEEccccccEEEEEEEEEEEEccccEEEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
ccccHcHHHcHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEEcccccHHcccccEEEEccccHHHHHccccccccHHHHHHHHHHHHHHHcccEEEEEcccccccccEEEEEEHHHHEEccccccEEEEEEEEEEEccccEEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
MDKKLNKIIKKKIISCSLAVLLCTslsscffhnnpvniydltestkydeSVQRHIQLIITEpitekilnsediivrssPIEIQYLIgsqwsdklPRMIQLKLIANFenngkistvvkpnqgiyadyQIISAIRSFEINIDRHCAIITMSLKIInahdnslvgqkvFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDwtlsslplsdn
MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIitepitekilnseDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRisseiidwtlsslplsdn
MDkklnkiikkkiiSCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSLPLSDN
************IISCSLAVLLCTSLSSCFFHNNPVNIYD*****************IITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKP*QGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKV*************HFIQSLNRAFSRISSEIIDWTL*SLP****
MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSLPLSDN
***KLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSLPL***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSLPLSDN
MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSLPLSDN
MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSSLPLSDN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target208 putative ABC transporter protein [Candidatus Liberibact
315122743202 putative ABC transporter protein [Candidatus Liberibact 1 3e-72
302353422112 putative ABC transporter protein [Candidatus Liberibact 1 5e-58
190892032203 putative ABC transporter protein [Rhizobium etli CIAT 6 1 4e-36
327190643203 putative ABC transporter protein [Rhizobium etli CNPAF5 1 5e-36
86357961203 putative ABC transporter protein [Rhizobium etli CFN 42 1 1e-35
241204912203 hypothetical protein Rleg_2192 [Rhizobium leguminosarum 1 1e-35
218461268203 putative ABC transporter protein [Rhizobium etli Kim 5] 1 2e-35
209549575203 ABC transporter [Rhizobium leguminosarum bv. trifolii W 1 2e-35
116252404203 hypothetical protein RL2658 [Rhizobium leguminosarum bv 1 1e-34
15888954201 hypothetical protein Atu1644 [Agrobacterium tumefaciens 1 1e-34
>gi|315122743|ref|YP_004063232.1| putative ABC transporter protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 202 Back     alignment and organism information
 Score =  275 bits (702), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 169/204 (82%), Gaps = 2/204 (0%)

Query: 1   MDKKLNKIIKKKIISCSLAVLLCTSLSSCFFHNNPVNIYDLTESTKYDESVQRHIQLIIT 60
           MDKKL KI K   + C  A+ LC  LSSCF  N P NI+DLTESTK+++S+Q +++L I 
Sbjct: 1   MDKKLKKITKNMRL-CIPAISLCMFLSSCF-GNIPKNIFDLTESTKHNQSIQHNVRLTIN 58

Query: 61  EPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQ 120
           EP+T K L+S DIIVRSSP+EIQYLIGSQWSD+LPRM+QLKLIANFENNGKIST++KPNQ
Sbjct: 59  EPVTSKTLDSPDIIVRSSPVEIQYLIGSQWSDRLPRMVQLKLIANFENNGKISTIIKPNQ 118

Query: 121 GIYADYQIISAIRSFEINIDRHCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF 180
           GIY +YQI S IR+FEI+I  H AII +SLKII+ +  +++ QKVFHVEE  E+DNKL F
Sbjct: 119 GIYPNYQISSIIRAFEIDIHHHYAIIEISLKIIDINTGNIIAQKVFHVEEAFEEDNKLCF 178

Query: 181 IQSLNRAFSRISSEIIDWTLSSLP 204
           I+SLNRAFSRISSEII+WT+SSLP
Sbjct: 179 IESLNRAFSRISSEIINWTVSSLP 202


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|302353422|gb|ADL27917.1| putative ABC transporter protein [Candidatus Liberibacter asiaticus] Length = 112 Back     alignment and organism information
>gi|190892032|ref|YP_001978574.1| putative ABC transporter protein [Rhizobium etli CIAT 652] Length = 203 Back     alignment and organism information
>gi|327190643|gb|EGE57731.1| putative ABC transporter protein [Rhizobium etli CNPAF512] Length = 203 Back     alignment and organism information
>gi|86357961|ref|YP_469853.1| putative ABC transporter protein [Rhizobium etli CFN 42] Length = 203 Back     alignment and organism information
>gi|241204912|ref|YP_002976008.1| hypothetical protein Rleg_2192 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 203 Back     alignment and organism information
>gi|218461268|ref|ZP_03501359.1| putative ABC transporter protein [Rhizobium etli Kim 5] Length = 203 Back     alignment and organism information
>gi|209549575|ref|YP_002281492.1| ABC transporter [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 203 Back     alignment and organism information
>gi|116252404|ref|YP_768242.1| hypothetical protein RL2658 [Rhizobium leguminosarum bv. viciae 3841] Length = 203 Back     alignment and organism information
>gi|15888954|ref|NP_354635.1| hypothetical protein Atu1644 [Agrobacterium tumefaciens str. C58] Length = 201 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target208 putative ABC transporter protein [Candidatus Liberibact
pfam03886160 pfam03886, DUF330, Protein of unknown function (DUF330) 1e-16
COG3218205 COG3218, COG3218, ABC-type uncharacterized transport sy 2e-37
>gnl|CDD|146492 pfam03886, DUF330, Protein of unknown function (DUF330) Back     alignment and domain information
>gnl|CDD|33031 COG3218, COG3218, ABC-type uncharacterized transport system, auxiliary component [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 208 putative ABC transporter protein [Candidatus Liberibact
COG3218205 ABC-type uncharacterized transport system, auxiliary co 100.0
COG3009190 Uncharacterized protein conserved in bacteria [Function 99.96
PRK11627192 hypothetical protein; Provisional 98.74
COG3056204 Uncharacterized lipoprotein [Cell envelope biogenesis, 97.65
pfam11769202 DUF3313 Protein of unknown function (DUF3313). This a b 95.19
COG4380216 Uncharacterized protein conserved in bacteria [Function 92.89
pfam03886160 DUF330 Protein of unknown function (DUF330). The protei 99.97
pfam03923159 Lipoprotein_16 Uncharacterized lipoprotein. The functio 96.27
pfam05643215 DUF799 Putative bacterial lipoprotein (DUF799). This fa 96.87
pfam09927120 DUF2159 Predicted secreted (periplasmic) protein (DUF21 96.82
pfam03783207 CsgG Curli production assembly/transport component CsgG 96.26
COG5468172 Predicted secreted (periplasmic) protein [Function unkn 95.86
PRK02889 430 tolB translocation protein TolB; Provisional 93.31
COG1462252 CsgG Uncharacterized protein involved in formation of c 94.29
PRK12700230 flgH flagellar basal body L-ring protein; Reviewed 92.15
>COG3218 ABC-type uncharacterized transport system, auxiliary component [General function prediction only] Back     alignment and domain information
>COG3009 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK11627 hypothetical protein; Provisional Back     alignment and domain information
>COG3056 Uncharacterized lipoprotein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam11769 DUF3313 Protein of unknown function (DUF3313) Back     alignment and domain information
>COG4380 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam03886 DUF330 Protein of unknown function (DUF330) Back     alignment and domain information
>pfam03923 Lipoprotein_16 Uncharacterized lipoprotein Back     alignment and domain information
>pfam05643 DUF799 Putative bacterial lipoprotein (DUF799) Back     alignment and domain information
>pfam09927 DUF2159 Predicted secreted (periplasmic) protein (DUF2159) Back     alignment and domain information
>pfam03783 CsgG Curli production assembly/transport component CsgG Back     alignment and domain information
>COG5468 Predicted secreted (periplasmic) protein [Function unknown] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG1462 CsgG Uncharacterized protein involved in formation of curli polymers [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12700 flgH flagellar basal body L-ring protein; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target208 putative ABC transporter protein [Candidatus Liberibact
2iqi_A192 Crystal Structure Of Protein Xcc0632 From Xanthomon 6e-20
>gi|119390266|pdb|2IQI|A Chain A, Crystal Structure Of Protein Xcc0632 From Xanthomonas Campestris, Pfam Duf330 Length = 192 Back     alignment and structure
 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 45/174 (25%), Positives = 86/174 (49%), Gaps = 4/174 (2%)

Query: 31  FHNNPVNIYDLTE-STKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQ 89
               P  IY  T   T      Q   QL++ +P   +I++S  I VR +P E+Q   G+ 
Sbjct: 5   GDQKPATIYAPTVRVTPNPAWPQVSWQLLVAKPSAARIIDSPRINVRPTPGELQVYHGAG 64

Query: 90  WSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINI---DRHCAII 146
           W+     M++  ++  FE++GKI+ V +   GI +DY++   +R FE +        A I
Sbjct: 65  WAQPATDMLEDSVVRAFEDSGKIAAVARIGAGIRSDYKLAIDVRRFESDYAGQSLPAATI 124

Query: 147 TMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTL 200
            ++ K++++ D  +V  + F V       +      +  +A +++++E++ WTL
Sbjct: 125 ELNAKLLHSSDQRVVASRTFTVARPSSSTDTAAVAAAFEQALTQVTTELVGWTL 178


Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target208 putative ABC transporter protein [Candidatus Liberibact
2iqi_A192 Hypothetical protein XCC0632; structural genomics, PSI- 3e-34
>2iqi_A Hypothetical protein XCC0632; structural genomics, PSI-2, protein structure initiative; 2.70A {Xanthomonas campestris PV} SCOP: c.51.6.2 Length = 192 Back     alignment and structure
 Score =  139 bits (352), Expect = 3e-34
 Identities = 43/172 (25%), Positives = 88/172 (51%), Gaps = 4/172 (2%)

Query: 35  PVNIYDLTESTKYDESVQR-HIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDK 93
           P  IY  T     + +  +   QL++ +P   +I++S  I VR +P E+Q   G+ W+  
Sbjct: 9   PATIYAPTVRVTPNPAWPQVSWQLLVAKPSAARIIDSPRINVRPTPGELQVYHGAGWAQP 68

Query: 94  LPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRH---CAIITMSL 150
              M++  ++  FE++GKI+ V +   GI +DY++   +R FE +        A I ++ 
Sbjct: 69  ATDMLEDSVVRAFEDSGKIAAVARIGAGIRSDYKLAIDVRRFESDYAGQSLPAATIELNA 128

Query: 151 KIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSS 202
           K++++ D  +V  + F V       +      +  +A +++++E++ WTL +
Sbjct: 129 KLLHSSDQRVVASRTFTVARPSSSTDTAAVAAAFEQALTQVTTELVGWTLIT 180


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target208 putative ABC transporter protein [Candidatus Liberibact
2iqi_A192 Hypothetical protein XCC0632; structural genomics, PSI- 100.0
>2iqi_A Hypothetical protein XCC0632; structural genomics, PSI-2, protein structure initiative; 2.70A {Xanthomonas campestris PV} SCOP: c.51.6.2 Back     alignment and structure
Probab=100.00  E-value=3.4e-36  Score=222.12  Aligned_cols=171  Identities=26%  Similarity=0.512  Sum_probs=157.3

Q ss_pred             CCCCCEEEECCCCCCCCCC-CCCCCCEEEECCCCCCCCCCCEEEEEECCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHC
Q ss_conf             9998607970788876666-666620898153012000686378994697699814660125689999999999997316
Q gi|254780141|r   32 HNNPVNIYDLTESTKYDES-VQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNG  110 (208)
Q Consensus        32 ~~~p~~~Y~L~~~~~~~~~-~~~~~~i~v~~~~~~~~l~~~~Iv~~~~~~~~~~~~~~rW~~~p~~~l~~~L~~~L~~~~  110 (208)
                      ..+|.++|.|+++....++ .+...+|.|.+|.++++||+++|+|+.++++++++.+|||+++|++||++.|.++|++.+
T Consensus         6 ~~~P~~~y~l~~~~~~~~~~p~~~~~l~V~~p~~p~~ld~~~Iv~~~~~~~l~~~~~~rWa~~~~~~l~~~L~~~L~~~~   85 (192)
T 2iqi_A            6 DQKPATIYAPTVRVTPNPAWPQVSWQLLVAKPSAARIIDSPRINVRPTPGELQVYHGAGWAQPATDMLEDSVVRAFEDSG   85 (192)
T ss_dssp             ----CEEECCCCCCCCCTTSCCCCSEEEECCCBCCTTTSSSSCEEESSTTCCEECTTEEESSCHHHHHHHHHHHHHHTTS
T ss_pred             CCCCCCEECCCCCCCCCCCCCCCCEEEEECCCCCHHHHCCCCEEEEECCCEEEECCCCCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             99996524369877899988987436998773411232677779993898787735782103778999999999999609


Q ss_pred             CCEEEECCCCCCCCCEEEEEEEEEEEEECCC---CEEEEEEEEEEEECCCCCEEEEEEEEEEEECCCCCHHHHHHHHHHH
Q ss_conf             9406503767778835999999999963587---4799999999994578827789999999952779988999999999
Q gi|254780141|r  111 KISTVVKPNQGIYADYQIISAIRSFEINIDR---HCAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRA  187 (208)
Q Consensus       111 ~~~~v~~~~~~~~~~~~L~~~I~~f~~~~~~---~~a~i~~~~~l~~~~~~~~~~~~~f~~~~~~~~~~~~~~v~Al~~A  187 (208)
                      .+..|.+++++.++||+|+++|++|++++++   ..+++.++|.+++.++++++++++|+.++|+.++++.++|+||++|
T Consensus        86 ~~~~v~~~~~~~~~d~~L~~~I~~F~~~~~~~~~~~a~~~~~~~l~~~~~~~v~~~~~f~~~~p~~~~~~~~lV~A~~~A  165 (192)
T 2iqi_A           86 KIAAVARIGAGIRSDYKLAIDVRRFESDYAGQSLPAATIELNAKLLHSSDQRVVASRTFTVARPSSSTDTAAVAAAFEQA  165 (192)
T ss_dssp             SCSEEECC-----CCEEEEEEEEEEEEECTTSSSCEEEEEEEEEEEETTTTEEEEEEEEEEEEECSSSSHHHHHHHHHHH
T ss_pred             CCCEEECCCCCCCCCEEEEEEEEEEEEEECCCCCEEEEEEEEEEEECCCCCCEEEEEEEEEEEECCCCCHHHHHHHHHHH
T ss_conf             97357568888887769999999988760688752799999888512789817899999999767889989999999999


Q ss_pred             HHHHHHHHHHHHHHH
Q ss_conf             999999999999973
Q gi|254780141|r  188 FSRISSEIIDWTLSS  202 (208)
Q Consensus       188 l~~l~~~ia~w~~~~  202 (208)
                      +++++++|++|+++.
T Consensus       166 l~~l~~~ia~w~~~~  180 (192)
T 2iqi_A          166 LTQVTTELVGWTLIT  180 (192)
T ss_dssp             HHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999987




Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 208 putative ABC transporter protein [Candidatus Liberibact
d2iqia1178 c.51.6.2 (A:32-209) Hypothetical protein XCC0632 {Xanth 4e-32
>d2iqia1 c.51.6.2 (A:32-209) Hypothetical protein XCC0632 {Xanthomonas campestris pv. campestris [TaxId: 340]} Length = 178 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Anticodon-binding domain-like
superfamily: XCC0632-like
family: XCC0632-like
domain: Hypothetical protein XCC0632
species: Xanthomonas campestris pv. campestris [TaxId: 340]
 Score =  131 bits (331), Expect = 4e-32
 Identities = 42/169 (24%), Positives = 87/169 (51%), Gaps = 4/169 (2%)

Query: 38  IYDLTESTKYDESVQR-HIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPR 96
           IY  T     + +  +   QL++ +P   +I++S  I VR +P E+Q   G+ W+     
Sbjct: 3   IYAPTVRVTPNPAWPQVSWQLLVAKPSAARIIDSPRINVRPTPGELQVYHGAGWAQPATD 62

Query: 97  MIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRH---CAIITMSLKII 153
           M++  ++  FE++GKI+ V +   GI +DY++   +R FE +        A I ++ K++
Sbjct: 63  MLEDSVVRAFEDSGKIAAVARIGAGIRSDYKLAIDVRRFESDYAGQSLPAATIELNAKLL 122

Query: 154 NAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTLSS 202
           ++ D  +V  + F V       +      +  +A +++++E++ WTL +
Sbjct: 123 HSSDQRVVASRTFTVARPSSSTDTAAVAAAFEQALTQVTTELVGWTLIT 171


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target208 putative ABC transporter protein [Candidatus Liberibact
d2iqia1178 Hypothetical protein XCC0632 {Xanthomonas campestris pv 100.0
>d2iqia1 c.51.6.2 (A:32-209) Hypothetical protein XCC0632 {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Anticodon-binding domain-like
superfamily: XCC0632-like
family: XCC0632-like
domain: Hypothetical protein XCC0632
species: Xanthomonas campestris pv. campestris [TaxId: 340]
Probab=100.00  E-value=2.1e-34  Score=210.70  Aligned_cols=167  Identities=26%  Similarity=0.500  Sum_probs=154.2

Q ss_pred             EEEECCCCCCCCCCC-CCCCCEEEECCCCCCCCCCCEEEEEECCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEE
Q ss_conf             079707888766666-6662089815301200068637899469769981466012568999999999999731694065
Q gi|254780141|r   37 NIYDLTESTKYDESV-QRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLIANFENNGKISTV  115 (208)
Q Consensus        37 ~~Y~L~~~~~~~~~~-~~~~~i~v~~~~~~~~l~~~~Iv~~~~~~~~~~~~~~rW~~~p~~~l~~~L~~~L~~~~~~~~v  115 (208)
                      ++|.+.+.....+.. +...+|.|.+|.++++||+++|+|+.+++++.+|.++||+++|++||++.|.++|++++.+..|
T Consensus         2 ~~~~p~~~~~~~p~~p~~~~~l~V~~~~~~~~ld~~~Iv~~~~~~~l~~~~~~rWa~~~~~~l~~~L~~~L~~~~~~~~V   81 (178)
T d2iqia1           2 TIYAPTVRVTPNPAWPQVSWQLLVAKPSAARIIDSPRINVRPTPGELQVYHGAGWAQPATDMLEDSVVRAFEDSGKIAAV   81 (178)
T ss_dssp             EEECCCCCCCCCTTSCCCCSEEEECCCBCCTTTSSSSCEEESSTTCCEECTTEEESSCHHHHHHHHHHHHHHTTSSCSEE
T ss_pred             CCCCCCCCCCCCCCCCCCCEEEEECCCCCCHHHCCCCEEEEECCCEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCCCEE
T ss_conf             63357988888998997616999877346111077756999589778451378222687899999999999960997458


Q ss_pred             ECCCCCCCCCEEEEEEEEEEEEECCCC---EEEEEEEEEEEECCCCCEEEEEEEEEEEECCCCCHHHHHHHHHHHHHHHH
Q ss_conf             037677788359999999999635874---79999999999457882778999999995277998899999999999999
Q gi|254780141|r  116 VKPNQGIYADYQIISAIRSFEINIDRH---CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRIS  192 (208)
Q Consensus       116 ~~~~~~~~~~~~L~~~I~~f~~~~~~~---~a~i~~~~~l~~~~~~~~~~~~~f~~~~~~~~~~~~~~v~Al~~Al~~l~  192 (208)
                      .+++++..+||+|+++|++|+++++++   .+++.++|.+++.++++++++++|..++|+.+++++++|+||++|+++++
T Consensus        82 ~~~~~~~~~d~~L~~~i~~F~~~~~~~~~~~a~~~~~~~l~~~~~~~v~~~~~f~~~~p~~~~~~~~lV~A~~~Al~~l~  161 (178)
T d2iqia1          82 ARIGAGIRSDYKLAIDVRRFESDYAGQSLPAATIELNAKLLHSSDQRVVASRTFTVARPSSSTDTAAVAAAFEQALTQVT  161 (178)
T ss_dssp             ECC-----CCEEEEEEEEEEEEECTTSSSCEEEEEEEEEEEETTTTEEEEEEEEEEEEECSSSSHHHHHHHHHHHHHHHH
T ss_pred             ECCCCCCCCCEEEEEEEEEEEEEECCCCCEEEEEEEEEEEECCCCCCEEEEEEEEEEEECCCCCHHHHHHHHHHHHHHHH
T ss_conf             66888888776999999998888458886289999999982178981788999999974788998999999999999999


Q ss_pred             HHHHHHHHHHC
Q ss_conf             99999999739
Q gi|254780141|r  193 SEIIDWTLSSL  203 (208)
Q Consensus       193 ~~ia~w~~~~~  203 (208)
                      ++|++|+++..
T Consensus       162 ~~ia~W~~~~~  172 (178)
T d2iqia1         162 TELVGWTLITG  172 (178)
T ss_dssp             HHHHHHHHHHH
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999975



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 208 putative ABC transporter protein [Candidatus Liber
2iqi_A_192 (A:) Hypothetical protein XCC0632; structural geno 6e-33
>2iqi_A (A:) Hypothetical protein XCC0632; structural genomics, PSI-2, protein structure initiative; 2.70A {Xanthomonas campestris PV}Length = 192 Back     alignment and structure
 Score =  135 bits (340), Expect = 6e-33
 Identities = 48/184 (26%), Positives = 90/184 (48%), Gaps = 6/184 (3%)

Query: 25  SLSSCFFHNNPVNIYDLT-ESTKYDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQ 83
           SLS       P  IY  T   T      Q   QL++ +P   +I++S  I VR +P E+Q
Sbjct: 1   SLSLG--DQKPATIYAPTVRVTPNPAWPQVSWQLLVAKPSAARIIDSPRINVRPTPGELQ 58

Query: 84  YLIGSQWSDKLPRMIQLKLIANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRH- 142
              G+ W+     M++  ++  FE++GKI+ V +   GI +DY++   +R FE +     
Sbjct: 59  VYHGAGWAQPATDMLEDSVVRAFEDSGKIAAVARIGAGIRSDYKLAIDVRRFESDYAGQS 118

Query: 143 --CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHFIQSLNRAFSRISSEIIDWTL 200
              A I ++ K++++ D  +V  + F V       +      +  +A +++++E++ WTL
Sbjct: 119 LPAATIELNAKLLHSSDQRVVASRTFTVARPSSSTDTAAVAAAFEQALTQVTTELVGWTL 178

Query: 201 SSLP 204
            +  
Sbjct: 179 ITGQ 182


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target208 putative ABC transporter protein [Candidatus Liberibact
2iqi_A_192 Hypothetical protein XCC0632; structural genomics, 100.0
2jxp_A_155 Putative lipoprotein B; uncharacterized lipoprotei 95.06
>2iqi_A (A:) Hypothetical protein XCC0632; structural genomics, PSI-2, protein structure initiative; 2.70A {Xanthomonas campestris PV} Back     alignment and structure
Probab=100.00  E-value=1.4e-38  Score=236.50  Aligned_cols=178  Identities=26%  Similarity=0.455  Sum_probs=165.6

Q ss_pred             HHHCCCCCCCCCEEEECCCCCC-CCCCCCCCCCEEEECCCCCCCCCCCEEEEEECCCEEEEECCCCCCCCHHHHHHHHHH
Q ss_conf             8630488999860797078887-666666662089815301200068637899469769981466012568999999999
Q gi|254780141|r   25 SLSSCFFHNNPVNIYDLTESTK-YDESVQRHIQLIITEPITEKILNSEDIIVRSSPIEIQYLIGSQWSDKLPRMIQLKLI  103 (208)
Q Consensus        25 ~l~~c~~~~~p~~~Y~L~~~~~-~~~~~~~~~~i~v~~~~~~~~l~~~~Iv~~~~~~~~~~~~~~rW~~~p~~~l~~~L~  103 (208)
                      .|+||++++  ++||.|+++.. .......++.|.|.+|.++++|++++|+|+.++++++++.+|||+++|++||++.|.
T Consensus         1 ~LsGCss~p--~~~Y~L~~~~~~~~~~~~~~~~i~v~~v~~~~~l~~~~iv~~~~~~~~~~~~~~rWa~~~~~~l~~~L~   78 (192)
T 2iqi_A            1 SLSLGDQKP--ATIYAPTVRVTPNPAWPQVSWQLLVAKPSAARIIDSPRINVRPTPGELQVYHGAGWAQPATDMLEDSVV   78 (192)
T ss_dssp             -----------CEEECCCCCCCCCTTSCCCCSEEEECCCBCCTTTSSSSCEEESSTTCCEECTTEEESSCHHHHHHHHHH
T ss_pred             CCCCCCCCC--CCEEECCCCCCCCCCCCCCCEEEEECCCCCCHHHCCCCEEEEECCCEEEECCCCCHHCCHHHHHHHHHH
T ss_conf             967889999--557864788888988898753699876334001067877998389889773678110387899999999


Q ss_pred             HHHHHHCCCEEEECCCCCCCCCEEEEEEEEEEEEECCCC---EEEEEEEEEEEECCCCCEEEEEEEEEEEECCCCCHHHH
Q ss_conf             999731694065037677788359999999999635874---79999999999457882778999999995277998899
Q gi|254780141|r  104 ANFENNGKISTVVKPNQGIYADYQIISAIRSFEINIDRH---CAIITMSLKIINAHDNSLVGQKVFHVEEKLEKDNKLHF  180 (208)
Q Consensus       104 ~~L~~~~~~~~v~~~~~~~~~~~~L~~~I~~f~~~~~~~---~a~i~~~~~l~~~~~~~~~~~~~f~~~~~~~~~~~~~~  180 (208)
                      ++|++.+.+..|++++++..+||+|+++|++|+++++++   ++++.++|.+++.+++++++++.|+.++|+.++++.++
T Consensus        79 ~~L~~~~~~~~v~~~~~~~~~d~~L~~~i~~f~~~~~~~~~~~~~l~~~~~l~~~~~~~~i~~~~f~~~~~~~~~~~~~~  158 (192)
T 2iqi_A           79 RAFEDSGKIAAVARIGAGIRSDYKLAIDVRRFESDYAGQSLPAATIELNAKLLHSSDQRVVASRTFTVARPSSSTDTAAV  158 (192)
T ss_dssp             HHHHTTSSCSEEECC-----CCEEEEEEEEEEEEECTTSSSCEEEEEEEEEEEETTTTEEEEEEEEEEEEECSSSSHHHH
T ss_pred             HHHHHHCCCCEEECCCCCCCCCEEEEEEEEEEEEEECCCCCEEEEEEEEEEEEECCCCCEEEEEEEEEEEECCCCCHHHH
T ss_conf             99996099736756888888887999999997877168885379999999997579983789988999977788998999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             999999999999999999997397
Q gi|254780141|r  181 IQSLNRAFSRISSEIIDWTLSSLP  204 (208)
Q Consensus       181 v~Al~~Al~~l~~~ia~w~~~~~p  204 (208)
                      |+||++|+++++++|++|+.+.+|
T Consensus       159 v~A~~~al~~l~~~ia~~i~~~~~  182 (192)
T 2iqi_A          159 AAAFEQALTQVTTELVGWTLITGQ  182 (192)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999999998655



>2jxp_A (A:) Putative lipoprotein B; uncharacterized lipoprotein B, structure, northeast structural genomics consortium, NESG, PSI-2; NMR {Nitrosomonas europaea atcc 19718} Back     alignment and structure