254780142

254780142

DNA-directed RNA polymerase subunit beta'

GeneID in NCBI database:8209117Locus tag:CLIBASIA_00105
Protein GI in NCBI database:254780142Protein Accession:YP_003064555.1
Gene range:-(19927, 24123)Protein Length:1398aa
Gene description:DNA-directed RNA polymerase subunit beta'
COG prediction:[K] DNA-directed RNA polymerase, beta' subunit/160 kD subunit
KEGG prediction:rpoC; DNA-directed RNA polymerase subunit beta' (EC:2.7.7.6); K03046 DNA-directed RNA polymerase subunit beta' [EC:2.7.7.6]
SEED prediction:DNA-directed RNA polymerase beta subunit (EC 2.7.7.6)
Pathway involved in KEGG:Purine metabolism [PATH:las00230]
Pyrimidine metabolism [PATH:las00240]
RNA polymerase [PATH:las03020]
Subsystem involved in SEED:RNA polymerase bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------140
MQQEVMRFFNPWTDDRGFDSVRISIASPAKIASLSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECICGKYKRMKYKGIICEKCGVEVTLSSVRRDRMAHIDLASPVAHPWFLKSLPSRISTLLGMSLRDVERVLYFESYVVVDPGLSSLEKYQILTEEEYVEAVSQFGQDQFIAMMGADAIYELLIALDLQNLALTLRDQLSKSSSIFRRKKIIKRLKIVDSFITSGNNPGWMIIRKLPVLPPDLRPLVALDFGRFAASDLNDLYRRVIGRNNRLMRLKSLHAPEIIIRNEKRMLQESVDALFDNGRHKRVVTGANRRPLKSLSDMLKGKQGRFRTNLLGKRVDYSGRSVIVAGPELQLHQCGLPKLMALELFKPFLYAQLEKKGYVSTVKQAKKFVEKERPEVWDVLAEVVHQHVVLLNRAPSLHRLSMQAFEPKIISGKAIQLHPLVCAGYNADFDGDQMAVYAVISPEAQLEARVLMLSTNNLLHPASGAPVTVPSQDMVLGLCYLSTVHEGDPGEGMLFADMGEVYHALENKIVTLHSKIRGRYKSVDKDGNSISKIYDTTPGRMIIGEILPRHHEISFDICNQEMIKKNISAMVDTIYRHCGQKSTVAFCDDLMRLGFRYACSSGISFGKDDIIVPESKEKIIAEADKMVKEYENQYNDGLITRGEKYNKVVDLWGKTTDKVTEEMMARIKRVEFDPETGRQKKMNSIFMMSHSGARGSIHQMRQLGGMRGLIAKPSGEIIESPIRSHFKGGLCGFEFFQSCVGGRKGLLDVVMRTASSGYLSRRLVDVAQNCVVNQVDCNTKKGLTITHIVDSGQVVYSLGSRVLGRTALDDIINPLTNECIVKAGQLILESHVNEIEKCGIRSVRIRSALTCESSRGVCVLCYGRDLARGSLVNVGEAVGVIAAQSIGEPGTQLTMRTFHLGGAVTVMDRSFIESPCDGIVKIKNRNVCRNSTNDLISMGRNTTLQILDMSGQEQYSHRIMYGAKLFVDDGGVIECGQRISEWDPHTFPIITEVSGTVGFEDLVDGISVIESIGESTGIAKRKVIDWRFASRSQNLKPAIVVTDENGVVLKSARGTDARWFLPVDALLSVSPGQKVSTGDVLARLPISSAKTKDITSGLPRVAELFEARRPKNHAILAEISGTIRIKRNYKNKSRVVIEPFEDGVEPAEYFIPKNKHFYLQDGDHVEKGDYILDGNPVPQDILRIKGVEALASYLINEVQEVYRLEGVAINHKHIEVVVRHMLQKVEITDPADTEYILGDNVDRIEVEELNRSLAQQGKKLVSFSPILQGITKASLQTKSFISAASFQETTKVLTEAAIAGKVDTLDGFKENVIVGRSIPAGTGAILHEKRRVAMNRDQMILKERSNFSQNEDLKNTAIQGSIAE
ccHHHHHHHcccccccEEEEEEEEcccHHHHHHHcEEEEEcccccccccccccccccccHHHcccccccHHHccccccccccccccHHcccccccccccccccEEEEEccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccHHHHHccHHHHHHHHHHccccccccccHHHHHHHHHHHccHHHHHHHHHHHHcccccHHHHHHHHHcccHHHHHHcccccHHHEEEEEcccccccccccEEEccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccHHccccHHHHHHHccccccHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHccccEEEEEcccccccccccEEEEEEEcccEEEEEEcccccccccccccEEEEEccccHHHHHHHHHHHcccccEEEccccccEEEcHHHHHHHHHHHHccccccccccEEcccHHHHHHHHHcccccccccEEEEEcccccccccccEEccccccHHHHHHHHHccccccccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHccHHHHHHHHHHHHHHHHHHHcccccccccccccccEEHHHccccccHHHHHHHHHccccccccccccccccHHHHHHccccHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHcccEEEEEcccccccEEEEEEEccccEEEcccccccccHHHHcccccccccEEEEccccccHHHHHHHHHccccEEEEEEcEEEcccccHHHHHHHHHHHccccccccccHHEEEccccccccccEEEEEEEEccccccccccccccccccEEEEEEEEEEEcccccEEEEEcccEEEEEEccccEEEEEEEccccEEEEEcccEEEcccEEEccccccccEEEEcccEEEEEEcccccEEEEEccccccccEEEEEEEcccccccccccEEEEEcccccEEEcccccccccccccccEEEEccccccccccEEEEEccccccccccccccccHHHHHHHccccccEEEEEEccEEEEEEcccccEEEEEEEcccccEEEEEEcccccEEEEEcccEEEcccEEEcccccHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccEEEEEcccccccccccHHHHHHHHHHHHHHHHcccccccccEEEEEEEccccccccHHHHcccHHHHHHHHHHHccccccccccccccEEccccccccccHHHHHHHHHcccHHHHHHcccHHHHccHHHHHHcccccccc
ccHHHHHHHccccccccHHHHHHHcccHHHHHHccccccccccEEEcccccccccccEEEEEEcccccHHHcccccccEEEcEEEccccccEEEHHHcHHHHHcHHHHccHHHHHHHHHccccHHHHHccccHHHHHHHHHHHHcEEEcccccccHccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEcHHHHHHHHHHHHHHcccccEEEEccccccHHHHHHHHcccccHHHHHHcccEEcccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccHHHcccHHHHHHHccccccEEEcccHHHccHHHHHHHcccccccccEEEccccHHHHHHHHHHHHHccccccccccccEEEccccEEEEEEEEEHHHcccccccEEEccHHHHHHHHHcccEEEEEEEEEEEEEEEcccccEEEEEcccHHHHHHHHHccccccccHHHcccHccHHHHHHHHHHHHHHHcccccEHHHHHHHHHHHHHHHHcccEEccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEcccccccccccHHHHEccccccccHHHHHHHHccccccEcccccEEEccHHHcHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcEEEEccccccccEEEEEEEccccccccHHHHEcHHEEHHHccccccccEEEcccccccHHHHHHHHHccccEEEEEEEEEEcccccEEHHHccHHcccccccccccEEEEEEEEccccccccEEEEEEEHcHHHHHHHcccEEEEcccEEEEEccEEEEcccccEEEEEccEEEEEEEccccEEEEEEccccEEEEEccccEEccccEEEEcccccccEEEEEcEEEEEEEccccEEEEEEcccHccccEEEEEcccccccccccccEEEEEcccccEEEccccccEEEEccccEEEEEccccEEccccEEEEcccccccccccccccHHHHHHHHcccccccEEEEEEcEEEEEcccccccEEEEEEEcccccccEEEEcccccEEEEEcccEEEcccEEEccccccHHHHHHHcHHHHHHHHHHHHHHHHHHcccEEccHHHHHHHHHHHccEEEEccccccccccccEEHHHHHHHHHHHHHccccccccccEEEEEEHcccccccHHEHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEccccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHccccc
MQQEVmrffnpwtddrgfdsvrisiaspakiaslsygeikkpetinyrtfkperdglfcarifgpikdyecicgkykrmkykgiicekcgvevtLSSVRRDRMahidlaspvahpwflkslPSRISTLLGMSLRDVERVLYFESYVvvdpglsslekYQILTEEEYVEAVSQFGQDQFIAMMGADAIYELLIALDLQNLALTLRDQLSKSSSIFRRKKIIKRLKIVDSFitsgnnpgwmiirklpvlppdlrplvaldfgrfAASDLNDLYRRVIGRNNRLMrlkslhapeiIIRNEKRMLQESVDALfdngrhkrvvtganrrplkSLSDMlkgkqgrfrtnllgkrvdysgrsvivagpelqlhqcglpkLMALELFKPFLYAQLEKKGYVSTVKQAKKFVEKERPEVWDVLAEVVHQHVVLLNrapslhrlsmqafepkiisgkaiqlhplvcagynadfdgdqMAVYAVISPEAQLEARVLMLStnnllhpasgapvtvpsqdmVLGLCYLstvhegdpgegmlfADMGEVYHALENKIVTLHSKIRgryksvdkdgnsiskiydttpgrmiigeilprhheisfDICNQEMIKKNISAMVDTIYRhcgqkstvAFCDDLMRLGFRYAcssgisfgkddiivpesKEKIIAEADKMVKEYENQYNdglitrgeKYNKVVDLWGKTTDKVTEEMMARIKRvefdpetgrqkkmnsifmmshsgargsiHQMRQLggmrgliakpsgeiiespirshfkgglcgfeffqscvggrkGLLDVVMRTASSGYLSRRLVDVAQNCvvnqvdcntkkgltiTHIVDSGQVVYSLGsrvlgrtalddiinpltNECIVKAGQLILESHVNEIEKCGIRSVRIRSaltcessrgvcvlcygrdlargslvNVGEAVGVIAAqsigepgtqltMRTFHLGGAVTVMdrsfiespcdgivkiknrnvcrnstNDLISMGRNTTLQILDMSGQEQYSHRIMYGAklfvddggviecgqrisewdphtfpiitevsgtvgfedlVDGISVIESIGESTGIAKRKVIDWRfasrsqnlkpaivvtdengvvlksargtdarwflpvdallsvspgqkvstgdvlarlpissaktkditsglPRVAELFEARRPKNHAILAEISGTIrikrnyknksrvviepfedgvepaeyfipknkhfylqdgdhvekgdyildgnpvpqdILRIKGVEALASYLINEVQEVYRLEGVAINHKHIEVVVRHMLQkveitdpadteyilgdnvdRIEVEELNRSLAQQGKKlvsfspilqgiTKASLQTKSFISAASFQETTKVLTEAAIagkvdtldgfkenvivgrsipagtgailHEKRRVAMNRDQMILKErsnfsqnedlkntaiqgsiae
mqqevmrffnpwtddrgfdSVRISIASpakiaslsygeikkpetinyrtfkperdGLFCARIFGPIKDYECICGKYKRMKYKGIICEKCGVEVTLSSVRRDRMAHIDlaspvahpwflkSLPSRISTLLGMSLRDVERVLYFESYvvvdpglsSLEKYQILTEEEYVEAVSQFGQDQFIAMMGADAIYELLIALDLQNLALTLrdqlsksssifrrkkiikrlkivdsfitsgnnpgwmIIRKLPVLPPDLRPLVALDFGRFAASDLNDLYRRVIGrnnrlmrlkslhapeiiirNEKRMLQESVDAlfdngrhkrvvtganrrplkslsdmlkgkqgrfrtnllgkrvDYSGRSVIVAGPELQLHQCGLPKLMALELFKPFLYAQLEKKGYVSTVKQAKKFVEKERPEVWDVLAEVVHQHVVLLNRAPSLHRLSMQAFEPKIISGKAIQLHPLVCAGYNADFDGDQMAVYAVISPEAQLEARVLMLSTNNLLHPASGAPVTVPSQDMVLGLCYLSTVHEGDPGEGMLFADMGEVYHALENKIVTlhskirgryksvdkdgnsiskiydttpgrMIIGEILPRHHEISFDICNQEMIKKNISAMVDTIYRHCGQKSTVAFCDDLMRLGFRYACSSgisfgkddiivpESKEKIIAEADKMVKEYENQYndglitrgekynkvvdLWGKTTDKVTEEMMARikrvefdpetgrqKKMNSIFMMSHSGARGSIHQMRQLGGMRGLIAKPSGEIIESPIRSHFKGGLCGFEFFQSCVGGRKGLLDVVMRTASSGYLSRRLVDVAQNCVVNQVDCNTKKGLTITHIVDSGQVVYSLGSRVLGRTALDDIINPLTNECIVKAGQLILESHVNEIEKCGIRSVRIrsaltcessrgvCVLCYGRDLARGSLVNVGEAVGVIAAqsigepgtqLTMRTFHLGGAVTVMDRSFIESPCdgivkiknrnvcrnstndlismgrnTTLQILDMSGQEQYSHRIMYGAKLFVDDGGVIECGQRISEWDPHTFPIITEVSGTVGFEDLVDGISVIesigestgiakrKVIDWRFasrsqnlkpaivvtdengvVLKSARGTDARWFLPVDALLsvspgqkvstgdvlarlpissaktkditsglPRVAELfearrpknhailaeisgtirikrnyknksrVVIEPFEDGVEPAEYFIPKNKHFYLQDGDHVEKGDYILDGNPVPQDILRIKGVEALASYLINEVQEVYRLEGVAINHKHIEVVVRHMLQKveitdpadteyilgDNVDRIEVEELNRSLAQQGKKLVSFSPILQGITKASLQTKSFISAASFQETTKVLTEAAIagkvdtldgfkenvivgrsipagtgailhekrrVAMNRDQMILKersnfsqnedlkntaiqgsiae
MQQEVMRFFNPWTDDRGFDSVRISIASPAKIASLSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECICGKYKRMKYKGIICEKCGVEVTLSSVRRDRMAHIDLASPVAHPWFLKSLPSRISTLLGMSLRDVERVLYFESYVVVDPGLSSLEKYQILTEEEYVEAVSQFGQDQFIAMMGADAIYEllialdlqnlaltlRDQlsksssifrrkkiikrlkiVDSFITSGNNPGWMIIRKlpvlppdlrplvaldFGRFAASDLNDLYRRVIGRNNRLMRLKSLHAPEIIIRNEKRMLQESVDALFDNGRHKRVVTGANRRPLKSLSDMLKGKQGRFRTNLLGKRVDYSGRSVIVAGPELQLHQCGLPKLMALELFKPFLYAQLEKKGYVSTVKQAKKFVEKERPEVWDVLAEVVHQHVVLLNRAPSLHRLSMQAFEPKIISGKAIQLHPLVCAGYNADFDGDQMAVYAVISPEAQLEARVLMLSTNNLLHPASGAPVTVPSQDMVLGLCYLSTVHEGDPGEGMLFADMGEVYHALENKIVTLHSKIRGRYKSVDKDGNSISKIYDTTPGRMIIGEILPRHHEISFDICNQEMIKKNISAMVDTIYRHCGQKSTVAFCDDLMRLGFRYACSSGISFGKDDIIVPESKEKIIAEADKMVKEYENQYNDGLITRGEKYNKVVDLWGKTTDKVTEEMMARIKRVEFDPETGRQKKMNSIFMMSHSGARGSIHQMRQLGGMRGLIAKPSGEIIESPIRSHFKGGLCGFEFFQSCVGGRKGLLDVVMRTASSGYLSRRLVDVAQNCVVNQVDCNTKKGLTITHIVDSGQVVYSLGSRVLGRTALDDIINPLTNECIVKAGQLILESHVNEIEKCGIRSVRIRSALTCESSRGVCVLCYGRDLARGSLVNVGEAVGVIAAQSIGEPGTQLTMRTFHLGGAVTVMDRSFIESPCDGIVKIKNRNVCRNSTNDLISMGRNTTLQILDMSGQEQYSHRIMYGAKLFVDDGGVIECGQRISEWDPHTFPIITEVSGTVGFEDLVDGISVIESIGESTGIAKRKVIDWRFASRSQNLKPAIVVTDENGVVLKSARGTDARWFLPVDALLSVSPGQKVSTGDVLARLPISSAKTKDITSGLPRVAELFEARRPKNHAILAEISGTIRIKRNYKNKSRVVIEPFEDGVEPAEYFIPKNKHFYLQDGDHVEKGDYILDGNPVPQDILRIKGVEALASYLINEVQEVYRLEGVAINHKHIEVVVRHMLQKVEITDPADTEYILGDNVDRIEVEELNRSLAQQGKKLVSFSPILQGITKASLQTKSFISAASFQETTKVLTEAAIAGKVDTLDGFKENVIVGRSIPAGTGAILHEKRRVAMNRDQMILKERSNFSQNEDLKNTAIQGSIAE
**QEVMRFFNPWTDDRGFDSVRISIASPAKIASLSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECICGKYKRMKYKGIICEKCGVEVTLSSVRRDRMAHIDLASPVAHPWFLKSLPSRISTLLGMSLRDVERVLYFESYVVVDPGLSSLEKYQILTEEEYVEAVSQFGQDQFIAMMGADAIYELLIALDLQNLAL******************IKRLKIVDSFITSGNNPGWMIIRKLPVLPPDLRPLVALDFGRFAASDLNDLYRRVIGRNNRLMRLKSLHAPEIIIRNEKRMLQESVDALFDNGRHKRV*****RRPLKSLSDMLKGKQGRFRTNLLGKRVDYSGRSVIVAGPELQLHQCGLPKLMALELFKPFLYAQLEKKGYVSTVKQAKKFVEKERPEVWDVLAEVVHQHVVLLNRAPSLHRLSMQAFEPKIISGKAIQLHPLVCAGYNADFDGDQMAVYAVISPEAQLEARVLMLSTNNLLHPASGAPVTVPSQDMVLGLCYLSTVHEGDPGEGMLFADMGEVYHALENKIVTLHSKIRGRYKSVDKDGNSISKIYDTTPGRMIIGEILPRHHEISFDICNQEMIKKNISAMVDTIYRHCGQKSTVAFCDDLMRLGFRYACSSGISFGKDDIIVPESKEKIIAEADKMVKEYENQYNDGLITRGEKYNKVVDLWGKTTDKVTEEMMAR****************NSIFMMSHSGARGSIHQMRQLGGMRGLIAKPSGEIIESPIRSHFKGGLCGFEFFQSCVGGRKGLLDVVMRTASSGYLSRRLVDVAQNCVVNQVDCNTKKGLTITHIVDSGQVVYSLGSRVLGRTALDDIINPLTNECIVKAGQLILESHVNEIEKCGIRSVRIRSALTCESSRGVCVLCYGRDLARGSLVNVGEAVGVIAAQSIGEPGTQLTMRTFHLGGAVTVMDR*FIESPCDGIVKIKNRNVCRNSTNDLISMGRNTTLQILDMSGQEQYSHRIMYGAKLFVDDGGVIECGQRISEWDPHTFPIITEVSGTVGFEDLVDGISVIESIGESTGIAKRKVI**************IVVTDENGVVLKSARGTDARWFLPVDALLSVSPGQKVSTGDVLARLPISSAKTKDITSGLPRVAELFEARRPKNHAILAEISGTIRIKRNYKNKSRVVIEPFEDGVEPAEYFIPKNKHFYLQDGDHVEKGDYILDGNPVPQDILRIKGVEALASYLINEVQEVYRLEGVAINHKHIEVVVRHMLQKVEITDPADTEYILGDNVDRIEVEELNRSLAQQGKKLVSFSPILQGITKASLQTKSFISAASFQETTKVLTEAAIAGKVDTLDGFKENVIVGRSIPAGTGAILHEK***********************************
MQQEVMRFFNPWTDDRGFDSVRISIASPAKIASLSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECICGKYKRMKYKGIICEKCGVEVTLSSVRRDRMAHIDLASPVAHPWFLKSLPSRISTLLGMSLRDVERVLYFESYVVVDPGLSSLEKYQILTEEEYVEAVSQFGQDQFIAMMGADAIYELLIALDLQNLALTLRDQLSKSSSIFRRKKIIKRLKIVDSFITSGNNPGWMIIRKLPVLPPDLRPLVALDFGRFAASDLNDLYRRVIGRNNRLMRLKSLHAPEIIIRNEKRMLQESVDALFDNGRHKRVVTGANRRPLKSLSDMLKGKQGRFRTNLLGKRVDYSGRSVIVAGPELQLHQCGLPKLMALELFKPFLYAQLEKKGYVSTVKQAKKFVEKERPEVWDVLAEVVHQHVVLLNRAPSLHRLSMQAFEPKIISGKAIQLHPLVCAGYNADFDGDQMAVYAVISPEAQLEARVLMLSTNNLLHPASGAPVTVPSQDMVLGLCYLSTVHEGDPGEGMLFADMGEVYHALENKIVTLHSKIRGRYKSVDKDGNSISKIYDTTPGRMIIGEILPRHHEISFDICNQEMIKKNISAMVDTIYRHCGQKSTVAFCDDLMRLGFRYACSSGISFGKDDIIVPESKEKIIAEADKMVKEYENQYNDGLITRGEKYNKVVDLWGKTTDKVTEEMMARIKRVEFDPETGRQKKMNSIFMMSHSGARGSIHQMRQLGGMRGLIAKPSGEIIESPIRSHFKGGLCGFEFFQSCVGGRKGLLDVVMRTASSGYLSRRLVDVAQNCVVNQVDCNTKKGLTITHIVDSGQVVYSLGSRVLGRTALDDIINPLTNECIVKAGQLILESHVNEIEKCGIRSVRIRSALTCESSRGVCVLCYGRDLARGSLVNVGEAVGVIAAQSIGEPGTQLTMRTFHLGGAVTVMDRSFIESPCDGIVKIKNRNVCRNSTNDLISMGRNTTLQILDMSGQEQYSHRIMYGAKLFVDDGGVIECGQRISEWDPHTFPIITEVSGTVGFEDLVDGISVIESIGESTGIAKRKVIDWRFASRSQNLKPAIVVTDENGVVLKSARGTDARWFLPVDALLSVSPGQKVSTGDVLARLPISSAKTKDITSGLPRVAELFEARRPKNHAILAEISGTIRIKRNYKNKSRVVIEPFEDGVEPAEYFIPKNKHFYLQDGDHVEKGDYILDGNPVPQDILRIKGVEALASYLINEVQEVYRLEGVAINHKHIEVVVRHMLQKVEITDPADTEYILGDNVDRIEVEELNRSLAQQGKKLVSFSPILQGITKASLQTKSFISAASFQETTKVLTEAAIAGKVDTLDGFKENVIVGRSIPAGTGAILHEKRRVAMNRDQMILKERSNFSQNEDLKNTAIQGSIAE
MQQEVMRFFNPWTDDRGFDSVRISIASPAKIASLSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECICGKYKRMKYKGIICEKCGVEVTLSSVRRDRMAHIDLASPVAHPWFLKSLPSRISTLLGMSLRDVERVLYFESYVVVDPGLSSLEKYQILTEEEYVEAVSQFGQDQFIAMMGADAIYELLIALDLQNLALTLRDQLSKSSSIFRRKKIIKRLKIVDSFITSGNNPGWMIIRKLPVLPPDLRPLVALDFGRFAASDLNDLYRRVIGRNNRLMRLKSLHAPEIIIRNEKRMLQESVDALFDNGRHKRVVTGANRRPLKSLSDMLKGKQGRFRTNLLGKRVDYSGRSVIVAGPELQLHQCGLPKLMALELFKPFLYAQLEKKGYVSTVKQAKKFVEKERPEVWDVLAEVVHQHVVLLNRAPSLHRLSMQAFEPKIISGKAIQLHPLVCAGYNADFDGDQMAVYAVISPEAQLEARVLMLSTNNLLHPASGAPVTVPSQDMVLGLCYLSTVHEGDPGEGMLFADMGEVYHALENKIVTLHSKIRGRYKSVDKDGNSISKIYDTTPGRMIIGEILPRHHEISFDICNQEMIKKNISAMVDTIYRHCGQKSTVAFCDDLMRLGFRYACSSGISFGKDDIIVPESKEKIIAEADKMVKEYENQYNDGLITRGEKYNKVVDLWGKTTDKVTEEMMARIKRVEFDPETGRQKKMNSIF***H****G*IHQMRQLGGMRGLIAKPSGEIIESPIRSHFKGGLCGFEFFQSCVGGRKGLLDVVMRTASSGYLSRRLVDVAQNCVVNQVDCNTKKGLTITHIVDSGQVVYSLGSRVLGRTALDDIINPLTNECIVKAGQLILESHVNEIEKCGIRSVRIRSALTCESSRGVCVLCYGRDLARGSLVNVGEAVGVIAAQSIGEPGTQLTMRTFHLGGAVTVMDRSFIESPCDGIVKIKNRNVCRNSTNDLISMGRNTTLQILDMSGQEQYSHRIMYGAKLFVDDGGVIECGQRISEWDPHTFPIITEVSGTVGFEDLVDGISVIESIGESTGIAKRKVIDWRFASRSQNLKPAIVVTDENGVVLKSARGTDARWFLPVDALLSVSPGQKVSTGDVLARLPISSAKTKDITSGLPRVAELFEARRPKNHAILAEISGTIRIKRNYKNKSRVVIEPFEDGVEPAEYFIPKNKHFYLQDGDHVEKGDYILDGNPVPQDILRIKGVEALASYLINEVQEVYRLEGVAINHKHIEVVVRHMLQKVEITDPADTEYILGDNVDRIEVEELNRSLAQQGKKLVSFSPILQGITKASLQTKSFISAASFQETTKVLTEAAIAGKVDTLDGFKENVIVGRSIPAGTGAILHEKRRVAMNR****************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQQEVMRFFNPWTDDRGFDSVRISIASPAKIASLSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECICGKYKRMKYKGIICEKCGVEVTLSSVRRDRMAHIDLASPVAHPWFLKSLPSRISTLLGMSLRDVERVLYFESYVVVDPGLSSLEKYQILTEEEYVEAVSQFGQDQFIAMMGADAIYELLIALDLQNLALTLRDQLSKSSSIFRRKKIIKRLKIVDSFITSGNNPGWMIIRKLPVLPPDLRPLVALDFGRFAASDLNDLYRRVIGRNNRLMRLKSLHAPEIIIRNEKRMLQESVDALFDNGRHKRVVTGANRRPLKSLSDMLKGKQGRFRTNLLGKRVDYSGRSVIVAGPELQLHQCGLPKLMALELFKPFLYAQLEKKGYVSTVKQAKKFVEKERPEVWDVLAEVVHQHVVLLNRAPSLHRLSMQAFEPKIISGKAIQLHPLVCAGYNADFDGDQMAVYAVISPEAQLEARVLMLSTNNLLHPASGAPVTVPSQDMVLGLCYLSTVHEGDPGEGMLFADMGEVYHALENKIVTLHSKIRGRYKSVDKDGNSISKIYDTTPGRMIIGEILPRHHEISFDICNQEMIKKNISAMVDTIYRHCGQKSTVAFCDDLMRLGFRYACSSGISFGKDDIIVPESKEKIIAEADKMVKEYENQYNDGLITRGEKYNKVVDLWGKTTDKVTEEMMARIKRVEFDPETGRQKKMNSIFMMSHSGARGSIHQMRQLGGMRGLIAKPSGEIIESPIRSHFKGGLCGFEFFQSCVGGRKGLLDVVMRTASSGYLSRRLVDVAQNCVVNQVDCNTKKGLTITHIVDSGQVVYSLGSRVLGRTALDDIINPLTNECIVKAGQLILESHVNEIEKCGIRSVRIRSALTCESSRGVCVLCYGRDLARGSLVNVGEAVGVIAAQSIGEPGTQLTMRTFHLGGAVTVMDRSFIESPCDGIVKIKNRNVCRNSTNDLISMGRNTTLQILDMSGQEQYSHRIMYGAKLFVDDGGVIECGQRISEWDPHTFPIITEVSGTVGFEDLVDGISVIESIGESTGIAKRKVIDWRFASRSQNLKPAIVVTDENGVVLKSARGTDARWFLPVDALLSVSPGQKVSTGDVLARLPISSAKTKDITSGLPRVAELFEARRPKNHAILAEISGTIRIKRNYKNKSRVVIEPFEDGVEPAEYFIPKNKHFYLQDGDHVEKGDYILDGNPVPQDILRIKGVEALASYLINEVQEVYRLEGVAINHKHIEVVVRHMLQKVEITDPADTEYILGDNVDRIEVEELNRSLAQQGKKLVSFSPILQGITKASLQTKSFISAASFQETTKVLTEAAIAGKVDTLDGFKENVIVGRSIPAGTGAILHEKRRVAMNRDQMILKERSNFSQNEDLKNTAIQGSIAE
MQQEVMRFFNPWTDDRGFDSVRISIASPAKIASLSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECICGKYKRMKYKGIICEKCGVEVTLSSVRRDRMAHIDLASPVAHPWFLKSLPSRISTLLGMSLRDVERVLYFESYVVVDPGLSSLEKYQILTEEEYVEAVSQFGQDQFIAMMGADAIYELLIALDLQNLALTLRDQLSKSSSIFRRKKIIKRLKIVDSFITSGNNPGWMIIRKLPVLPPDLRPLVALDFGRFAASDLNDLYRRVIGRNNRLMRLKSLHAPEIIIRNEKRMLQESVDALFDNGRHKRVVTGANRRPLKSLSDMLKGKQGRFRTNLLGKRVDYSGRSVIVAGPELQLHQCGLPKLMALELFKPFLYAQLEKKGYVSTVKQAKKFVEKERPEVWDVLAEVVHQHVVLLNRAPSLHRLSMQAFEPKIISGKAIQLHPLVCAGYNADFDGDQMAVYAVISPEAQLEARVLMLSTNNLLHPASGAPVTVPSQDMVLGLCYLSTVHEGDPGEGMLFADMGEVYHALENKIVTLHSKIRGRYKSVDKDGNSISKIYDTTPGRMIIGEILPRHHEISFDICNQEMIKKNISAMVDTIYRHCGQKSTVAFCDDLMRLGFRYACSSGISFGKDDIIVPESKEKIIAEADKMVKEYENQYNDGLITRGEKYNKVVDLWGKTTDKVTEEMMARIKRVEFDPETGRQKKMNSIFMMSHSGARGSIHQMRQLGGMRGLIAKPSGEIIESPIRSHFKGGLCGFEFFQSCVGGRKGLLDVVMRTASSGYLSRRLVDVAQNCVVNQVDCNTKKGLTITHIVDSGQVVYSLGSRVLGRTALDDIINPLTNECIVKAGQLILESHVNEIEKCGIRSVRIRSALTCESSRGVCVLCYGRDLARGSLVNVGEAVGVIAAQSIGEPGTQLTMRTFHLGGAVTVMDRSFIESPCDGIVKIKNRNVCRNSTNDLISMGRNTTLQILDMSGQEQYSHRIMYGAKLFVDDGGVIECGQRISEWDPHTFPIITEVSGTVGFEDLVDGISVIESIGESTGIAKRKVIDWRFASRSQNLKPAIVVTDENGVVLKSARGTDARWFLPVDALLSVSPGQKVSTGDVLARLPISSAKTKDITSGLPRVAELFEARRPKNHAILAEISGTIRIKRNYKNKSRVVIEPFEDGVEPAEYFIPKNKHFYLQDGDHVEKGDYILDGNPVPQDILRIKGVEALASYLINEVQEVYRLEGVAINHKHIEVVVRHMLQKVEITDPADTEYILGDNVDRIEVEELNRSLAQQGKKLVSFSPILQGITKASLQTKSFISAASFQETTKVLTEAAIAGKVDTLDGFKENVIVGRSIPAGTGAILHEKRRVAMNRDQMILKERSNFSQNEDLKNTAIQGSIAE
MQQEVMRFFNPWTDDRGFDSVRISIASPAKIASLSYGEIKKPETINYRTFKPERDGLFCARIFGPIKDYECICGKYKRMKYKGIICEKCGVEVTLSSVRRDRMAHIDLASPVAHPWFLKSLPSRISTLLGMSLRDVERVLYFESYVVVDPGLSSLEKYQILTEEEYVEAVSQFGQDQFIAMMGADAIYELLIALDLQNLALTLRDQLSKSSSIFRRKKIIKRLKIVDSFITSGNNPGWMIIRKLPVLPPDLRPLVALDFGRFAASDLNDLYRRVIGRNNRLMRLKSLHAPEIIIRNEKRMLQESVDALFDNGRHKRVVTGANRRPLKSLSDMLKGKQGRFRTNLLGKRVDYSGRSVIVAGPELQLHQCGLPKLMALELFKPFLYAQLEKKGYVSTVKQAKKFVEKERPEVWDVLAEVVHQHVVLLNRAPSLHRLSMQAFEPKIISGKAIQLHPLVCAGYNADFDGDQMAVYAVISPEAQLEARVLMLSTNNLLHPASGAPVTVPSQDMVLGLCYLSTVHEGDPGEGMLFADMGEVYHALENKIVTLHSKIRGRYKSVDKDGNSISKIYDTTPGRMIIGEILPRHHEISFDICNQEMIKKNISAMVDTIYRHCGQKSTVAFCDDLMRLGFRYACSSGISFGKDDIIVPESKEKIIAEADKMVKEYENQYNDGLITRGEKYNKVVDLWGKTTDKVTEEMMARIKRVEFDPETGRQKKMNSIFMMSHSGARGSIHQMRQLGGMRGLIAKPSGEIIESPIRSHFKGGLCGFEFFQSCVGGRKGLLDVVMRTASSGYLSRRLVDVAQNCVVNQVDCNTKKGLTITHIVDSGQVVYSLGSRVLGRTALDDIINPLTNECIVKAGQLILESHVNEIEKCGIRSVRIRSALTCESSRGVCVLCYGRDLARGSLVNVGEAVGVIAAQSIGEPGTQLTMRTFHLGGAVTVMDRSFIESPCDGIVKIKNRNVCRNSTNDLISMGRNTTLQILDMSGQEQYSHRIMYGAKLFVDDGGVIECGQRISEWDPHTFPIITEVSGTVGFEDLVDGISVIESIGESTGIAKRKVIDWRFASRSQNLKPAIVVTDENGVVLKSARGTDARWFLPVDALLSVSPGQKVSTGDVLARLPISSAKTKDITSGLPRVAELFEARRPKNHAILAEISGTIRIKRNYKNKSRVVIEPFEDGVEPAEYFIPKNKHFYLQDGDHVEKGDYILDGNPVPQDILRIKGVEALASYLINEVQEVYRLEGVAINHKHIEVVVRHMLQKVEITDPADTEYILGDNVDRIEVEELNRSLAQQGKKLVSFSPILQGITKASLQTKSFISAASFQETTKVLTEAAIAGKVDTLDGFKENVIVGRSIPAGTGAILHEKRRVAMNRDQMILKERSNFSQNEDLKNTAIQGSIAE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target1398 DNA-directed RNA polymerase subunit beta' [Candidatus L
3151227441398 DNA-directed RNA polymerase subunit beta' [Candidatus L 1 0.0
3271945261407 DNA-directed RNA polymerase protein, beta' subunit [Rhi 1 0.0
863572981402 DNA-directed RNA polymerase subunit beta' [Rhizobium et 1 0.0
1908913481402 DNA-directed RNA polymerase protein, beta' subunit [Rhi 1 0.0
1162515331402 DNA-directed RNA polymerase subunit beta' [Rhizobium le 1 0.0
2095489281402 DNA-directed RNA polymerase subunit beta' [Rhizobium le 1 0.0
2412041581402 DNA-directed RNA polymerase subunit beta' [Rhizobium le 1 0.0
2220856691403 DNA-directed RNA polymerase, beta' subunit [Agrobacteri 1 0.0
1591849891402 DNA-directed RNA polymerase subunit beta' [Agrobacteriu 1 0.0
2221483581403 DNA-directed RNA polymerase subunit beta' [Agrobacteriu 1 0.0
>gi|315122744|ref|YP_004063233.1| DNA-directed RNA polymerase subunit beta' [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 1398 Back     alignment and organism information
 Score = 2611 bits (6768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1260/1398 (90%), Positives = 1322/1398 (94%)

Query: 1    MQQEVMRFFNPWTDDRGFDSVRISIASPAKIASLSYGEIKKPETINYRTFKPERDGLFCA 60
            MQQEVMRFFNPWTDDR FDSVRISIASP KI SLSYGEIKKPETINYRTFKPERDGLFCA
Sbjct: 1    MQQEVMRFFNPWTDDREFDSVRISIASPEKILSLSYGEIKKPETINYRTFKPERDGLFCA 60

Query: 61   RIFGPIKDYECICGKYKRMKYKGIICEKCGVEVTLSSVRRDRMAHIDLASPVAHPWFLKS 120
            RIFGPIKDYECICGKYKRMKYKGIICEKCGVEVTLS VRRDRMAHI LASPVAHPWFLKS
Sbjct: 61   RIFGPIKDYECICGKYKRMKYKGIICEKCGVEVTLSCVRRDRMAHIQLASPVAHPWFLKS 120

Query: 121  LPSRISTLLGMSLRDVERVLYFESYVVVDPGLSSLEKYQILTEEEYVEAVSQFGQDQFIA 180
            LPSRISTLL M+LRDVERVLYFESYVV+DPGLSSLEKYQILTEEEYVEAV+ FGQDQFIA
Sbjct: 121  LPSRISTLLDMTLRDVERVLYFESYVVIDPGLSSLEKYQILTEEEYVEAVNDFGQDQFIA 180

Query: 181  MMGADAIYELLIALDLQNLALTLRDQLSKSSSIFRRKKIIKRLKIVDSFITSGNNPGWMI 240
            MMGADAI ELLI LDL NLA+TLR QLSKSSSIFRRKKIIKRLKIVDSF+ SGN P WM+
Sbjct: 181  MMGADAIRELLILLDLPNLAITLRGQLSKSSSIFRRKKIIKRLKIVDSFLISGNRPEWMV 240

Query: 241  IRKLPVLPPDLRPLVALDFGRFAASDLNDLYRRVIGRNNRLMRLKSLHAPEIIIRNEKRM 300
            +  +PVLPPDLRPLVALDFGRFAASDLNDLYRRVIGRNNRLMRLKSLHAPEII+RNEKRM
Sbjct: 241  MTVIPVLPPDLRPLVALDFGRFAASDLNDLYRRVIGRNNRLMRLKSLHAPEIIVRNEKRM 300

Query: 301  LQESVDALFDNGRHKRVVTGANRRPLKSLSDMLKGKQGRFRTNLLGKRVDYSGRSVIVAG 360
            LQESVDALFDNGRHKRVVTGANRRPLKSLSDMLKGKQGRFRTNLLGKRVDYSGR+VIVAG
Sbjct: 301  LQESVDALFDNGRHKRVVTGANRRPLKSLSDMLKGKQGRFRTNLLGKRVDYSGRTVIVAG 360

Query: 361  PELQLHQCGLPKLMALELFKPFLYAQLEKKGYVSTVKQAKKFVEKERPEVWDVLAEVVHQ 420
            PEL LHQCGLPKLMALELFKPFLYAQLEKKGYVSTVKQAKKFVEKERPEVWDVLAEVVHQ
Sbjct: 361  PELLLHQCGLPKLMALELFKPFLYAQLEKKGYVSTVKQAKKFVEKERPEVWDVLAEVVHQ 420

Query: 421  HVVLLNRAPSLHRLSMQAFEPKIISGKAIQLHPLVCAGYNADFDGDQMAVYAVISPEAQL 480
            HVVLLNRAPSLHRLSMQAFEPKIISGKAIQLHPLVCAGYNADFDGDQMAVY V+S EAQL
Sbjct: 421  HVVLLNRAPSLHRLSMQAFEPKIISGKAIQLHPLVCAGYNADFDGDQMAVYVVLSLEAQL 480

Query: 481  EARVLMLSTNNLLHPASGAPVTVPSQDMVLGLCYLSTVHEGDPGEGMLFADMGEVYHALE 540
            EARVLM+STNNLLHPASG PV VPSQDMVLGL YLS +HEGDPGEGM+FAD+ EVYHALE
Sbjct: 481  EARVLMMSTNNLLHPASGVPVVVPSQDMVLGLYYLSIIHEGDPGEGMVFADVDEVYHALE 540

Query: 541  NKIVTLHSKIRGRYKSVDKDGNSISKIYDTTPGRMIIGEILPRHHEISFDICNQEMIKKN 600
             K+VTLHSKIRGRYK++D+ GN +SKIY+TTPGRMI+GEILPRHH ISFDICNQEM+KKN
Sbjct: 541  RKVVTLHSKIRGRYKNIDESGNWVSKIYETTPGRMILGEILPRHHNISFDICNQEMVKKN 600

Query: 601  ISAMVDTIYRHCGQKSTVAFCDDLMRLGFRYACSSGISFGKDDIIVPESKEKIIAEADKM 660
            ISAMVD +YRHCGQKSTVAFCDDLMRLGFRYACSSGISFGKDDI+VP+SK KIIAEADKM
Sbjct: 601  ISAMVDAVYRHCGQKSTVAFCDDLMRLGFRYACSSGISFGKDDIVVPKSKGKIIAEADKM 660

Query: 661  VKEYENQYNDGLITRGEKYNKVVDLWGKTTDKVTEEMMARIKRVEFDPETGRQKKMNSIF 720
            VKEYENQYNDGLITRGEKYNKVVDLWGKTTDKVTEEMM+ IK+VEFDPETGRQKKMNSIF
Sbjct: 661  VKEYENQYNDGLITRGEKYNKVVDLWGKTTDKVTEEMMSLIKQVEFDPETGRQKKMNSIF 720

Query: 721  MMSHSGARGSIHQMRQLGGMRGLIAKPSGEIIESPIRSHFKGGLCGFEFFQSCVGGRKGL 780
            MMSHSGAR S+HQMRQLGGMRGLIAKPSGEIIESPIRSHFK GL GFEFFQSCVGGRKGL
Sbjct: 721  MMSHSGARSSVHQMRQLGGMRGLIAKPSGEIIESPIRSHFKDGLYGFEFFQSCVGGRKGL 780

Query: 781  LDVVMRTASSGYLSRRLVDVAQNCVVNQVDCNTKKGLTITHIVDSGQVVYSLGSRVLGRT 840
            LDVVMRTASSGYLSRRLVDVAQNC+VNQVDC T KGL+ITHIVDSGQVVYSLGSRVLGR 
Sbjct: 781  LDVVMRTASSGYLSRRLVDVAQNCIVNQVDCGTNKGLSITHIVDSGQVVYSLGSRVLGRI 840

Query: 841  ALDDIINPLTNECIVKAGQLILESHVNEIEKCGIRSVRIRSALTCESSRGVCVLCYGRDL 900
            ALDDI+NP+TN CI+KAG LILESHV EIEK GIRSVRIRSALTCES +GVC LCYGRDL
Sbjct: 841  ALDDIVNPVTNACIIKAGGLILESHVTEIEKSGIRSVRIRSALTCESKKGVCSLCYGRDL 900

Query: 901  ARGSLVNVGEAVGVIAAQSIGEPGTQLTMRTFHLGGAVTVMDRSFIESPCDGIVKIKNRN 960
            ARGSLVNVGEAVGVIAAQSIGEPGTQLTMRTFHLGGAVTVMDRSF+ES C+G VKIKNR+
Sbjct: 901  ARGSLVNVGEAVGVIAAQSIGEPGTQLTMRTFHLGGAVTVMDRSFLESSCEGTVKIKNRS 960

Query: 961  VCRNSTNDLISMGRNTTLQILDMSGQEQYSHRIMYGAKLFVDDGGVIECGQRISEWDPHT 1020
            VCRNS NDLISMGRNTTLQILD+SGQEQ SHRIMYGAKLFVDDG +++ GQR+SEWDPHT
Sbjct: 961  VCRNSANDLISMGRNTTLQILDVSGQEQSSHRIMYGAKLFVDDGDIVKYGQRVSEWDPHT 1020

Query: 1021 FPIITEVSGTVGFEDLVDGISVIESIGESTGIAKRKVIDWRFASRSQNLKPAIVVTDENG 1080
            FP+ITEVSG V FEDLVDG+SVIES+GESTGIAKRKVIDWRF SR QNLKPAIVV DENG
Sbjct: 1021 FPMITEVSGIVDFEDLVDGLSVIESVGESTGIAKRKVIDWRFTSRGQNLKPAIVVKDENG 1080

Query: 1081 VVLKSARGTDARWFLPVDALLSVSPGQKVSTGDVLARLPISSAKTKDITSGLPRVAELFE 1140
             VLK +RGTDARWFLPVDA+LSVSPGQKVS GDVLAR PISSAKTKDITSGLPRVAELFE
Sbjct: 1081 AVLKFSRGTDARWFLPVDAILSVSPGQKVSVGDVLARSPISSAKTKDITSGLPRVAELFE 1140

Query: 1141 ARRPKNHAILAEISGTIRIKRNYKNKSRVVIEPFEDGVEPAEYFIPKNKHFYLQDGDHVE 1200
            ARRPKNHAILAE+SG+I+IKRNYKNKSRV+IEPFE+GVEP EYFIPKNKHFYLQDGD VE
Sbjct: 1141 ARRPKNHAILAEVSGSIKIKRNYKNKSRVLIEPFEEGVEPVEYFIPKNKHFYLQDGDKVE 1200

Query: 1201 KGDYILDGNPVPQDILRIKGVEALASYLINEVQEVYRLEGVAINHKHIEVVVRHMLQKVE 1260
            KGDYIL+GNP P DILRIKG+EALASYLINEVQEVYRLEGV IN KHIEVV+R MLQKVE
Sbjct: 1201 KGDYILEGNPAPHDILRIKGIEALASYLINEVQEVYRLEGVLINDKHIEVVIRQMLQKVE 1260

Query: 1261 ITDPADTEYILGDNVDRIEVEELNRSLAQQGKKLVSFSPILQGITKASLQTKSFISAASF 1320
            ITDPADTEYILGDN+DR+EVEELNRSLAQQGKK VSFSP+LQGITKASLQTKSFISAASF
Sbjct: 1261 ITDPADTEYILGDNIDRVEVEELNRSLAQQGKKQVSFSPVLQGITKASLQTKSFISAASF 1320

Query: 1321 QETTKVLTEAAIAGKVDTLDGFKENVIVGRSIPAGTGAILHEKRRVAMNRDQMILKERSN 1380
            QETTKVLTEAAIAGKVD L+G KENVIVGR IPAGTGAILHEKRR+AMNRDQMILK RSN
Sbjct: 1321 QETTKVLTEAAIAGKVDMLEGLKENVIVGRLIPAGTGAILHEKRRIAMNRDQMILKARSN 1380

Query: 1381 FSQNEDLKNTAIQGSIAE 1398
             SQ+ D KN  IQG IAE
Sbjct: 1381 SSQDSDSKNNQIQGIIAE 1398


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|327194526|gb|EGE61384.1| DNA-directed RNA polymerase protein, beta' subunit [Rhizobium etli CNPAF512] Length = 1407 Back     alignment and organism information
>gi|86357298|ref|YP_469190.1| DNA-directed RNA polymerase subunit beta' [Rhizobium etli CFN 42] Length = 1402 Back     alignment and organism information
>gi|190891348|ref|YP_001977890.1| DNA-directed RNA polymerase protein, beta' subunit [Rhizobium etli CIAT 652] Length = 1402 Back     alignment and organism information
>gi|116251533|ref|YP_767371.1| DNA-directed RNA polymerase subunit beta' [Rhizobium leguminosarum bv. viciae 3841] Length = 1402 Back     alignment and organism information
>gi|209548928|ref|YP_002280845.1| DNA-directed RNA polymerase subunit beta' [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 1402 Back     alignment and organism information
>gi|241204158|ref|YP_002975254.1| DNA-directed RNA polymerase subunit beta' [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 1402 Back     alignment and organism information
>gi|222085669|ref|YP_002544199.1| DNA-directed RNA polymerase, beta' subunit [Agrobacterium radiobacter K84] Length = 1403 Back     alignment and organism information
>gi|159184989|ref|NP_354930.2| DNA-directed RNA polymerase subunit beta' [Agrobacterium tumefaciens str. C58] Length = 1402 Back     alignment and organism information
>gi|222148358|ref|YP_002549315.1| DNA-directed RNA polymerase subunit beta' [Agrobacterium vitis S4] Length = 1403 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target1398 DNA-directed RNA polymerase subunit beta' [Candidatus L
CHL00018663 CHL00018, rpoC1, RNA polymerase beta' subunit 0.0
TIGR02387619 TIGR02387, rpoC1_cyan, DNA-directed RNA polymerase, gam 0.0
PRK005661156 PRK00566, PRK00566, DNA-directed RNA polymerase subunit 0.0
TIGR023861140 TIGR02386, rpoC_TIGR, DNA-directed RNA polymerase, beta 0.0
PRK148442836 PRK14844, PRK14844, bifunctional DNA-directed RNA polym 0.0
PRK09603 2890 PRK09603, PRK09603, bifunctional DNA-directed RNA polym 0.0
PRK149061460 PRK14906, PRK14906, DNA-directed RNA polymerase subunit 0.0
PRK02625627 PRK02625, rpoC1, DNA-directed RNA polymerase subunit ga 0.0
PRK005661156 PRK00566, PRK00566, DNA-directed RNA polymerase subunit 1e-117
TIGR023861140 TIGR02386, rpoC_TIGR, DNA-directed RNA polymerase, beta 1e-87
PRK14906 1460 PRK14906, PRK14906, DNA-directed RNA polymerase subunit 4e-60
CHL001171364 CHL00117, rpoC2, RNA polymerase beta'' subunit; Reviewe 5e-49
cd02735309 cd02735, RNAP_I_Rpa1_C, Largest subunit (Rpa1) of Eukar 3e-04
smart00663295 smart00663, RPOLA_N, RNA polymerase I subunit A N-termi 1e-117
KOG0262 1640 KOG0262, KOG0262, KOG0262, RNA polymerase I, large subu 7e-30
PRK02597 1331 PRK02597, rpoC2, DNA-directed RNA polymerase subunit be 1e-105
TIGR02388 1227 TIGR02388, rpoC2_cyan, DNA-directed RNA polymerase, bet 6e-97
CHL00117 1364 CHL00117, rpoC2, RNA polymerase beta'' subunit; Reviewe 1e-91
PRK096032890 PRK09603, PRK09603, bifunctional DNA-directed RNA polym 5e-84
pfam04997330 pfam04997, RNA_pol_Rpb1_1, RNA polymerase Rpb1, domain 4e-82
TIGR02390868 TIGR02390, RNA_pol_rpoA1, DNA-directed RNA polymerase s 5e-74
KOG0260 1605 KOG0260, KOG0260, KOG0260, RNA polymerase II, large sub 3e-54
PRK08566882 PRK08566, PRK08566, DNA-directed RNA polymerase subunit 3e-70
PRK025971331 PRK02597, rpoC2, DNA-directed RNA polymerase subunit be 4e-69
TIGR023881227 TIGR02388, rpoC2_cyan, DNA-directed RNA polymerase, bet 1e-62
PRK149771321 PRK14977, PRK14977, bifunctional DNA-directed RNA polym 2e-68
cd02655204 cd02655, RNAP_beta'_C, Largest subunit (beta') of Bacte 8e-60
cd00630158 cd00630, RNAP_largest_subunit_C, Largest subunit of RNA 7e-20
cd06528363 cd06528, RNAP_A'', A'' subunit of Archaeal RNA Polymera 6e-09
cd02736300 cd02736, RNAP_III_Rpc1_C, Largest subunit (Rpc1) of Euk 1e-08
PRK04309383 PRK04309, PRK04309, DNA-directed RNA polymerase subunit 1e-08
PRK14897509 PRK14897, PRK14897, unknown domain/DNA-directed RNA pol 2e-08
PRK14898858 PRK14898, PRK14898, DNA-directed RNA polymerase subunit 8e-07
KOG02611386 KOG0261, KOG0261, KOG0261, RNA polymerase III, large su 1e-05
PRK149771321 PRK14977, PRK14977, bifunctional DNA-directed RNA polym 4e-05
PRK149061460 PRK14906, PRK14906, DNA-directed RNA polymerase subunit 4e-56
KOG02611386 KOG0261, KOG0261, KOG0261, RNA polymerase III, large su 1e-55
pfam00623165 pfam00623, RNA_pol_Rpb1_2, RNA polymerase Rpb1, domain 2e-54
pfam04998447 pfam04998, RNA_pol_Rpb1_5, RNA polymerase Rpb1, domain 2e-46
pfam04983158 pfam04983, RNA_pol_Rpb1_3, RNA polymerase Rpb1, domain 5e-25
pfam04998447 pfam04998, RNA_pol_Rpb1_5, RNA polymerase Rpb1, domain 1e-22
cd02655204 cd02655, RNAP_beta'_C, Largest subunit (beta') of Bacte 3e-17
PRK04309383 PRK04309, PRK04309, DNA-directed RNA polymerase subunit 2e-12
cd06528363 cd06528, RNAP_A'', A'' subunit of Archaeal RNA Polymera 8e-12
cd02735309 cd02735, RNAP_I_Rpa1_C, Largest subunit (Rpa1) of Eukar 8e-11
PRK14897509 PRK14897, PRK14897, unknown domain/DNA-directed RNA pol 6e-10
cd00630158 cd00630, RNAP_largest_subunit_C, Largest subunit of RNA 2e-09
cd02584410 cd02584, RNAP_II_Rpb1_C, Largest subunit (Rpb1) of Euka 2e-09
KOG02621640 KOG0262, KOG0262, KOG0262, RNA polymerase I, large subu 3e-09
cd02736300 cd02736, RNAP_III_Rpc1_C, Largest subunit (Rpc1) of Euk 1e-08
KOG02601605 KOG0260, KOG0260, KOG0260, RNA polymerase II, large sub 5e-05
COG0086808 COG0086, RpoC, DNA-directed RNA polymerase, beta' subun 0.001
PRK14898 858 PRK14898, PRK14898, DNA-directed RNA polymerase subunit 0.002
pfam05000108 pfam05000, RNA_pol_Rpb1_4, RNA polymerase Rpb1, domain 2e-16
TIGR02389367 TIGR02389, RNA_pol_rpoA2, DNA-directed RNA polymerase, 6e-11
KOG0260 1605 KOG0260, KOG0260, KOG0260, RNA polymerase II, large sub 1e-07
KOG02621640 KOG0262, KOG0262, KOG0262, RNA polymerase I, large subu 7e-05
TIGR02389367 TIGR02389, RNA_pol_rpoA2, DNA-directed RNA polymerase, 2e-07
KOG02621640 KOG0262, KOG0262, KOG0262, RNA polymerase I, large subu 7e-07
cd02584410 cd02584, RNAP_II_Rpb1_C, Largest subunit (Rpb1) of Euka 9e-07
COG0086808 COG0086, RpoC, DNA-directed RNA polymerase, beta' subun 9e-04
COG0086808 COG0086, RpoC, DNA-directed RNA polymerase, beta' subun 0.0
>gnl|CDD|176961 CHL00018, rpoC1, RNA polymerase beta' subunit Back     alignment and domain information
>gnl|CDD|131440 TIGR02387, rpoC1_cyan, DNA-directed RNA polymerase, gamma subunit Back     alignment and domain information
>gnl|CDD|179068 PRK00566, PRK00566, DNA-directed RNA polymerase subunit beta'; Provisional Back     alignment and domain information
>gnl|CDD|162830 TIGR02386, rpoC_TIGR, DNA-directed RNA polymerase, beta' subunit, predominant form Back     alignment and domain information
>gnl|CDD|173305 PRK14844, PRK14844, bifunctional DNA-directed RNA polymerase subunit beta/beta'; Provisional Back     alignment and domain information
>gnl|CDD|181983 PRK09603, PRK09603, bifunctional DNA-directed RNA polymerase subunit beta/beta'; Reviewed Back     alignment and domain information
>gnl|CDD|184899 PRK14906, PRK14906, DNA-directed RNA polymerase subunit beta'/alpha domain fusion protein; Provisional Back     alignment and domain information
>gnl|CDD|179452 PRK02625, rpoC1, DNA-directed RNA polymerase subunit gamma; Provisional Back     alignment and domain information
>gnl|CDD|179068 PRK00566, PRK00566, DNA-directed RNA polymerase subunit beta'; Provisional Back     alignment and domain information
>gnl|CDD|162830 TIGR02386, rpoC_TIGR, DNA-directed RNA polymerase, beta' subunit, predominant form Back     alignment and domain information
>gnl|CDD|184899 PRK14906, PRK14906, DNA-directed RNA polymerase subunit beta'/alpha domain fusion protein; Provisional Back     alignment and domain information
>gnl|CDD|177040 CHL00117, rpoC2, RNA polymerase beta'' subunit; Reviewed Back     alignment and domain information
>gnl|CDD|132722 cd02735, RNAP_I_Rpa1_C, Largest subunit (Rpa1) of Eukaryotic RNA polymerase I (RNAP I), C-terminal domain Back     alignment and domain information
>gnl|CDD|128909 smart00663, RPOLA_N, RNA polymerase I subunit A N-terminus Back     alignment and domain information
>gnl|CDD|35483 KOG0262, KOG0262, KOG0262, RNA polymerase I, large subunit [Transcription] Back     alignment and domain information
>gnl|CDD|179447 PRK02597, rpoC2, DNA-directed RNA polymerase subunit beta'; Provisional Back     alignment and domain information
>gnl|CDD|162831 TIGR02388, rpoC2_cyan, DNA-directed RNA polymerase, beta'' subunit Back     alignment and domain information
>gnl|CDD|177040 CHL00117, rpoC2, RNA polymerase beta'' subunit; Reviewed Back     alignment and domain information
>gnl|CDD|181983 PRK09603, PRK09603, bifunctional DNA-directed RNA polymerase subunit beta/beta'; Reviewed Back     alignment and domain information
>gnl|CDD|147265 pfam04997, RNA_pol_Rpb1_1, RNA polymerase Rpb1, domain 1 Back     alignment and domain information
>gnl|CDD|162833 TIGR02390, RNA_pol_rpoA1, DNA-directed RNA polymerase subunit A' Back     alignment and domain information
>gnl|CDD|35481 KOG0260, KOG0260, KOG0260, RNA polymerase II, large subunit [Transcription] Back     alignment and domain information
>gnl|CDD|181474 PRK08566, PRK08566, DNA-directed RNA polymerase subunit A'; Validated Back     alignment and domain information
>gnl|CDD|179447 PRK02597, rpoC2, DNA-directed RNA polymerase subunit beta'; Provisional Back     alignment and domain information
>gnl|CDD|162831 TIGR02388, rpoC2_cyan, DNA-directed RNA polymerase, beta'' subunit Back     alignment and domain information
>gnl|CDD|184940 PRK14977, PRK14977, bifunctional DNA-directed RNA polymerase A'/A'' subunit; Provisional Back     alignment and domain information
>gnl|CDD|132721 cd02655, RNAP_beta'_C, Largest subunit (beta') of Bacterial DNA-dependent RNA polymerase (RNAP), C-terminal domain Back     alignment and domain information
>gnl|CDD|132719 cd00630, RNAP_largest_subunit_C, Largest subunit of RNA polymerase (RNAP), C-terminal domain Back     alignment and domain information
>gnl|CDD|132725 cd06528, RNAP_A'', A'' subunit of Archaeal RNA Polymerase (RNAP) Back     alignment and domain information
>gnl|CDD|132723 cd02736, RNAP_III_Rpc1_C, Largest subunit (Rpc1) of Eukaryotic RNA polymerase III (RNAP III), C-terminal domain Back     alignment and domain information
>gnl|CDD|179818 PRK04309, PRK04309, DNA-directed RNA polymerase subunit A''; Validated Back     alignment and domain information
>gnl|CDD|184891 PRK14897, PRK14897, unknown domain/DNA-directed RNA polymerase subunit A'' fusion protein; Provisional Back     alignment and domain information
>gnl|CDD|184892 PRK14898, PRK14898, DNA-directed RNA polymerase subunit A''; Provisional Back     alignment and domain information
>gnl|CDD|35482 KOG0261, KOG0261, KOG0261, RNA polymerase III, large subunit [Transcription] Back     alignment and domain information
>gnl|CDD|184940 PRK14977, PRK14977, bifunctional DNA-directed RNA polymerase A'/A'' subunit; Provisional Back     alignment and domain information
>gnl|CDD|184899 PRK14906, PRK14906, DNA-directed RNA polymerase subunit beta'/alpha domain fusion protein; Provisional Back     alignment and domain information
>gnl|CDD|35482 KOG0261, KOG0261, KOG0261, RNA polymerase III, large subunit [Transcription] Back     alignment and domain information
>gnl|CDD|144278 pfam00623, RNA_pol_Rpb1_2, RNA polymerase Rpb1, domain 2 Back     alignment and domain information
>gnl|CDD|147266 pfam04998, RNA_pol_Rpb1_5, RNA polymerase Rpb1, domain 5 Back     alignment and domain information
>gnl|CDD|147253 pfam04983, RNA_pol_Rpb1_3, RNA polymerase Rpb1, domain 3 Back     alignment and domain information
>gnl|CDD|147266 pfam04998, RNA_pol_Rpb1_5, RNA polymerase Rpb1, domain 5 Back     alignment and domain information
>gnl|CDD|132721 cd02655, RNAP_beta'_C, Largest subunit (beta') of Bacterial DNA-dependent RNA polymerase (RNAP), C-terminal domain Back     alignment and domain information
>gnl|CDD|179818 PRK04309, PRK04309, DNA-directed RNA polymerase subunit A''; Validated Back     alignment and domain information
>gnl|CDD|132725 cd06528, RNAP_A'', A'' subunit of Archaeal RNA Polymerase (RNAP) Back     alignment and domain information
>gnl|CDD|132722 cd02735, RNAP_I_Rpa1_C, Largest subunit (Rpa1) of Eukaryotic RNA polymerase I (RNAP I), C-terminal domain Back     alignment and domain information
>gnl|CDD|184891 PRK14897, PRK14897, unknown domain/DNA-directed RNA polymerase subunit A'' fusion protein; Provisional Back     alignment and domain information
>gnl|CDD|132719 cd00630, RNAP_largest_subunit_C, Largest subunit of RNA polymerase (RNAP), C-terminal domain Back     alignment and domain information
>gnl|CDD|132720 cd02584, RNAP_II_Rpb1_C, Largest subunit (Rpb1) of Eukaryotic RNA polymerase II (RNAP II), C-terminal domain Back     alignment and domain information
>gnl|CDD|35483 KOG0262, KOG0262, KOG0262, RNA polymerase I, large subunit [Transcription] Back     alignment and domain information
>gnl|CDD|132723 cd02736, RNAP_III_Rpc1_C, Largest subunit (Rpc1) of Eukaryotic RNA polymerase III (RNAP III), C-terminal domain Back     alignment and domain information
>gnl|CDD|35481 KOG0260, KOG0260, KOG0260, RNA polymerase II, large subunit [Transcription] Back     alignment and domain information
>gnl|CDD|30435 COG0086, RpoC, DNA-directed RNA polymerase, beta' subunit/160 kD subunit [Transcription] Back     alignment and domain information
>gnl|CDD|184892 PRK14898, PRK14898, DNA-directed RNA polymerase subunit A''; Provisional Back     alignment and domain information
>gnl|CDD|147268 pfam05000, RNA_pol_Rpb1_4, RNA polymerase Rpb1, domain 4 Back     alignment and domain information
>gnl|CDD|162832 TIGR02389, RNA_pol_rpoA2, DNA-directed RNA polymerase, subunit A'' Back     alignment and domain information
>gnl|CDD|35481 KOG0260, KOG0260, KOG0260, RNA polymerase II, large subunit [Transcription] Back     alignment and domain information
>gnl|CDD|35483 KOG0262, KOG0262, KOG0262, RNA polymerase I, large subunit [Transcription] Back     alignment and domain information
>gnl|CDD|162832 TIGR02389, RNA_pol_rpoA2, DNA-directed RNA polymerase, subunit A'' Back     alignment and domain information
>gnl|CDD|35483 KOG0262, KOG0262, KOG0262, RNA polymerase I, large subunit [Transcription] Back     alignment and domain information
>gnl|CDD|132720 cd02584, RNAP_II_Rpb1_C, Largest subunit (Rpb1) of Eukaryotic RNA polymerase II (RNAP II), C-terminal domain Back     alignment and domain information
>gnl|CDD|30435 COG0086, RpoC, DNA-directed RNA polymerase, beta' subunit/160 kD subunit [Transcription] Back     alignment and domain information
>gnl|CDD|30435 COG0086, RpoC, DNA-directed RNA polymerase, beta' subunit/160 kD subunit [Transcription] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 1398 DNA-directed RNA polymerase subunit beta' [Candidatus L
100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. This entry represents the beta-prime subunit, RpoC, found in most bacteria. It excludes some, mainly cyanobacterial, species where RpoC is replaced by two homologous proteins that include an additional domain. One arm of the "claw" is predominantly formed by this subunit, the other being predominantly formed by the beta subunit. The active site of the enzyme is defined by three invariant aspartate residues within the beta-prime subunit .; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006350 transcription." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02386">TIGR023861552 rpoC_TIGR DNA-directed RNA polymerase, beta' subunit; I 100.0
PRK014971384 DNA-directed RNA polymerase subunit beta'; Provisional 100.0
PRK096032890 DNA-directed RNA polymerase subunit beta/beta'; Reviewe 100.0
PRK052581204 DNA-directed RNA polymerase subunit beta'; Provisional 100.0
PRK021731438 DNA-directed RNA polymerase subunit beta'; Provisional 100.0
PRK029951291 DNA-directed RNA polymerase subunit beta'; Provisional 100.0
PRK005661284 DNA-directed RNA polymerase subunit beta'; Provisional 100.0
KOG0260 1605 consensus 100.0
KOG02611386 consensus 100.0
KOG02621640 consensus 100.0
100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. This family consists of the archaeal A' subunit of the DNA-directed RNA polymerase. The example from Methanococcus jannaschii contains an intein.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0008270 zinc ion binding, 0006350 transcription." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02390">TIGR02390901 RNA_pol_rpoA1 DNA-directed RNA polymerase subunit A'; I 100.0
PRK08566881 DNA-directed RNA polymerase subunit alpha; Validated 100.0
COG0086808 RpoC DNA-directed RNA polymerase, beta' subunit/160 kD 100.0
PRK02625627 DNA-directed RNA polymerase subunit gamma; Provisional 100.0
CHL00018668 rpoC1 RNA polymerase beta' subunit 100.0
PRK025971295 DNA-directed RNA polymerase subunit beta'; Provisional 100.0
100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. The family consists of the product of the rpoC2 gene, a subunit of DNA-directed RNA polymerase of cyanobacteria and chloroplasts. RpoC2 corresponds largely to the C-terminal region of the RpoC (the beta' subunit) of other bacteria. Members of this family are designated beta'' in chloroplasts/plastids, and beta' (confusingly) in Cyanobacteria, where RpoC1 is called beta' in chloroplasts/plastids and gamma in Cyanobacteria. We prefer to name this family beta'', after its organellar members, to emphasize that this RpoC1 and RpoC2 together replace RpoC in other bacteria.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006350 transcription." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02388">TIGR023881252 rpoC2_cyan DNA-directed RNA polymerase, beta'' subunit; 100.0
CHL00117 1350 rpoC2 RNA polymerase beta'' subunit; Reviewed 100.0
CHL00006 1372 consensus 100.0
100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. The RNA polymerase gamma subunit, encoded by the rpoC1 gene, is found in cyanobacteria and corresponds to the N-terminal region the beta' subunit, encoded by rpoC, in other bacteria. The equivalent subunit in plastids and chloroplasts is designated beta', while the product of the rpoC2 gene is designated beta''.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006350 transcription." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02387">TIGR02387625 rpoC1_cyan DNA-directed RNA polymerase, gamma subunit; 100.0
smart00663295 RPOLA_N RNA polymerase I subunit A N-terminus. 100.0
pfam04998447 RNA_pol_Rpb1_5 RNA polymerase Rpb1, domain 5. RNA polym 100.0
PRK04309381 DNA-directed RNA polymerase subunit A''; Validated 100.0
cd06528363 RNAP_A'' A'' subunit of Archaeal RNA Polymerase (RNAP). 100.0
cd02584410 RNAP_II_Rpb1_C Largest subunit (Rpb1) of Eukaryotic RNA 100.0
100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. This family consists of the archaeal A'' subunit of the DNA-directed RNA polymerase. The example from Methanococcus jannaschii contains an intein.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006350 transcription." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02389">TIGR02389397 RNA_pol_rpoA2 DNA-directed RNA polymerase, subunit A''; 100.0
cd02736300 RNAP_III_Rpc1_C Largest subunit (Rpc1) of Eukaryotic RN 100.0
cd02735309 RNAP_I_Rpa1_C Largest subunit (Rpa1) of Eukaryotic RNA 100.0
pfam04997330 RNA_pol_Rpb1_1 RNA polymerase Rpb1, domain 1. RNA polym 100.0
cd02655204 RNAP_beta'_C Largest subunit (beta') of Bacterial DNA-d 100.0
cd02737381 RNAP_IV_NRPD1_C Largest subunit (NRPD1) of Higher plant 100.0
pfam00623165 RNA_pol_Rpb1_2 RNA polymerase Rpb1, domain 2. RNA polym 100.0
cd00630158 RNAP_largest_subunit_C Largest subunit of RNA polymeras 100.0
COG0086808 RpoC DNA-directed RNA polymerase, beta' subunit/160 kD 99.68
pfam04983158 RNA_pol_Rpb1_3 RNA polymerase Rpb1, domain 3. RNA polym 99.93
pfam04998447 RNA_pol_Rpb1_5 RNA polymerase Rpb1, domain 5. RNA polym 98.98
pfam05000108 RNA_pol_Rpb1_4 RNA polymerase Rpb1, domain 4. RNA polym 98.83
PRK029951291 DNA-directed RNA polymerase subunit beta'; Provisional 96.99
PRK052581204 DNA-directed RNA polymerase subunit beta'; Provisional 96.26
100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. This entry represents the beta-prime subunit, RpoC, found in most bacteria. It excludes some, mainly cyanobacterial, species where RpoC is replaced by two homologous proteins that include an additional domain. One arm of the "claw" is predominantly formed by this subunit, the other being predominantly formed by the beta subunit. The active site of the enzyme is defined by three invariant aspartate residues within the beta-prime subunit .; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006350 transcription." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02386">TIGR023861552 rpoC_TIGR DNA-directed RNA polymerase, beta' subunit; I 95.95
pfam05183381 RdRP RNA dependent RNA polymerase. This family of prote 90.52
>TIGR02386 rpoC_TIGR DNA-directed RNA polymerase, beta' subunit; InterPro: IPR012754 DNA-directed RNA polymerases 2 Back     alignment and domain information
>PRK01497 DNA-directed RNA polymerase subunit beta'; Provisional Back     alignment and domain information
>PRK09603 DNA-directed RNA polymerase subunit beta/beta'; Reviewed Back     alignment and domain information
>PRK05258 DNA-directed RNA polymerase subunit beta'; Provisional Back     alignment and domain information
>PRK02173 DNA-directed RNA polymerase subunit beta'; Provisional Back     alignment and domain information
>PRK02995 DNA-directed RNA polymerase subunit beta'; Provisional Back     alignment and domain information
>PRK00566 DNA-directed RNA polymerase subunit beta'; Provisional Back     alignment and domain information
>KOG0260 consensus Back     alignment and domain information
>KOG0261 consensus Back     alignment and domain information
>KOG0262 consensus Back     alignment and domain information
>TIGR02390 RNA_pol_rpoA1 DNA-directed RNA polymerase subunit A'; InterPro: IPR012758 DNA-directed RNA polymerases 2 Back     alignment and domain information
>PRK08566 DNA-directed RNA polymerase subunit alpha; Validated Back     alignment and domain information
>COG0086 RpoC DNA-directed RNA polymerase, beta' subunit/160 kD subunit [Transcription] Back     alignment and domain information
>PRK02625 DNA-directed RNA polymerase subunit gamma; Provisional Back     alignment and domain information
>CHL00018 rpoC1 RNA polymerase beta' subunit Back     alignment and domain information
>PRK02597 DNA-directed RNA polymerase subunit beta'; Provisional Back     alignment and domain information
>TIGR02388 rpoC2_cyan DNA-directed RNA polymerase, beta'' subunit; InterPro: IPR012756 DNA-directed RNA polymerases 2 Back     alignment and domain information
>CHL00117 rpoC2 RNA polymerase beta'' subunit; Reviewed Back     alignment and domain information
>CHL00006 consensus Back     alignment and domain information
>TIGR02387 rpoC1_cyan DNA-directed RNA polymerase, gamma subunit; InterPro: IPR012755 DNA-directed RNA polymerases 2 Back     alignment and domain information
>smart00663 RPOLA_N RNA polymerase I subunit A N-terminus Back     alignment and domain information
>pfam04998 RNA_pol_Rpb1_5 RNA polymerase Rpb1, domain 5 Back     alignment and domain information
>PRK04309 DNA-directed RNA polymerase subunit A''; Validated Back     alignment and domain information
>cd06528 RNAP_A'' A'' subunit of Archaeal RNA Polymerase (RNAP) Back     alignment and domain information
>cd02584 RNAP_II_Rpb1_C Largest subunit (Rpb1) of Eukaryotic RNA polymerase II (RNAP II), C-terminal domain Back     alignment and domain information
>TIGR02389 RNA_pol_rpoA2 DNA-directed RNA polymerase, subunit A''; InterPro: IPR012757 DNA-directed RNA polymerases 2 Back     alignment and domain information
>cd02736 RNAP_III_Rpc1_C Largest subunit (Rpc1) of Eukaryotic RNA polymerase III (RNAP III), C-terminal domain Back     alignment and domain information
>cd02735 RNAP_I_Rpa1_C Largest subunit (Rpa1) of Eukaryotic RNA polymerase I (RNAP I), C-terminal domain Back     alignment and domain information
>pfam04997 RNA_pol_Rpb1_1 RNA polymerase Rpb1, domain 1 Back     alignment and domain information
>cd02655 RNAP_beta'_C Largest subunit (beta') of Bacterial DNA-dependent RNA polymerase (RNAP), C-terminal domain Back     alignment and domain information
>cd02737 RNAP_IV_NRPD1_C Largest subunit (NRPD1) of Higher plant RNA polymerase IV, C-terminal domain Back     alignment and domain information
>pfam00623 RNA_pol_Rpb1_2 RNA polymerase Rpb1, domain 2 Back     alignment and domain information
>cd00630 RNAP_largest_subunit_C Largest subunit of RNA polymerase (RNAP), C-terminal domain Back     alignment and domain information
>COG0086 RpoC DNA-directed RNA polymerase, beta' subunit/160 kD subunit [Transcription] Back     alignment and domain information
>pfam04983 RNA_pol_Rpb1_3 RNA polymerase Rpb1, domain 3 Back     alignment and domain information
>pfam04998 RNA_pol_Rpb1_5 RNA polymerase Rpb1, domain 5 Back     alignment and domain information
>pfam05000 RNA_pol_Rpb1_4 RNA polymerase Rpb1, domain 4 Back     alignment and domain information
>PRK02995 DNA-directed RNA polymerase subunit beta'; Provisional Back     alignment and domain information
>PRK05258 DNA-directed RNA polymerase subunit beta'; Provisional Back     alignment and domain information
>TIGR02386 rpoC_TIGR DNA-directed RNA polymerase, beta' subunit; InterPro: IPR012754 DNA-directed RNA polymerases 2 Back     alignment and domain information
>pfam05183 RdRP RNA dependent RNA polymerase Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target1398 DNA-directed RNA polymerase subunit beta' [Candidatus L
3iyd_D1413 Three-Dimensional Em Structure Of An Intact Activat 0.0
3lu0_D1407 Molecular Model Of Escherichia Coli Core Rna Polyme 0.0
3h0g_A 1752 Rna Polymerase Ii From Schizosaccharomyces Pombe Le 0.0
1i3q_A 1733 Rna Polymerase Ii Crystal Form I At 3.1 A Resolutio 0.0
2gho_D1233 Recombinant Thermus Aquaticus Rna Polymerase For St 0.0
1hqm_D1265 Crystal Structure Of Thermus Aquaticus Core Rna Pol 0.0
1i6v_D1264 Thermus Aquaticus Core Rna Polymerase-Rifampicin Co 0.0
2gho_D1233 Recombinant Thermus Aquaticus Rna Polymerase For St 4e-96
1hqm_D1265 Crystal Structure Of Thermus Aquaticus Core Rna Pol 5e-96
1i6v_D1264 Thermus Aquaticus Core Rna Polymerase-Rifampicin Co 3e-96
1iw7_D1524 Crystal Structure Of The Rna Polymerase Holoenzyme 1e-94
1l9u_D1524 Thermus Aquaticus Rna Polymerase Holoenzyme At 4 A 7e-96
1iw7_D1524 Crystal Structure Of The Rna Polymerase Holoenzyme 0.0
1l9u_D1524 Thermus Aquaticus Rna Polymerase Holoenzyme At 4 A 0.0
1iw7_D 1524 Crystal Structure Of The Rna Polymerase Holoenzyme 1e-80
1l9u_D 1524 Thermus Aquaticus Rna Polymerase Holoenzyme At 4 A 2e-81
2waq_A880 The Complete Structure Of The Archaeal 13-Subunit D 1e-150
2pmz_A880 Archaeal Rna Polymerase From Sulfolobus Solfataricu 1e-148
3qqc_A436 Crystal Structure Of Archaeal Spt45 BOUND TO THE RN 1e-71
3qqc_A436 Crystal Structure Of Archaeal Spt45 BOUND TO THE RN 2e-06
2waq_C395 The Complete Structure Of The Archaeal 13-Subunit D 8e-40
2y0s_C395 Crystal Structure Of Sulfolobus Shibatae Rna Polyme 4e-39
2pmz_C392 Archaeal Rna Polymerase From Sulfolobus Solfataricu 4e-38
3hkz_C395 The X-Ray Crystal Structure Of Rna Polymerase From 5e-38
2auk_A190 Structure Of E. Coli Rna Polymerase Beta' GG' INSER 3e-33
>gi|266618718|pdb|3IYD|D Chain D, Three-Dimensional Em Structure Of An Intact Activator- Dependent Transcription Initiation Complex Length = 1413 Back     alignment and structure
 Score = 1727 bits (4473), Expect = 0.0,   Method: Composition-based stats.
 Identities = 743/1372 (54%), Positives = 982/1372 (71%), Gaps = 14/1372 (1%)

Query: 3    QEVMRFFNPWTDDRGFDSVRISIASPAKIASLSYGEIKKPETINYRTFKPERDGLFCARI 62
            +++++F    T    FD+++I++ASP  I S S+GE+KKPETINYRTFKPERDGLFCARI
Sbjct: 2    KDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARI 61

Query: 63   FGPIKDYECICGKYKRMKYKGIICEKCGVEVTLSSVRRDRMAHIDLASPVAHPWFLKSLP 122
            FGP+KDYEC+CGKYKR+K++G+ICEKCGVEVT + VRR+RM HI+LASP AH WFLKSLP
Sbjct: 62   FGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGHIELASPTAHIWFLKSLP 121

Query: 123  SRISTLLGMSLRDVERVLYFESYVVVDPGLSSLEKYQILTEEEYVEAVSQFGQDQFIAMM 182
            SRI  LL M LRD+ERVLYFESYVV++ G+++LE+ QILTEE+Y++A+ +FG D+F A M
Sbjct: 122  SRIGLLLDMPLRDIERVLYFESYVVIEGGMTNLERQQILTEEQYLDALEEFG-DEFDAKM 180

Query: 183  GADAIYELLIALDLQNLALTLRDQLSKSSSIFRRKKIIKRLKIVDSFITSGNNPGWMIIR 242
            GA+AI  LL ++DL+     LR++L++++S  +RKK+ KR+K++++F+ SGN P WMI+ 
Sbjct: 181  GAEAIQALLKSMDLEQECEQLREELNETNSETKRKKLTKRIKLLEAFVQSGNKPEWMILT 240

Query: 243  KLPVLPPDLRPLVALDFGRFAASDLNDLYRRVIGRNNRLMRLKSLHAPEIIIRNEKRMLQ 302
             LPVLPPDLRPLV LD GRFA SDLNDLYRRVI RNNRL RL  L AP+II+RNEKRMLQ
Sbjct: 241  VLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLLDLAAPDIIVRNEKRMLQ 300

Query: 303  ESVDALFDNGRHKRVVTGANRRPLKSLSDMLKGKQGRFRTNLLGKRVDYSGRSVIVAGPE 362
            E+VDAL DNGR  R +TG+N+RPLKSL+DM+KGKQGRFR NLLGKRVDYSGRSVI  GP 
Sbjct: 301  EAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGPY 360

Query: 363  LQLHQCGLPKLMALELFKPFLYAQLEKKGYVSTVKQAKKFVEKERPEVWDVLAEVVHQHV 422
            L+LHQCGLPK MALELFKPF+Y +LE +G  +T+K AKK VE+E   VWD+L EV+ +H 
Sbjct: 361  LRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKKMVEREEAVVWDILDEVIREHP 420

Query: 423  VLLNRAPSLHRLSMQAFEPKIISGKAIQLHPLVCAGYNADFDGDQMAVYAVISPEAQLEA 482
            VLLNRAP+LHRL +QAFEP +I GKAIQLHPLVCA YNADFDGDQMAV+  ++ EAQLEA
Sbjct: 421  VLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLEA 480

Query: 483  RVLMLSTNNLLHPASGAPVTVPSQDMVLGLCYLSTVHEGDPGEGMLFADMGEVYHALENK 542
            R LM+STNN+L PA+G P+ VPSQD+VLGL Y++       GEGM+     E      + 
Sbjct: 481  RALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRDCVNAKGEGMVLTGPKEAERLYRSG 540

Query: 543  IVTLHSKIRGRYKSVDKDGNS----ISKIYDTTPGRMIIGEILPRHHEISFDICNQEMIK 598
            + +LH++++ R    +KD N      + + DTT GR I+  I+P+   + + I NQ + K
Sbjct: 541  LASLHARVKVRITEYEKDANGELVAKTSLKDTTVGRAILWMIVPKG--LPYSIVNQALGK 598

Query: 599  KNISAMVDTIYRHCGQKSTVAFCDDLMRLGFRYACSSGISFGKDDIIVPESKEKIIAEAD 658
            K IS M++T YR  G K TV F D +M  GF YA  SG S G DD+++PE K +II+EA+
Sbjct: 599  KAISKMLNTCYRILGLKPTVIFADQIMYTGFAYAARSGASVGIDDMVIPEKKHEIISEAE 658

Query: 659  KMVKEYENQYNDGLITRGEKYNKVVDLWGKTTDKVTEEMMARIKRV---EFDPETGRQKK 715
              V E + Q+  GL+T GE+YNKV+D+W    D+V++ MM  ++       D +  +Q  
Sbjct: 659  AEVAEIQEQFQSGLVTAGERYNKVIDIWAAANDRVSKAMMDNLQTETVINRDGQEEKQVS 718

Query: 716  MNSIFMMSHSGARGSIHQMRQLGGMRGLIAKPSGEIIESPIRSHFKGGLCGFEFFQSCVG 775
             NSI+MM+ SGARGS  Q+RQL GMRGL+AKP G IIE+PI ++F+ GL   ++F S  G
Sbjct: 719  FNSIYMMADSGARGSAAQIRQLAGMRGLMAKPDGSIIETPITANFREGLNVLQYFISTHG 778

Query: 776  GRKGLLDVVMRTASSGYLSRRLVDVAQNCVVNQVDCNTKKGLTITHIVDSGQVVYSLGSR 835
             RKGL D  ++TA+SGYL+RRLVDVAQ+ VV + DC T +G+ +T +++ G V   L  R
Sbjct: 779  ARKGLADTALKTANSGYLTRRLVDVAQDLVVTEDDCGTHEGIMMTPVIEGGDVKEPLRDR 838

Query: 836  VLGRTALDDIINPLTNECIVKAGQLILESHVNEIEKCGIRSVRIRSALTCESSRGVCVLC 895
            VLGR   +D++ P T + +V    L+ E   + +E+  + +V++RS ++C++  GVC  C
Sbjct: 839  VLGRVTAEDVLKPGTADILVPRNTLLHEQWCDLLEENSVDAVKVRSVVSCDTDFGVCAHC 898

Query: 896  YGRDLARGSLVNVGEAVGVIAAQSIGEPGTQLTMRTFHLGG-AVTVMDRSFIESPCDGIV 954
            YGRDLARG ++N GEA+GVIAAQSIGEPGTQLTMRTFH+GG A      S I+    G +
Sbjct: 899  YGRDLARGHIINKGEAIGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAESSIQVKNKGSI 958

Query: 955  KIKNRNVCRNSTNDLISMGRNTTLQILDMSGQEQYSHRIMYGAKLFVDDGGVIECGQRIS 1014
            K+ N     NS+  L+   RNT L+++D  G+ + S+++ YGA L   DG  +  G+ ++
Sbjct: 959  KLSNVKSVVNSSGKLVITSRNTELKLIDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVA 1018

Query: 1015 EWDPHTFPIITEVSGTVGFEDLVDGISVIESIGESTGIAKRKVIDW-RFASRSQNLKPAI 1073
             WDPHT P+ITEVSG V F D++DG ++     E TG++   V+D     +  ++L+PA+
Sbjct: 1019 NWDPHTMPVITEVSGFVRFTDMIDGQTITRQTDELTGLSSLVVLDSAERTAGGKDLRPAL 1078

Query: 1074 VVTDENGV-VLKSARGTDARWFLPVDALLSVSPGQKVSTGDVLARLPISSAKTKDITSGL 1132
             + D  G  VL       A++FLP  A++ +  G ++S+GD LAR+P  S  TKDIT GL
Sbjct: 1079 KIVDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIPQESGGTKDITGGL 1138

Query: 1133 PRVAELFEARRPKNHAILAEISGTIRIKRNYKNKSRVVIEPFEDGVEPAEYFIPKNKHFY 1192
            PRVA+LFEARRPK  AILAEISG +   +  K K R+VI P  DG +P E  IPK +   
Sbjct: 1139 PRVADLFEARRPKEPAILAEISGIVSFGKETKGKRRLVITPV-DGSDPYEEMIPKWRQLN 1197

Query: 1193 LQDGDHVEKGDYILDGNPVPQDILRIKGVEALASYLINEVQEVYRLEGVAINHKHIEVVV 1252
            + +G+ VE+GD I DG   P DILR++GV A+  Y++NEVQ+VYRL+GV IN KHIEV+V
Sbjct: 1198 VFEGERVERGDVISDGPEAPHDILRLRGVHAVTRYIVNEVQDVYRLQGVKINDKHIEVIV 1257

Query: 1253 RHMLQKVEITDPADTEYILGDNVDRIEVEELNRSLAQQGKKLVSFSPILQGITKASLQTK 1312
            R ML+K  I +   ++++ G+ V+   V+  NR L   GK   ++S  L GITKASL T+
Sbjct: 1258 RQMLRKATIVNAGSSDFLEGEQVEYSRVKIANRELEANGKVGATYSRDLLGITKASLATE 1317

Query: 1313 SFISAASFQETTKVLTEAAIAGKVDTLDGFKENVIVGRSIPAGTGAILHEKR 1364
            SFISAASFQETT+VLTEAA+AGK D L G KENVIVGR IPAGTG   H+ R
Sbjct: 1318 SFISAASFQETTRVLTEAAVAGKRDELRGLKENVIVGRLIPAGTGYAYHQDR 1369