254780143

254780143

DNA-directed RNA polymerase subunit beta

GeneID in NCBI database:8209118Locus tag:CLIBASIA_00110
Protein GI in NCBI database:254780143Protein Accession:YP_003064556.1
Gene range:-(24186, 28346)Protein Length:1386aa
Gene description:DNA-directed RNA polymerase subunit beta
COG prediction:[K] DNA-directed RNA polymerase, beta subunit/140 kD subunit
KEGG prediction:rpoB; DNA-directed RNA polymerase subunit beta (EC:2.7.7.6); K03043 DNA-directed RNA polymerase subunit beta [EC:2.7.7.6]
SEED prediction:DNA-directed RNA polymerase beta subunit (EC 2.7.7.6)
Pathway involved in KEGG:Purine metabolism [PATH:las00230]
Pyrimidine metabolism [PATH:las00240]
RNA polymerase [PATH:las03020]
Subsystem involved in SEED:RNA polymerase bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------
MAKGVVFNGLGRVRKFFGKNPEIIDIPDLIEVQKASYDHFLMMNIAPDERPNEGLQAAFKSVFPITAFSGAAMLEFVSYEFDPPKFDVDDCLWRDLTYAVPLKITLRLIVFDVDEFTGAKSIKDIKEQSIYMGDLPLMTKDGTFVIKGIQRIVVSQLHRSPGIHFDHDKGRASLSGKLLYACRIIPDQGLWMDIEFDSKDIIHVRIDRRRKVPVTSFLMALGMDSEEILSTFYPKIVYSQRGDFWCFPLSAADLMVGAKVSSSLVDIDTGEQVIESGKKLTSGLLKSLKEKGVKFLGITSDCLCGLYVAEDIVNGETGEIYIEAGDVIDEKSLEEIFHSEIRDIPILYVDSVNNNAYIRNTLVTDKNKDRKDALLDIYRVMRPGDVSTFSVAESMFNFLFFDSDKYDLSTVGRVKMNMRLNLDTPDDVRHIRKEDIIAIIKILVDLRNGKGTIDDIDNLGNRRVRSVGEMLKNQYRLGLLRMERSIKERISSVDIDSVMPQDLINAKPVVSAVCEFFCSSQLSQLEEHVNSLSRITHTRRLSALGQGGVARARAGVEMRDVHPTHYGRICPAETSEGHNIGLVSSLTSFARVNAYGFIETPYRKVCDGKVTNDVVYLSAMEEENRYIAQANSSLDEDGSFTEELVFCRCAGEEILVPREKIDFIDASPKQVVSIAASLIPFLENDDSNRVLMGCNMQRQAVPLLKAEAPFVGTGMESVVAKSSGAAIVAKRAGIVEQVDAIRIVIRSVEGDLDPSTSGVDIYRLMKFQRSNQNTCVNQRPLVKVGDEVRRNDIIADGPSTDLGDLALGRNMLVAFMPWHGYNFEDSMLISERMVSEDVFTSIHIEEFEVMARDTKLGPEEITRDIPNVSEEGLKNIDECGIICVGAEVNPGDILVGKITPKGESPMTPEEKLLRAIFGEKAVDVRDTSLRVPSGVSGTVVDVRIFNRHGIDKNERSISVEREQIELLARDKDDEQVILDRNIYSRLMEILCGQNAVSGPKGFKKSTVLSSDLISEYPRSQWWQFAVQDEKVQRNVESLKVQYETSKSILEDRFKNKIEKIQWGDDMPPGVLRVVKVFVAMKRPIQSGDKMAGRHGNKGIVSRILPCEDMPFLKDGTPVDIVLNPLGVPSRMNVGQIFETHLGWACVGLGKKIKSLINDYKANGDISPLRSFLEKVIGTGSHTEKISDYDDDSVLRVAEQWKSGVPVSTPVFDGADEEAINSMLRMADLDESGQSILYDGLTGEPFDRPVTVGYIYMLKLNHMVSDKVYARSTGSYSLVTQQPLGGKSNRGGQRLGEMEVWCIQAYGAAYVLQEMLTIKSDDVVGRTRVYESIVAGNDTFETGTPESFNVLVKEMQALGLSIDLENSRTKNSAKMEEIPDFNKCELK
cccccccccccEEEccHHHccHHHccccHHHHHHHHHHHHHHccccccccccccHHHHHHHccccccccccEEEEEEEEEEccccccHHHHHHccccEEEEEEEEEEEEEEccccccccccEEEEEEEEEEEcccEEEcccccEEEccHHHHHHHHHHHcccccccccccccccccccEEEEEEEEccccEEEEEEccccEEEEEEcccccccEEEEEEHHcccHHHHHHHHcccccEEEEccccccccccHHHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHcccccccccHHHHcccHHHHccccccccEEEEEccccccHHHHHHHHHccccEEEEEEEcccccccEEEcHHHccccccHHHHHHHHHHHccccccccHHHHHHHHHHHcccccccccccccEEEEEHHcccccccccccccHHHHHHHHHHHHHHHcccccccccccHHccEEccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHcccEEEEEccccEEEHHHHHHHHHHcccccccccccccccEEEccccccEEEcccccccccHHHHHHHccccEEcccccccccHHHHHccEEcccEEEEEEcccccEEEEEccccccccccEEHHHHHHHcccccEEEcccccEEEEccHHHHHHHHHHcccccccccccHHHHHccccccccccccccccccccccHHHHHccccHHEEcccccEEEEEEccEEEEEEccccccccccccEEEEEEEccccccccccccccEEccccEEEcccEEcccccccccccccccccEEEEEccccccHHHHHHHHHHHHHccccEEEEEEEEEEHHHHccccHHHHHcccccccHHHHHHHHHccccccccccccccEEEEEEccccccccccHHHHHHHHcccccccccccEEEEcccccEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHccccHHHHHHHHHccHHHHHHHHHccccccccccccHHHHHEEEEEcccccccccccEEEEEEEEEEccccccccccccccccccEEEEEEcccccccccccccEEEEEccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHcccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHccccccccEEEEcccccccccccEEEEHHHHHHHHHHHccccEEEEccccEEEEEcccccccccccEEccHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEcccccccccccHHHHHHHHHHHHccccEEEEEccccccccHHccccccHHccc
ccccccccHHHHHHHHcccccHHcccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHccccccccccccHHHHHHHccccccccccHHccccccccccccEEEEEEEEEccccccccccHHcHcccccccccccccccccEEEEcccEEEEEEccccccccEEccccccccccccHHEEcEEcccccccccccccccccEEEEccccccccHHHHHHHccccHHHHHHHHHHccEEEEccccEEEEcccHHHccccEcccHHHcHccccEEEccccEEcHHHHHHHHHccccEccccHHHHHHHHHHHHcccccccEEEEEccccccHHHHHHHHHccccccEEEEcccccccccHHcHccccccccHHHHHHHHHHHccccccccHHHHHHHHHHcccccccccHHHcccEEccHHcccccccccccccHHHHHHHHHHHHHHHcccccEcccHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHcccHHHHHHHHHHHcccHHHHHHccccccccccccEEEEccccccccHHHcccEEEcccccccccEccccccccccHHHHHHHHHHHHHHccccEccccEEEEcccccHHHHHHHHHHHccEEEEEEccccccccccHHHHEEEcccccEEEccHHHccEEEccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccccccccccccccEEEccccHEEEEEcccEEEEEcccEEEEEEcHccccccccccEEEEEEEEEccccccccccccEEcccccEccccEEEccccccHHHHHccccEEEEEcccccccccccEEEEEEEEEcccEEEEEEEEEEEEEccccccHHHHHHcccccHHHHHHHcccccEEEEEEEEccccEEEEEEcccccccccHHHHHHHHHHcccccccccccccccccccEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEcHHHHHcccccHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHEEEEEEEEHccccccccccccccccEEEEEEccccccccccccccEEEEccccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHccccccccEEEEccccccccccccEHHHHHHHHHHHccccccccccccccEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHccccccccccccHHHHHHHHHHHHcccEEEccccccccccHHHHcccccccEcc
makgvvfnglgrvrkffgknpeiidipdliEVQKASYDHFLmmniapderpneglQAAFKSVFPITAFSGAAMLEFVsyefdppkfdvddclwrdltyavplKITLRLIVFdvdeftgaksikdikeqsiymgdlplmtkdgtFVIKGIQRIVVSQlhrspgihfdhdkgraslsGKLLYACriipdqglwmdiefdskdiihvridrrrkvpVTSFLMALGMDSEEILSTfypkivysqrgdfwcfplsaADLMVGAKVssslvdidtgEQVIESGKKLTSGLLKSLKEKGVKFLGITSDCLCGLYvaedivngetgEIYIeagdvidekSLEEIFhseirdipilyvdsvnnnaYIRNTlvtdknkdrkDALLDIYrvmrpgdvstFSVAESMFNflffdsdkydlstvgRVKMnmrlnldtpddvrHIRKEDIIAIIKILVDlrngkgtiddidnlgnRRVRSVGEMLKNQYRLGLLRMERSIKERissvdidsvmpqdlinakpvVSAVCEFFCSSQLSQLEEHVNSLSRITHTRRLSALGQggvararagvemrdvhpthygricpaetseghniglVSSLTSFARvnaygfietpyrkvcdgkvtNDVVYLSAMEEENRYIAQAnssldedgsftEELVFCRCageeilvprekidfidaspKQVVSIAASLipflenddsnrvlmgcnmqrqavpllkaeapfvgtgMESVVAKSSGAAIVAKRAGIVEQVDAIRIVIRSvegdldpstsgvdiYRLMKFqrsnqntcvnqrplvkvgdevrrndiiadgpstdlgdlaLGRNMLVAfmpwhgynfedsmlisermvsedvftSIHIEEFEVMardtklgpeeitrdipnvseeglknidecgiicvgaevnpgdilvgkitpkgespmtpeEKLLRAIFgekavdvrdtslrvpsgvsgtVVDVRIfnrhgidknersiSVEREQIELLArdkddeqviLDRNIYSRLMEILcgqnavsgpkgfkkstVLSSDliseyprsqwwqfAVQDEKVQRNVESLKVQYETSKSILEDRFKNKIEkiqwgddmppgvLRVVKVFVAMkrpiqsgdkmagrhgnkgivsrilpcedmpflkdgtpvdivlnplgvpsrmnvgQIFETHLGWACVGLGKKIKSLINDykangdispLRSFLEKVIgtgshtekisdydddsVLRVAEQWksgvpvstpvfdgadEEAINSMLRMadldesgqsilydgltgepfdrpvtVGYIYMLKLNHmvsdkvyarstgsyslvtqqplggksnrggqrlgEMEVWCIQAYGAAYVLQEMLTiksddvvgrTRVYESIVagndtfetgtpeSFNVLVKEMQALGLsidlensrtknsakmeeipdfnkcelk
makgvvfnglgrvrkffgknpeiidipdLIEVQKASYDHFLMMNIAPDERPNEGLQAAFKSVFPITAFSGAAMLEFVSYEFDPPKFDVDDCLWRDLTYAVPLKITLRLIVFDvdeftgaksikdikeqsiymgdlplmTKDGTFVIKGIQRIVVSQLHRSPGIHFDHDKGRASLSGKLLYACRIIPDQGLWMDIEFDSKDiihvridrrrkvpVTSFLMALGMDSEEILSTFYPKIVYSQRGDFWCFPLSAADLMVGAKVSSSLVDIDTGEQVIESGKKLTSGLLKSLKEKGVKFLGITSDCLCGLYVAEDIVNGETGEIYIEAGDVIDEKSLEEIFHSEIRDIPILYVDSVNNNAYIrntlvtdknkdrkDALLDIYRVMRPGDVSTFSVAESMFNFLFFDSDKYDLSTVGRVkmnmrlnldtpddvrhiRKEDIIAIIKIlvdlrngkgtiddidnlgnrrvRSVGEMLKNQYRLGLLRMERSIKERissvdidsvmpQDLINAKPVVSAVCEFFCSSQLSQLEEHVNSLSRITHTRRLSALGQGGVARARAGVEMRDVHPTHYGRICPAETSEGHNIGLVSSLTSFARVNAYGFietpyrkvcdgkVTNDVVYLSAMEEENRYIAQANSSLDEDGSFTEELVFCRCAGEEILVPREKIDFIDASPKQVVSIAASLIPFLENDDSNRVLMGCNMQRQAVPLLKAEAPFVGTGMESVVAKSSGAAIVAkragiveqvDAIRIVIrsvegdldpstsgVDIYRLMKFqrsnqntcvnqrplvkvgdevrrndiiadgpstdlgdlALGRNMLVAFMPWHGYNFEDSMLISERMVSEDVFTSIHIEEFevmardtklgpeeitrdipnvseeglkNIDECGIICVGAEVNPGDILVGkitpkgespmtpEEKLLRAIFGekavdvrdtslrvpsgvsgtvvdvrifnrhgidknersisvEREQIellardkddeqviLDRNIYSRLMEILCGqnavsgpkgfKKSTVLSSDLISEYPRSQWWQFAVQDEKVQRNVESLKvqyetsksiledrfKNKIekiqwgddmppgVLRVVKVFVAMKRpiqsgdkmagrhgnKGIVSRILPCEDMPFLKDGTPVDIVLNPLGVPSRMNVGQIFETHLGWACVGLGKKIKSLINDYKANGDISPLRSFLEKVIGTgshtekisdyddDSVLRVAEQwksgvpvstpvfdGADEEAINSMLRMADLDESGQSILYDGLTGEPFDRPVTVGYIYMLKLNHMVSDKVYARSTGSyslvtqqplggksnrggqRLGEMEVWCIQAYGAAYVLQEMLTIKSDDVVGRTRVYESivagndtfetgtpESFNVLVKEMQALGLSIdlensrtknsakmeeipdfnkcelk
MAKGVVFNGLGRVRKFFGKNPEIIDIPDLIEVQKASYDHFLMMNIAPDERPNEGLQAAFKSVFPITAFSGAAMLEFVSYEFDPPKFDVDDCLWRDLTYAVPLKITLRLIVFDVDEFTGAKSIKDIKEQSIYMGDLPLMTKDGTFVIKGIQRIVVSQLHRSPGIHFDHDKGRASLSGKLLYACRIIPDQGLWMDIEFDSKDIIHVRIDRRRKVPVTSFLMALGMDSEEILSTFYPKIVYSQRGDFWCFPLSAADLMVGAKVSSSLVDIDTGEQVIEsgkkltsgllkslkekgvkFLGITSDCLCGLYVAEDIVNGETGEIYIEAGDVIDEKSLEEIFHSEIRDIPILYVDSVNNNAYIRNTLVTDKNKDRKDALLDIYRVMRPGDVSTFSVAESMFNFLFFDSDKYDLSTVGRVKMNMRLNLDTPDDVRHirkediiaiikilvdlrNGKGTIDDIDNLGNRRVRSVGEMLKNQYRLGLLRMERSIKERISSVDIDSVMPQDLINAKPVVSAVCEFFCSSQLSQLEEHVNSLSRITHTRRLSALGQggvararagvEMRDVHPTHYGRICPAETSEGHNIGLVSSLTSFARVNAYGFIETPYRKVCDGKVTNDVVYLSAMEEENRYIAQANSSLDEDGSFTEELVFCRCAGEEILVPREKIDFIDASPKQVVSIAASLIPFLENDDSNRVLMGCNMQRQAVPLLKAEAPFVGTGMESVVAKSSGAAIVAKRAGIVEQVDAIRIVIRSVEGDLDPSTSGVDIYRLMKFQRSNQNTCVNQRPLVKVGDEVRRNDIIADGPSTDLGDLALGRNMLVAFMPWHGYNFEDSMLISERMVSEDVFTSIHIEEFEVMARDTKLGPEEITRDIPNVSEEGLKNIDECGIICVGAEVNPGDILVGKITPKGESPMTPEEKLLRAIFGEKAVDVRDTSLRVPSGVSGTVVDVRIFNRHGIDKNERSISVEREQIELLARDKDDEQVILDRNIYSRLMEILCGQNAVSGPKGFKKSTVLSSDLISEYPRSQWWQFAVQDEKVQRNVESLKVQYETSKSILEDRFKNKIEKIQWGDDMPPGVLRVVKVFVAMKRPIQSGDKMAGRHGNKGIVSRILPCEDMPFLKDGTPVDIVLNPLGVPSRMNVGQIFETHLGWACVGLGKKIKSLINDYKANGDISPLRSFLEKVIGTGSHTEKISDYDDDSVLRVAEQWKSGVPVSTPVFDGADEEAINSMLRMADLDESGQSILYDGLTGEPFDRPVTVGYIYMLKLNHMVSDKVYARSTGSYSLVTQQPLGGKSNRGGQRLGEMEVWCIQAYGAAYVLQEMLTIKSDDVVGRTRVYESIVAGNDTFETGTPESFNVLVKEMQALGLSIDLENSRTKNSAKMEEIPDFNKCELK
***GVVFNGLGRVRKFFGKNPEIIDIPDLIEVQKASYDHFLM**************AAFKSVFPITAFSGAAMLEFVSYEFDPPKFDVDDCLWRDLTYAVPLKITLRLIVFDVDEF*******DIKEQSIYMGDLPLMTKDGTFVIKGIQRIVVSQLHRSPGIHFDHDKGRASLSGKLLYACRIIPDQGLWMDIEFDSKDIIHVRIDRRRKVPVTSFLMALGMDSEEILSTFYPKIVYSQRGDFWCFPLSAADLMVGAKVSSSLVDIDTGEQVIESGKKLTSGLLKSLKEKGVKFLGITSDCLCGLYVAEDIVNGETGEIYIEAGDVIDEKSLEEIFHSEIRDIPILYVDSVNNNAYIRNTLVTDKNKDRKDALLDIYRVMRPGDVSTFSVAESMFNFLFFDSDKYDLSTVGRVKMNMRLNLDTPDDVRHIRKEDIIAIIKILVDLRNGKGTIDDIDNLGNRRVRSVGEMLKNQYRLGLLRMERSIKERISSVDIDSVMPQDLINAKPVVSAVCEFFCSSQLSQLEEHVNSLSRITHTRRLSALGQGGVARARAGVEMRDVHPTHYGRICPAETSEGHNIGLVSSLTSFARVNAYGFIETPYRKVCDGKVTNDVVYLSAMEEENRYIAQANSSLDEDGSFTEELVFCRCAGEEILVPREKIDFIDASPKQVVSIAASLIPFLENDDSNRVLMGCNMQRQAVPLLKAEAPFVGTGMESVVAKSSGAAIVAKRAGIVEQVDAIRIVIRSVEGDLDPSTSGVDIYRLMKFQRSNQNTCVNQRPLVKVGDEVRRNDIIADGPSTDLGDLALGRNMLVAFMPWHGYNFEDSMLISERMVSEDVFTSIHIEEFEVMARDTKLGPEEITRDIPNVSEEGLKNIDECGIICVGAEVNPGDILVGKITPKGESPMTPEEKLLRAIFGEKAVDVRDTSLRVPSGVSGTVVDVRIFNRHGIDKNERSISVEREQIELLARDKDDEQVILDRNIYSRLMEILCGQNA**********TVLSSDLISEYPRSQWWQFAVQDEKVQRNVESLKVQYETSKSILEDRFKNKIEKIQWGDDMPPGVLRVVKVFVAMKRPIQSGDKMAGRHGNKGIVSRILPCEDMPFLKDGTPVDIVLNPLGVPSRMNVGQIFETHLGWACVGLGKKIKSLINDYKANGDISPLRSFLEKVIGTGSHTEKISDYDDDSVLRVAEQWKSGVPVSTPVFDGADEEAINSMLRMADLDESGQSILYDGLTGEPFDRPVTVGYIYMLKLNHMVSDKVYARSTGSYSLVTQQPLGGKSNRGGQRLGEMEVWCIQAYGAAYVLQEMLTIKSDDVVGRTRVYESIVAGNDTFETGTPESFNVLVKEMQALGLSID************************
MAKGVVFNGLGRVRKFFGKNPEIIDIPDLIEVQKASYDHFLMMNIAPDERPNEGLQAAFKSVFPITAFSGAAMLEFVSYEFDPPKFDVDDCLWRDLTYAVPLKITLRLIVFDVDEFTGAKSIKDIKEQSIYMGDLPLMTKDGTFVIKGIQRIVVSQLHRSPGIHFDHDKGRASLSGKLLYACRIIPDQGLWMDIEFDSKDIIHVRIDRRRKVPVTSFLMALGMDSEEILSTFYPKIVYSQRGDFWCFPLSAADLMVGAKVSSSLVDIDTGEQVIESGKKLTSGLLKSLKEKGVKFLGITSDCLCGLYVAEDIVNGETGEIYIEAGDVIDEKSLEEIFHSEIRDIPILYVDSVNNNAYIRNTLVTDKNKDRKDALLDIYRVMRPGDVSTFSVAESMFNFLFFDSDKYDLSTVGRVKMNMRLNLDTPDDVRHIRKEDIIAIIKILVDLRNGKGTIDDIDNLGNRRVRSVGEMLKNQYRLGLLRMERSIKERISSVDIDSVMPQDLINAKPVVSAVCEFFCSSQLSQLEEHVNSLSRITHTRRLSALGQGGVARARAGVEMRDVHPTHYGRICPAETSEGHNIGLVSSLTSFARVNAYGFIETPYRKVCDGKVTNDVVYLSAMEEENRYIAQANSSLDEDGSFTEELVFCRCAGEEILVPREKIDFIDASPKQVVSIAASLIPFLENDDSNRVLMGCNMQRQAVPLLKAEAPFVGTGMESVVAKSSGAAIVAKRAGIVEQVDAIRIVIRSVEGDLDPSTSGVDIYRLMKFQRSNQNTCVNQRPLVKVGDEVRRNDIIADGPSTDLGDLALGRNMLVAFMPWHGYNFEDSMLISERMVSEDVFTSIHIEEFEVMARDTKLGPEEITRDIPNVSEEGLKNIDECGIICVGAEVNPGDILVGKITPKGESPMTPEEKLLRAIFGEKAVDVRDTSLRVPSGVSGTVVDVRIFNRHGIDKNERSISVEREQIELLARDKDDEQVILDRNIYSRLMEILCGQNAVSGPKGFKKSTVLSSDLISEYPRSQWWQFAVQDEKVQRNVESLKVQYETSKSILEDRFKNKIEKIQWGDDMPPGVLRVVKVFVAMKRPIQSGDKMAGRHGNKGIVSRILPCEDMPFLKDGTPVDIVLNPLGVPSRMNVGQIFETHLGWACVGLGKKIKSLINDYKANGDISPLRSFLEKVIGTGSHTEKISDYDDDSVLRVAEQWKSGVPVSTPVFDGADEEAINSMLRMADLDESGQSILYDGLTGEPFDRPVTVGYIYMLKLNHMVSDKVYARSTGSYSLVTQQPLGGKSNRGGQRLGEMEVWCIQAYGAAYVLQEMLTIKSDDVVGRTRVYESIVAGNDTFETGTPESFNVLVKEMQALGLSIDLENSRTKNSAKMEEIPDFNKCELK
****VVFNGLGRVRKFFGKNPEIIDIPDLIEVQKASYDHFLMMNIAPDERPNEGLQAAFKSVFPITAFSGAAMLEFVSYEFDPPKFDVDDCLWRDLTYAVPLKITLRLIVFDVDEFTGAKSIKDIKEQSIYMGDLPLMTKDGTFVIKGIQRIVVSQLHRSPGIHFDHDKGRASLSGKLLYACRIIPDQGLWMDIEFDSKDIIHVRIDRRRKVPVTSFLMALGMDSEEILSTFYPKIVYSQRGDFWCFPLSAADLMVGAKVSSSLVDIDTGEQVIESGKKLTSGLLKSLKEKGVKFLGITSDCLCGLYVAEDIVNGETGEIYIEAGDVIDEKSLEEIFHSEIRDIPILYVDSVNNNAYIRNTLVTDKNKDRKDALLDIYRVMRPGDVSTFSVAESMFNFLFFDSDKYDLSTVGRVKMNMRLNLDTPDDVRHIRKEDIIAIIKILVDLRNGKGTIDDIDNLGNRRVRSVGEMLKNQYRLGLLRMERSIKERISSVDIDSVMPQDLINAKPVVSAVCEFFCSSQLSQLEEHVNSLSRITHTRRLSALGQGGVARARAGVEMRDVHPTHYGRICPAETSEGHNIGLVSSLTSFARVNAYGFIETPYRKVCDGKVTNDVVYLSAMEEENRYIAQANSSLDEDGSFTEELVFCRCAGEEILVPREKIDFIDASPKQVVSIAASLIPFLENDDSNRVLMGCNMQRQAVPLLKAEAPFVGTGMESVVAKSSGAAIVAKRAGIVEQVDAIRIVIRSVEGDLDPSTSGVDIYRLMKFQRSNQNTCVNQRPLVKVGDEVRRNDIIADGPSTDLGDLALGRNMLVAFMPWHGYNFEDSMLISERMVSEDVFTSIHIEEFEVMARDTKLGPEEITRDIPNVSEEGLKNIDECGIICVGAEVNPGDILVGKITPKGESPMTPEEKLLRAIFGEKAVDVRDTSLRVPSGVSGTVVDVRIFNRHGIDKNERSISVEREQIELLARDKDDEQVILDRNIYSRLMEILCGQNAVSGPKGFKKSTVLSSDLISEYPRSQWWQFAVQDEKVQRNVESLKVQYETSKSILEDRFKNKIEKIQWGDDMPPGVLRVVKVFVAMKRPIQSGDKMAGRHGNKGIVSRILPCEDMPFLKDGTPVDIVLNPLGVPSRMNVGQIFETHLGWACVGLGKKIKSLINDYKANGDISPLRSFLEKVIGTGSHTEKISDYDDDSVLRVAEQWKSGVPVSTPVFDGADEEAINSMLRMADLDESGQSILYDGLTGEPFDRPVTVGYIYMLKLNHMVSDKVYARSTGSYSLVTQQPLGGKSNRGGQRLGEMEVWCIQAYGAAYVLQEMLTIKSDDVVGRTRVYESIVAGNDTFETGTPESFNVLVKEMQALGLSIDLEN***************NKC***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKGVVFNGLGRVRKFFGKNPEIIDIPDLIEVQKASYDHFLMMNIAPDERPNEGLQAAFKSVFPITAFSGAAMLEFVSYEFDPPKFDVDDCLWRDLTYAVPLKITLRLIVFDVDEFTGAKSIKDIKEQSIYMGDLPLMTKDGTFVIKGIQRIVVSQLHRSPGIHFDHDKGRASLSGKLLYACRIIPDQGLWMDIEFDSKDIIHVRIDRRRKVPVTSFLMALGMDSEEILSTFYPKIVYSQRGDFWCFPLSAADLMVGAKVSSSLVDIDTGEQVIESGKKLTSGLLKSLKEKGVKFLGITSDCLCGLYVAEDIVNGETGEIYIEAGDVIDEKSLEEIFHSEIRDIPILYVDSVNNNAYIRNTLVTDKNKDRKDALLDIYRVMRPGDVSTFSVAESMFNFLFFDSDKYDLSTVGRVKMNMRLNLDTPDDVRHIRKEDIIAIIKILVDLRNGKGTIDDIDNLGNRRVRSVGEMLKNQYRLGLLRMERSIKERISSVDIDSVMPQDLINAKPVVSAVCEFFCSSQLSQLEEHVNSLSRITHTRRLSALGQGGVARARAGVEMRDVHPTHYGRICPAETSEGHNIGLVSSLTSFARVNAYGFIETPYRKVCDGKVTNDVVYLSAMEEENRYIAQANSSLDEDGSFTEELVFCRCAGEEILVPREKIDFIDASPKQVVSIAASLIPFLENDDSNRVLMGCNMQRQAVPLLKAEAPFVGTGMESVVAKSSGAAIVAKRAGIVEQVDAIRIVIRSVEGDLDPSTSGVDIYRLMKFQRSNQNTCVNQRPLVKVGDEVRRNDIIADGPSTDLGDLALGRNMLVAFMPWHGYNFEDSMLISERMVSEDVFTSIHIEEFEVMARDTKLGPEEITRDIPNVSEEGLKNIDECGIICVGAEVNPGDILVGKITPKGESPMTPEEKLLRAIFGEKAVDVRDTSLRVPSGVSGTVVDVRIFNRHGIDKNERSISVEREQIELLARDKDDEQVILDRNIYSRLMEILCGQNAVSGPKGFKKSTVLSSDLISEYPRSQWWQFAVQDEKVQRNVESLKVQYETSKSILEDRFKNKIEKIQWGDDMPPGVLRVVKVFVAMKRPIQSGDKMAGRHGNKGIVSRILPCEDMPFLKDGTPVDIVLNPLGVPSRMNVGQIFETHLGWACVGLGKKIKSLINDYKANGDISPLRSFLEKVIGTGSHTEKISDYDDDSVLRVAEQWKSGVPVSTPVFDGADEEAINSMLRMADLDESGQSILYDGLTGEPFDRPVTVGYIYMLKLNHMVSDKVYARSTGSYSLVTQQPLGGKSNRGGQRLGEMEVWCIQAYGAAYVLQEMLTIKSDDVVGRTRVYESIVAGNDTFETGTPESFNVLVKEMQALGLSIDLENSRTKNSAKMEEIPDFNKCELK
MAKGVVFNGLGRVRKFFGKNPEIIDIPDLIEVQKASYDHFLMMNIAPDERPNEGLQAAFKSVFPITAFSGAAMLEFVSYEFDPPKFDVDDCLWRDLTYAVPLKITLRLIVFDVDEFTGAKSIKDIKEQSIYMGDLPLMTKDGTFVIKGIQRIVVSQLHRSPGIHFDHDKGRASLSGKLLYACRIIPDQGLWMDIEFDSKDIIHVRIDRRRKVPVTSFLMALGMDSEEILSTFYPKIVYSQRGDFWCFPLSAADLMVGAKVSSSLVDIDTGEQVIESGKKLTSGLLKSLKEKGVKFLGITSDCLCGLYVAEDIVNGETGEIYIEAGDVIDEKSLEEIFHSEIRDIPILYVDSVNNNAYIRNTLVTDKNKDRKDALLDIYRVMRPGDVSTFSVAESMFNFLFFDSDKYDLSTVGRVKMNMRLNLDTPDDVRHIRKEDIIAIIKILVDLRNGKGTIDDIDNLGNRRVRSVGEMLKNQYRLGLLRMERSIKERISSVDIDSVMPQDLINAKPVVSAVCEFFCSSQLSQLEEHVNSLSRITHTRRLSALGQGGVARARAGVEMRDVHPTHYGRICPAETSEGHNIGLVSSLTSFARVNAYGFIETPYRKVCDGKVTNDVVYLSAMEEENRYIAQANSSLDEDGSFTEELVFCRCAGEEILVPREKIDFIDASPKQVVSIAASLIPFLENDDSNRVLMGCNMQRQAVPLLKAEAPFVGTGMESVVAKSSGAAIVAKRAGIVEQVDAIRIVIRSVEGDLDPSTSGVDIYRLMKFQRSNQNTCVNQRPLVKVGDEVRRNDIIADGPSTDLGDLALGRNMLVAFMPWHGYNFEDSMLISERMVSEDVFTSIHIEEFEVMARDTKLGPEEITRDIPNVSEEGLKNIDECGIICVGAEVNPGDILVGKITPKGESPMTPEEKLLRAIFGEKAVDVRDTSLRVPSGVSGTVVDVRIFNRHGIDKNERSISVEREQIELLARDKDDEQVILDRNIYSRLMEILCGQNAVSGPKGFKKSTVLSSDLISEYPRSQWWQFAVQDEKVQRNVESLKVQYETSKSILEDRFKNKIEKIQWGDDMPPGVLRVVKVFVAMKRPIQSGDKMAGRHGNKGIVSRILPCEDMPFLKDGTPVDIVLNPLGVPSRMNVGQIFETHLGWACVGLGKKIKSLINDYKANGDISPLRSFLEKVIGTGSHTEKISDYDDDSVLRVAEQWKSGVPVSTPVFDGADEEAINSMLRMADLDESGQSILYDGLTGEPFDRPVTVGYIYMLKLNHMVSDKVYARSTGSYSLVTQQPLGGKSNRGGQRLGEMEVWCIQAYGAAYVLQEMLTIKSDDVVGRTRVYESIVAGNDTFETGTPESFNVLVKEMQALGLSIDLENSRTKNSAKMEEIPDFNKCELK
MAKGVVFNGLGRVRKFFGKNPEIIDIPDLIEVQKASYDHFLMMNIAPDERPNEGLQAAFKSVFPITAFSGAAMLEFVSYEFDPPKFDVDDCLWRDLTYAVPLKITLRLIVFDVDEFTGAKSIKDIKEQSIYMGDLPLMTKDGTFVIKGIQRIVVSQLHRSPGIHFDHDKGRASLSGKLLYACRIIPDQGLWMDIEFDSKDIIHVRIDRRRKVPVTSFLMALGMDSEEILSTFYPKIVYSQRGDFWCFPLSAADLMVGAKVSSSLVDIDTGEQVIESGKKLTSGLLKSLKEKGVKFLGITSDCLCGLYVAEDIVNGETGEIYIEAGDVIDEKSLEEIFHSEIRDIPILYVDSVNNNAYIRNTLVTDKNKDRKDALLDIYRVMRPGDVSTFSVAESMFNFLFFDSDKYDLSTVGRVKMNMRLNLDTPDDVRHIRKEDIIAIIKILVDLRNGKGTIDDIDNLGNRRVRSVGEMLKNQYRLGLLRMERSIKERISSVDIDSVMPQDLINAKPVVSAVCEFFCSSQLSQLEEHVNSLSRITHTRRLSALGQGGVARARAGVEMRDVHPTHYGRICPAETSEGHNIGLVSSLTSFARVNAYGFIETPYRKVCDGKVTNDVVYLSAMEEENRYIAQANSSLDEDGSFTEELVFCRCAGEEILVPREKIDFIDASPKQVVSIAASLIPFLENDDSNRVLMGCNMQRQAVPLLKAEAPFVGTGMESVVAKSSGAAIVAKRAGIVEQVDAIRIVIRSVEGDLDPSTSGVDIYRLMKFQRSNQNTCVNQRPLVKVGDEVRRNDIIADGPSTDLGDLALGRNMLVAFMPWHGYNFEDSMLISERMVSEDVFTSIHIEEFEVMARDTKLGPEEITRDIPNVSEEGLKNIDECGIICVGAEVNPGDILVGKITPKGESPMTPEEKLLRAIFGEKAVDVRDTSLRVPSGVSGTVVDVRIFNRHGIDKNERSISVEREQIELLARDKDDEQVILDRNIYSRLMEILCGQNAVSGPKGFKKSTVLSSDLISEYPRSQWWQFAVQDEKVQRNVESLKVQYETSKSILEDRFKNKIEKIQWGDDMPPGVLRVVKVFVAMKRPIQSGDKMAGRHGNKGIVSRILPCEDMPFLKDGTPVDIVLNPLGVPSRMNVGQIFETHLGWACVGLGKKIKSLINDYKANGDISPLRSFLEKVIGTGSHTEKISDYDDDSVLRVAEQWKSGVPVSTPVFDGADEEAINSMLRMADLDESGQSILYDGLTGEPFDRPVTVGYIYMLKLNHMVSDKVYARSTGSYSLVTQQPLGGKSNRGGQRLGEMEVWCIQAYGAAYVLQEMLTIKSDDVVGRTRVYESIVAGNDTFETGTPESFNVLVKEMQALGLSIDLENSRTKNSAKMEEIPDFNKCELK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target1386 DNA-directed RNA polymerase subunit beta [Candidatus Li
1707854341386 RNA polymerase B' subunit [Candidatus Liberibacter asia 1 0.0
3151227451382 DNA-directed RNA polymerase subunit beta [Candidatus Li 1 0.0
1400639731258 RNA polymerase B' subunit [Candidatus Liberibacter asia 1 0.0
2833622181243 partial DNA-directed RNA polymerase subunit beta [Candi 1 0.0
2833621881243 partial DNA-directed RNA polymerase subunit beta [Candi 1 0.0
2833621481243 partial DNA-directed RNA polymerase subunit beta [Candi 1 0.0
2833621781243 partial DNA-directed RNA polymerase subunit beta [Candi 1 0.0
2833621381159 DNA-directed RNA polymerase subunit beta [Candidatus Li 1 0.0
2559578781018 RNA polymerase beta subunit [Candidatus Liberibacter as 1 0.0
2559578881018 RNA polymerase beta subunit [Candidatus Liberibacter as 1 0.0
>gi|170785434|gb|ACB37713.1| RNA polymerase B' subunit [Candidatus Liberibacter asiaticus] Length = 1386 Back     alignment and organism information
 Score = 2837 bits (7355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1385/1386 (99%), Positives = 1385/1386 (99%)

Query: 1    MAKGVVFNGLGRVRKFFGKNPEIIDIPDLIEVQKASYDHFLMMNIAPDERPNEGLQAAFK 60
            MAKGVVFNGLGRVRKFFGKNPEIIDIPDLIEVQKASYDHFLMMNIAPDERPNEGLQAAFK
Sbjct: 1    MAKGVVFNGLGRVRKFFGKNPEIIDIPDLIEVQKASYDHFLMMNIAPDERPNEGLQAAFK 60

Query: 61   SVFPITAFSGAAMLEFVSYEFDPPKFDVDDCLWRDLTYAVPLKITLRLIVFDVDEFTGAK 120
            SVFPITAFSGAAMLEFVSYEFDPPKFDVDDCLWRDLTYAVPLKITLRLIVFDVDEFTGAK
Sbjct: 61   SVFPITAFSGAAMLEFVSYEFDPPKFDVDDCLWRDLTYAVPLKITLRLIVFDVDEFTGAK 120

Query: 121  SIKDIKEQSIYMGDLPLMTKDGTFVIKGIQRIVVSQLHRSPGIHFDHDKGRASLSGKLLY 180
            SIKDIKEQSIYMGDLPLMTKDGTFVIKGIQRIVVSQLHRSPGIHFDHDKGRASLSGKLLY
Sbjct: 121  SIKDIKEQSIYMGDLPLMTKDGTFVIKGIQRIVVSQLHRSPGIHFDHDKGRASLSGKLLY 180

Query: 181  ACRIIPDQGLWMDIEFDSKDIIHVRIDRRRKVPVTSFLMALGMDSEEILSTFYPKIVYSQ 240
            ACRIIPDQGLWMDIEFDSKDIIHVRIDRRRKVPVTSFLMALGMDSEEILSTFYPKIVYSQ
Sbjct: 181  ACRIIPDQGLWMDIEFDSKDIIHVRIDRRRKVPVTSFLMALGMDSEEILSTFYPKIVYSQ 240

Query: 241  RGDFWCFPLSAADLMVGAKVSSSLVDIDTGEQVIESGKKLTSGLLKSLKEKGVKFLGITS 300
            RGDFWCFPLSAADLMVGAKVSSSLVDIDTGEQVIESGKKLTSGLLKSLKEKGVKFLGITS
Sbjct: 241  RGDFWCFPLSAADLMVGAKVSSSLVDIDTGEQVIESGKKLTSGLLKSLKEKGVKFLGITS 300

Query: 301  DCLCGLYVAEDIVNGETGEIYIEAGDVIDEKSLEEIFHSEIRDIPILYVDSVNNNAYIRN 360
            DCLCGLYVAEDIVNGETGEIYIEAGDVIDEKSLEEIFHSEIRDIPILYVDSVNNNAYIRN
Sbjct: 301  DCLCGLYVAEDIVNGETGEIYIEAGDVIDEKSLEEIFHSEIRDIPILYVDSVNNNAYIRN 360

Query: 361  TLVTDKNKDRKDALLDIYRVMRPGDVSTFSVAESMFNFLFFDSDKYDLSTVGRVKMNMRL 420
            TLVTDKNKDRKDALLDIYRVMRPGDVSTFSVAESMFNFLFFDSDKYDLSTVGRVKMNMRL
Sbjct: 361  TLVTDKNKDRKDALLDIYRVMRPGDVSTFSVAESMFNFLFFDSDKYDLSTVGRVKMNMRL 420

Query: 421  NLDTPDDVRHIRKEDIIAIIKILVDLRNGKGTIDDIDNLGNRRVRSVGEMLKNQYRLGLL 480
            NLDTPDDVRHIRKEDIIAIIKILVDLRNGKGTIDDIDNLGNRRVRSVGEMLKNQYRLGLL
Sbjct: 421  NLDTPDDVRHIRKEDIIAIIKILVDLRNGKGTIDDIDNLGNRRVRSVGEMLKNQYRLGLL 480

Query: 481  RMERSIKERISSVDIDSVMPQDLINAKPVVSAVCEFFCSSQLSQLEEHVNSLSRITHTRR 540
            RMERSIKERISSVDIDSVMPQDLINAKPVVSAVCEFFCSSQLSQLEEHVNSLSRITHTRR
Sbjct: 481  RMERSIKERISSVDIDSVMPQDLINAKPVVSAVCEFFCSSQLSQLEEHVNSLSRITHTRR 540

Query: 541  LSALGQGGVARARAGVEMRDVHPTHYGRICPAETSEGHNIGLVSSLTSFARVNAYGFIET 600
            LSALGQGGVARARAGVEMRDVHPTHYGRICPAETSEGHNIGLVSSLTSFARVNAYGFIET
Sbjct: 541  LSALGQGGVARARAGVEMRDVHPTHYGRICPAETSEGHNIGLVSSLTSFARVNAYGFIET 600

Query: 601  PYRKVCDGKVTNDVVYLSAMEEENRYIAQANSSLDEDGSFTEELVFCRCAGEEILVPREK 660
            PYRKVCDGKVTNDVVYLSAMEEENRYIAQANSSLDEDGSFTEELVFCRCAGEEILVPREK
Sbjct: 601  PYRKVCDGKVTNDVVYLSAMEEENRYIAQANSSLDEDGSFTEELVFCRCAGEEILVPREK 660

Query: 661  IDFIDASPKQVVSIAASLIPFLENDDSNRVLMGCNMQRQAVPLLKAEAPFVGTGMESVVA 720
            IDFIDASPKQVVSIAASLIPFLENDDSNRVLMGCNMQRQAVPLLKAEAPFVGTGMESVVA
Sbjct: 661  IDFIDASPKQVVSIAASLIPFLENDDSNRVLMGCNMQRQAVPLLKAEAPFVGTGMESVVA 720

Query: 721  KSSGAAIVAKRAGIVEQVDAIRIVIRSVEGDLDPSTSGVDIYRLMKFQRSNQNTCVNQRP 780
            KSSGAAIVAKRAGIVEQVDAIRIVIRSVEGDLDPSTSGVDIYRLMKFQRSNQNTCVNQRP
Sbjct: 721  KSSGAAIVAKRAGIVEQVDAIRIVIRSVEGDLDPSTSGVDIYRLMKFQRSNQNTCVNQRP 780

Query: 781  LVKVGDEVRRNDIIADGPSTDLGDLALGRNMLVAFMPWHGYNFEDSMLISERMVSEDVFT 840
            LVKVGDEVRRNDIIADGPSTDLGDLALGRNMLVAFMPWHGYNFEDSMLISERMVSEDVFT
Sbjct: 781  LVKVGDEVRRNDIIADGPSTDLGDLALGRNMLVAFMPWHGYNFEDSMLISERMVSEDVFT 840

Query: 841  SIHIEEFEVMARDTKLGPEEITRDIPNVSEEGLKNIDECGIICVGAEVNPGDILVGKITP 900
            SIHIEEFEVMARDTKLGPEEITRDIPNVSEEGLKNIDECGIICVGAEVNPGDILVGKITP
Sbjct: 841  SIHIEEFEVMARDTKLGPEEITRDIPNVSEEGLKNIDECGIICVGAEVNPGDILVGKITP 900

Query: 901  KGESPMTPEEKLLRAIFGEKAVDVRDTSLRVPSGVSGTVVDVRIFNRHGIDKNERSISVE 960
            KGESPMTPEEKLLRAIFGEKAVDVRDTSLRVPSGVSGTVVDVRIFNRHGIDKNERSISVE
Sbjct: 901  KGESPMTPEEKLLRAIFGEKAVDVRDTSLRVPSGVSGTVVDVRIFNRHGIDKNERSISVE 960

Query: 961  REQIELLARDKDDEQVILDRNIYSRLMEILCGQNAVSGPKGFKKSTVLSSDLISEYPRSQ 1020
            REQIELLARDKDDEQVILDRNIYSRLMEILCGQNAVSGPKGFKKSTVLSSDLISEYPRSQ
Sbjct: 961  REQIELLARDKDDEQVILDRNIYSRLMEILCGQNAVSGPKGFKKSTVLSSDLISEYPRSQ 1020

Query: 1021 WWQFAVQDEKVQRNVESLKVQYETSKSILEDRFKNKIEKIQWGDDMPPGVLRVVKVFVAM 1080
            WWQFAVQDEKVQRNVESLKVQYETSKSILEDRFKNKIEKIQWGDDMPPGVLRVVKVFVAM
Sbjct: 1021 WWQFAVQDEKVQRNVESLKVQYETSKSILEDRFKNKIEKIQWGDDMPPGVLRVVKVFVAM 1080

Query: 1081 KRPIQSGDKMAGRHGNKGIVSRILPCEDMPFLKDGTPVDIVLNPLGVPSRMNVGQIFETH 1140
            KRPIQSGDKMAGRHGNKGIVSRILPCEDMPFLKDGTPVDIVLNPLGVPSRMNVGQIFETH
Sbjct: 1081 KRPIQSGDKMAGRHGNKGIVSRILPCEDMPFLKDGTPVDIVLNPLGVPSRMNVGQIFETH 1140

Query: 1141 LGWACVGLGKKIKSLINDYKANGDISPLRSFLEKVIGTGSHTEKISDYDDDSVLRVAEQW 1200
            LGWACVGLGKKIK LINDYKANGDISPLRSFLEKVIGTGSHTEKISDYDDDSVLRVAEQW
Sbjct: 1141 LGWACVGLGKKIKGLINDYKANGDISPLRSFLEKVIGTGSHTEKISDYDDDSVLRVAEQW 1200

Query: 1201 KSGVPVSTPVFDGADEEAINSMLRMADLDESGQSILYDGLTGEPFDRPVTVGYIYMLKLN 1260
            KSGVPVSTPVFDGADEEAINSMLRMADLDESGQSILYDGLTGEPFDRPVTVGYIYMLKLN
Sbjct: 1201 KSGVPVSTPVFDGADEEAINSMLRMADLDESGQSILYDGLTGEPFDRPVTVGYIYMLKLN 1260

Query: 1261 HMVSDKVYARSTGSYSLVTQQPLGGKSNRGGQRLGEMEVWCIQAYGAAYVLQEMLTIKSD 1320
            HMVSDKVYARSTGSYSLVTQQPLGGKSNRGGQRLGEMEVWCIQAYGAAYVLQEMLTIKSD
Sbjct: 1261 HMVSDKVYARSTGSYSLVTQQPLGGKSNRGGQRLGEMEVWCIQAYGAAYVLQEMLTIKSD 1320

Query: 1321 DVVGRTRVYESIVAGNDTFETGTPESFNVLVKEMQALGLSIDLENSRTKNSAKMEEIPDF 1380
            DVVGRTRVYESIVAGNDTFETGTPESFNVLVKEMQALGLSIDLENSRTKNSAKMEEIPDF
Sbjct: 1321 DVVGRTRVYESIVAGNDTFETGTPESFNVLVKEMQALGLSIDLENSRTKNSAKMEEIPDF 1380

Query: 1381 NKCELK 1386
            NKCELK
Sbjct: 1381 NKCELK 1386


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315122745|ref|YP_004063234.1| DNA-directed RNA polymerase subunit beta [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 1382 Back     alignment and organism information
>gi|140063973|gb|ABO82472.1| RNA polymerase B' subunit [Candidatus Liberibacter asiaticus] Length = 1258 Back     alignment and organism information
>gi|283362218|dbj|BAI65997.1| partial DNA-directed RNA polymerase subunit beta [Candidatus Liberibacter asiaticus] Length = 1243 Back     alignment and organism information
>gi|283362188|dbj|BAI65970.1| partial DNA-directed RNA polymerase subunit beta [Candidatus Liberibacter asiaticus] Length = 1243 Back     alignment and organism information
>gi|283362148|dbj|BAI65934.1| partial DNA-directed RNA polymerase subunit beta [Candidatus Liberibacter asiaticus] Length = 1243 Back     alignment and organism information
>gi|283362178|dbj|BAI65961.1| partial DNA-directed RNA polymerase subunit beta [Candidatus Liberibacter asiaticus] Length = 1243 Back     alignment and organism information
>gi|283362138|dbj|BAI65925.1| DNA-directed RNA polymerase subunit beta [Candidatus Liberibacter asiaticus] Length = 1159 Back     alignment and organism information
>gi|255957878|dbj|BAH96849.1| RNA polymerase beta subunit [Candidatus Liberibacter asiaticus] Length = 1018 Back     alignment and organism information
>gi|255957888|dbj|BAH96858.1| RNA polymerase beta subunit [Candidatus Liberibacter asiaticus] Length = 1018 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target1386 DNA-directed RNA polymerase subunit beta [Candidatus Li
CHL002071077 CHL00207, rpoB, RNA polymerase beta subunit; Provisiona 0.0
CHL000011070 CHL00001, rpoB, RNA polymerase beta subunit 0.0
TIGR020131065 TIGR02013, rpoB, DNA-directed RNA polymerase, beta subu 0.0
COG00851060 COG0085, RpoB, DNA-directed RNA polymerase, beta subuni 0.0
PRK09603 2890 PRK09603, PRK09603, bifunctional DNA-directed RNA polym 0.0
PRK004051112 PRK00405, rpoB, DNA-directed RNA polymerase subunit bet 0.0
PRK14844 2836 PRK14844, PRK14844, bifunctional DNA-directed RNA polym 0.0
PRK004051112 PRK00405, rpoB, DNA-directed RNA polymerase subunit bet 1e-147
TIGR020131065 TIGR02013, rpoB, DNA-directed RNA polymerase, beta subu 1e-124
COG00851060 COG0085, RpoB, DNA-directed RNA polymerase, beta subuni 4e-97
cd00653866 cd00653, RNA_pol_B_RPB2, RNA polymerase beta subunit 1e-89
CHL002071077 CHL00207, rpoB, RNA polymerase beta subunit; Provisiona 3e-87
KOG02141141 KOG0214, KOG0214, KOG0214, RNA polymerase II, second la 4e-48
TIGR03670599 TIGR03670, rpoB_arch, DNA-directed RNA polymerase subun 2e-45
PRK085651103 PRK08565, PRK08565, DNA-directed RNA polymerase subunit 1e-44
PRK07225605 PRK07225, PRK07225, DNA-directed RNA polymerase subunit 5e-42
PRK004051112 PRK00405, rpoB, DNA-directed RNA polymerase subunit bet 2e-99
TIGR020131065 TIGR02013, rpoB, DNA-directed RNA polymerase, beta subu 3e-76
CHL000011070 CHL00001, rpoB, RNA polymerase beta subunit 7e-33
CHL002071077 CHL00207, rpoB, RNA polymerase beta subunit; Provisiona 7e-29
cd00653866 cd00653, RNA_pol_B_RPB2, RNA polymerase beta subunit 1e-23
pfam04563394 pfam04563, RNA_pol_Rpb2_1, RNA polymerase beta subunit 4e-14
KOG02141141 KOG0214, KOG0214, KOG0214, RNA polymerase II, second la 3e-08
PRK085651103 PRK08565, PRK08565, DNA-directed RNA polymerase subunit 9e-07
pfam00562373 pfam00562, RNA_pol_Rpb2_6, RNA polymerase Rpb2, domain 1e-70
PRK14844 2836 PRK14844, PRK14844, bifunctional DNA-directed RNA polym 7e-67
pfam00562373 pfam00562, RNA_pol_Rpb2_6, RNA polymerase Rpb2, domain 7e-66
cd00653866 cd00653, RNA_pol_B_RPB2, RNA polymerase beta subunit 3e-65
COG00851060 COG0085, RpoB, DNA-directed RNA polymerase, beta subuni 1e-59
CHL000011070 CHL00001, rpoB, RNA polymerase beta subunit 3e-55
cd00653866 cd00653, RNA_pol_B_RPB2, RNA polymerase beta subunit 1e-45
TIGR03670599 TIGR03670, rpoB_arch, DNA-directed RNA polymerase subun 9e-14
PRK085651103 PRK08565, PRK08565, DNA-directed RNA polymerase subunit 1e-11
PRK07225605 PRK07225, PRK07225, DNA-directed RNA polymerase subunit 6e-10
KOG02141141 KOG0214, KOG0214, KOG0214, RNA polymerase II, second la 6e-45
CHL000011070 CHL00001, rpoB, RNA polymerase beta subunit 4e-36
KOG02151153 KOG0215, KOG0215, KOG0215, RNA polymerase III, second l 7e-12
KOG02161111 KOG0216, KOG0216, KOG0216, RNA polymerase I, second lar 1e-31
pfam0456078 pfam04560, RNA_pol_Rpb2_7, RNA polymerase Rpb2, domain 4e-30
pfam1038566 pfam10385, RNA_pol_Rpb2_45, RNA polymerase beta subunit 6e-24
pfam04563394 pfam04563, RNA_pol_Rpb2_1, RNA polymerase beta subunit 2e-22
KOG02151153 KOG0215, KOG0215, KOG0215, RNA polymerase III, second l 7e-20
pfam0456568 pfam04565, RNA_pol_Rpb2_3, RNA polymerase Rpb2, domain 1e-19
PRK085651103 PRK08565, PRK08565, DNA-directed RNA polymerase subunit 4e-16
PRK09606494 PRK09606, PRK09606, DNA-directed RNA polymerase subunit 2e-12
pfam04561180 pfam04561, RNA_pol_Rpb2_2, RNA polymerase Rpb2, domain 4e-08
pfam04561180 pfam04561, RNA_pol_Rpb2_2, RNA polymerase Rpb2, domain 1e-04
TIGR03670599 TIGR03670, rpoB_arch, DNA-directed RNA polymerase subun 1e-04
PRK07225605 PRK07225, PRK07225, DNA-directed RNA polymerase subunit 1e-04
KOG02151153 KOG0215, KOG0215, KOG0215, RNA polymerase III, second l 9e-04
PRK005661156 PRK00566, PRK00566, DNA-directed RNA polymerase subunit 0.002
>gnl|CDD|177098 CHL00207, rpoB, RNA polymerase beta subunit; Provisional Back     alignment and domain information
>gnl|CDD|176946 CHL00001, rpoB, RNA polymerase beta subunit Back     alignment and domain information
>gnl|CDD|162660 TIGR02013, rpoB, DNA-directed RNA polymerase, beta subunit Back     alignment and domain information
>gnl|CDD|30434 COG0085, RpoB, DNA-directed RNA polymerase, beta subunit/140 kD subunit [Transcription] Back     alignment and domain information
>gnl|CDD|181983 PRK09603, PRK09603, bifunctional DNA-directed RNA polymerase subunit beta/beta'; Reviewed Back     alignment and domain information
>gnl|CDD|179007 PRK00405, rpoB, DNA-directed RNA polymerase subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|173305 PRK14844, PRK14844, bifunctional DNA-directed RNA polymerase subunit beta/beta'; Provisional Back     alignment and domain information
>gnl|CDD|179007 PRK00405, rpoB, DNA-directed RNA polymerase subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|162660 TIGR02013, rpoB, DNA-directed RNA polymerase, beta subunit Back     alignment and domain information
>gnl|CDD|30434 COG0085, RpoB, DNA-directed RNA polymerase, beta subunit/140 kD subunit [Transcription] Back     alignment and domain information
>gnl|CDD|73223 cd00653, RNA_pol_B_RPB2, RNA polymerase beta subunit Back     alignment and domain information
>gnl|CDD|177098 CHL00207, rpoB, RNA polymerase beta subunit; Provisional Back     alignment and domain information
>gnl|CDD|35435 KOG0214, KOG0214, KOG0214, RNA polymerase II, second largest subunit [Transcription] Back     alignment and domain information
>gnl|CDD|132709 TIGR03670, rpoB_arch, DNA-directed RNA polymerase subunit B Back     alignment and domain information
>gnl|CDD|181473 PRK08565, PRK08565, DNA-directed RNA polymerase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|180893 PRK07225, PRK07225, DNA-directed RNA polymerase subunit B'; Validated Back     alignment and domain information
>gnl|CDD|179007 PRK00405, rpoB, DNA-directed RNA polymerase subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|162660 TIGR02013, rpoB, DNA-directed RNA polymerase, beta subunit Back     alignment and domain information
>gnl|CDD|176946 CHL00001, rpoB, RNA polymerase beta subunit Back     alignment and domain information
>gnl|CDD|177098 CHL00207, rpoB, RNA polymerase beta subunit; Provisional Back     alignment and domain information
>gnl|CDD|73223 cd00653, RNA_pol_B_RPB2, RNA polymerase beta subunit Back     alignment and domain information
>gnl|CDD|113338 pfam04563, RNA_pol_Rpb2_1, RNA polymerase beta subunit Back     alignment and domain information
>gnl|CDD|35435 KOG0214, KOG0214, KOG0214, RNA polymerase II, second largest subunit [Transcription] Back     alignment and domain information
>gnl|CDD|181473 PRK08565, PRK08565, DNA-directed RNA polymerase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|144229 pfam00562, RNA_pol_Rpb2_6, RNA polymerase Rpb2, domain 6 Back     alignment and domain information
>gnl|CDD|173305 PRK14844, PRK14844, bifunctional DNA-directed RNA polymerase subunit beta/beta'; Provisional Back     alignment and domain information
>gnl|CDD|144229 pfam00562, RNA_pol_Rpb2_6, RNA polymerase Rpb2, domain 6 Back     alignment and domain information
>gnl|CDD|73223 cd00653, RNA_pol_B_RPB2, RNA polymerase beta subunit Back     alignment and domain information
>gnl|CDD|30434 COG0085, RpoB, DNA-directed RNA polymerase, beta subunit/140 kD subunit [Transcription] Back     alignment and domain information
>gnl|CDD|176946 CHL00001, rpoB, RNA polymerase beta subunit Back     alignment and domain information
>gnl|CDD|73223 cd00653, RNA_pol_B_RPB2, RNA polymerase beta subunit Back     alignment and domain information
>gnl|CDD|132709 TIGR03670, rpoB_arch, DNA-directed RNA polymerase subunit B Back     alignment and domain information
>gnl|CDD|181473 PRK08565, PRK08565, DNA-directed RNA polymerase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|180893 PRK07225, PRK07225, DNA-directed RNA polymerase subunit B'; Validated Back     alignment and domain information
>gnl|CDD|35435 KOG0214, KOG0214, KOG0214, RNA polymerase II, second largest subunit [Transcription] Back     alignment and domain information
>gnl|CDD|176946 CHL00001, rpoB, RNA polymerase beta subunit Back     alignment and domain information
>gnl|CDD|35436 KOG0215, KOG0215, KOG0215, RNA polymerase III, second largest subunit [Transcription] Back     alignment and domain information
>gnl|CDD|35437 KOG0216, KOG0216, KOG0216, RNA polymerase I, second largest subunit [Transcription] Back     alignment and domain information
>gnl|CDD|146952 pfam04560, RNA_pol_Rpb2_7, RNA polymerase Rpb2, domain 7 Back     alignment and domain information
>gnl|CDD|150971 pfam10385, RNA_pol_Rpb2_45, RNA polymerase beta subunit external 1 domain Back     alignment and domain information
>gnl|CDD|113338 pfam04563, RNA_pol_Rpb2_1, RNA polymerase beta subunit Back     alignment and domain information
>gnl|CDD|35436 KOG0215, KOG0215, KOG0215, RNA polymerase III, second largest subunit [Transcription] Back     alignment and domain information
>gnl|CDD|146955 pfam04565, RNA_pol_Rpb2_3, RNA polymerase Rpb2, domain 3 Back     alignment and domain information
>gnl|CDD|181473 PRK08565, PRK08565, DNA-directed RNA polymerase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|181986 PRK09606, PRK09606, DNA-directed RNA polymerase subunit B''; Validated Back     alignment and domain information
>gnl|CDD|113336 pfam04561, RNA_pol_Rpb2_2, RNA polymerase Rpb2, domain 2 Back     alignment and domain information
>gnl|CDD|113336 pfam04561, RNA_pol_Rpb2_2, RNA polymerase Rpb2, domain 2 Back     alignment and domain information
>gnl|CDD|132709 TIGR03670, rpoB_arch, DNA-directed RNA polymerase subunit B Back     alignment and domain information
>gnl|CDD|180893 PRK07225, PRK07225, DNA-directed RNA polymerase subunit B'; Validated Back     alignment and domain information
>gnl|CDD|35436 KOG0215, KOG0215, KOG0215, RNA polymerase III, second largest subunit [Transcription] Back     alignment and domain information
>gnl|CDD|179068 PRK00566, PRK00566, DNA-directed RNA polymerase subunit beta'; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 1386 DNA-directed RNA polymerase subunit beta [Candidatus Li
100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. This entry describes orthologues of the beta subunit of bacterial RNA polymerase. The core enzyme consists of two alpha chains, one beta chain, and one beta' subunit.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006350 transcription." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02013">TIGR020131449 rpoB DNA-directed RNA polymerase, beta subunit; InterPr 100.0
PRK09603 2890 DNA-directed RNA polymerase subunit beta/beta'; Reviewe 100.0
PRK004051127 rpoB DNA-directed RNA polymerase subunit beta; Reviewed 100.0
CHL000011065 rpoB RNA polymerase beta subunit 100.0
COG00851060 RpoB DNA-directed RNA polymerase, beta subunit/140 kD s 100.0
PRK085651101 DNA-directed RNA polymerase subunit beta; Provisional 100.0
cd00653866 RNA_pol_B_RPB2 RNA polymerase beta subunit. RNA polymer 100.0
KOG02141141 consensus 100.0
KOG02151153 consensus 100.0
KOG02161111 consensus 100.0
TIGR03670599 rpoB_arch DNA-directed RNA polymerase subunit B. This m 100.0
PRK07225605 DNA-directed RNA polymerase subunit B'; Validated 100.0
pfam00562373 RNA_pol_Rpb2_6 RNA polymerase Rpb2, domain 6. RNA polym 100.0
PRK09606491 DNA-directed RNA polymerase subunit beta''; Validated 100.0
pfam04563394 RNA_pol_Rpb2_1 RNA polymerase beta subunit. RNA polymer 100.0
pfam04561180 RNA_pol_Rpb2_2 RNA polymerase Rpb2, domain 2. RNA polym 100.0
pfam0456078 RNA_pol_Rpb2_7 RNA polymerase Rpb2, domain 7. RNA polym 99.93
pfam0456568 RNA_pol_Rpb2_3 RNA polymerase Rpb2, domain 3. RNA polym 99.82
KOG02141141 consensus 99.36
pfam1038566 RNA_pol_Rpb2_45 RNA polymerase beta subunit external 1 98.87
COG00851060 RpoB DNA-directed RNA polymerase, beta subunit/140 kD s 98.53
PRK09603 2890 DNA-directed RNA polymerase subunit beta/beta'; Reviewe 97.77
PRK085651101 DNA-directed RNA polymerase subunit beta; Provisional 97.59
100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. This entry describes orthologues of the beta subunit of bacterial RNA polymerase. The core enzyme consists of two alpha chains, one beta chain, and one beta' subunit.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006350 transcription." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02013">TIGR020131449 rpoB DNA-directed RNA polymerase, beta subunit; InterPr 96.2
>TIGR02013 rpoB DNA-directed RNA polymerase, beta subunit; InterPro: IPR010243 DNA-directed RNA polymerases 2 Back     alignment and domain information
>PRK09603 DNA-directed RNA polymerase subunit beta/beta'; Reviewed Back     alignment and domain information
>PRK00405 rpoB DNA-directed RNA polymerase subunit beta; Reviewed Back     alignment and domain information
>CHL00001 rpoB RNA polymerase beta subunit Back     alignment and domain information
>COG0085 RpoB DNA-directed RNA polymerase, beta subunit/140 kD subunit [Transcription] Back     alignment and domain information
>PRK08565 DNA-directed RNA polymerase subunit beta; Provisional Back     alignment and domain information
>cd00653 RNA_pol_B_RPB2 RNA polymerase beta subunit Back     alignment and domain information
>KOG0214 consensus Back     alignment and domain information
>KOG0215 consensus Back     alignment and domain information
>KOG0216 consensus Back     alignment and domain information
>TIGR03670 rpoB_arch DNA-directed RNA polymerase subunit B Back     alignment and domain information
>PRK07225 DNA-directed RNA polymerase subunit B'; Validated Back     alignment and domain information
>pfam00562 RNA_pol_Rpb2_6 RNA polymerase Rpb2, domain 6 Back     alignment and domain information
>PRK09606 DNA-directed RNA polymerase subunit beta''; Validated Back     alignment and domain information
>pfam04563 RNA_pol_Rpb2_1 RNA polymerase beta subunit Back     alignment and domain information
>pfam04561 RNA_pol_Rpb2_2 RNA polymerase Rpb2, domain 2 Back     alignment and domain information
>pfam04560 RNA_pol_Rpb2_7 RNA polymerase Rpb2, domain 7 Back     alignment and domain information
>pfam04565 RNA_pol_Rpb2_3 RNA polymerase Rpb2, domain 3 Back     alignment and domain information
>KOG0214 consensus Back     alignment and domain information
>pfam10385 RNA_pol_Rpb2_45 RNA polymerase beta subunit external 1 domain Back     alignment and domain information
>COG0085 RpoB DNA-directed RNA polymerase, beta subunit/140 kD subunit [Transcription] Back     alignment and domain information
>PRK09603 DNA-directed RNA polymerase subunit beta/beta'; Reviewed Back     alignment and domain information
>PRK08565 DNA-directed RNA polymerase subunit beta; Provisional Back     alignment and domain information
>TIGR02013 rpoB DNA-directed RNA polymerase, beta subunit; InterPro: IPR010243 DNA-directed RNA polymerases 2 Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target1386 DNA-directed RNA polymerase subunit beta [Candidatus Li
3iyd_C1342 Three-Dimensional Em Structure Of An Intact Activat 0.0
3lu0_C1342 Molecular Model Of Escherichia Coli Core Rna Polyme 0.0
1l9u_C1118 Thermus Aquaticus Rna Polymerase Holoenzyme At 4 A 1e-138
1ynj_C1119 Taq Rna Polymerase-Sorangicin Complex Length = 1119 1e-138
1hqm_C1119 Crystal Structure Of Thermus Aquaticus Core Rna Pol 1e-138
1i6v_C1118 Thermus Aquaticus Core Rna Polymerase-Rifampicin Co 1e-138
1iw7_C1119 Crystal Structure Of The Rna Polymerase Holoenzyme 1e-136
1l9u_C1118 Thermus Aquaticus Rna Polymerase Holoenzyme At 4 A 1e-121
1ynj_C1119 Taq Rna Polymerase-Sorangicin Complex Length = 1119 1e-121
1hqm_C1119 Crystal Structure Of Thermus Aquaticus Core Rna Pol 1e-121
1i6v_C1118 Thermus Aquaticus Core Rna Polymerase-Rifampicin Co 1e-121
1iw7_C1119 Crystal Structure Of The Rna Polymerase Holoenzyme 1e-121
1l9u_C1118 Thermus Aquaticus Rna Polymerase Holoenzyme At 4 A 4e-65
1ynj_C1119 Taq Rna Polymerase-Sorangicin Complex Length = 1119 4e-65
1hqm_C1119 Crystal Structure Of Thermus Aquaticus Core Rna Pol 4e-65
1i6v_C1118 Thermus Aquaticus Core Rna Polymerase-Rifampicin Co 4e-65
1iw7_C1119 Crystal Structure Of The Rna Polymerase Holoenzyme 4e-67
1i3q_B1224 Rna Polymerase Ii Crystal Form I At 3.1 A Resolutio 1e-111
1i3q_B1224 Rna Polymerase Ii Crystal Form I At 3.1 A Resolutio 1e-61
3h0g_B1210 Rna Polymerase Ii From Schizosaccharomyces Pombe Le 3e-62
3h0g_B1210 Rna Polymerase Ii From Schizosaccharomyces Pombe Le 2e-97
2pmz_B1124 Archaeal Rna Polymerase From Sulfolobus Solfataricu 1e-86
2waq_B1131 The Complete Structure Of The Archaeal 13-Subunit D 9e-86
2pmz_B1124 Archaeal Rna Polymerase From Sulfolobus Solfataricu 4e-54
2waq_B1131 The Complete Structure Of The Archaeal 13-Subunit D 6e-52
3lti_A296 Crystal Structure Of The Escherichia Coli Rna Polym 3e-75
3mlq_A188 Crystal Structure Of The Thermus Thermophilus Trans 1e-40
gi|266618717|pdb|3IYD|C Chain C, Three-Dimensional Em Structure Of An Intact Activator- Dependent Transcription Initiation Complex Length = 1342 Back     alignment and structure
 Score = 1670 bits (4324), Expect = 0.0,   Method: Composition-based stats.
 Identities = 716/1364 (52%), Positives = 972/1364 (71%), Gaps = 22/1364 (1%)

Query: 3    KGVVFNGLGRVRKFFGKNPEIIDIPDLIEVQKASYDHFLMMNIAPDERPNEGLQAAFKSV 62
                +    R+RK FGK P+++D+P L+ +Q  S+  F+  +         GL+AAF+SV
Sbjct: 1    MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQD----PEGQYGLEAAFRSV 56

Query: 63   FPITAFSGAAMLEFVSYEFDPPKFDVDDCLWRDLTYAVPLKITLRLIVFDVDEFTGAKSI 122
            FPI ++SG + L++VSY    P FDV +C  R +TY+ PL++ LRL++++ +   G  ++
Sbjct: 57   FPIQSYSGNSELQYVSYRLGEPVFDVQECQIRGVTYSAPLRVKLRLVIYEREAPEG--TV 114

Query: 123  KDIKEQSIYMGDLPLMTKDGTFVIKGIQRIVVSQLHRSPGIHFDHDKGRASLSGKLLYAC 182
            KDIKEQ +YMG++PLMT +GTFVI G +R++VSQLHRSPG+ FD DKG+   SGK+LY  
Sbjct: 115  KDIKEQEVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGKTHSSGKVLYNA 174

Query: 183  RIIPDQGLWMDIEFDSKDIIHVRIDRRRKVPVTSFLMALGMDSEEILSTFYPKIVYSQRG 242
            RIIP +G W+D EFD KD + VRIDRRRK+P T  L AL   +E+IL  F+ K+++  R 
Sbjct: 175  RIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNYTTEQILDLFFEKVIFEIRD 234

Query: 243  DFWCFPLSAADLMVGAKVSSSLVDIDTGEQVIESGKKLTSGLLKSLKEKGVKFLGITSDC 302
            +     L    L  G   S  +     G+  +E G+++T+  ++ L++  VK + +  + 
Sbjct: 235  NKLQMELVPERL-RGETASFDIE--ANGKVYVEKGRRITARHIRQLEKDDVKLIEVPVEY 291

Query: 303  LCGLYVAEDIVNGETGEIYIEAGDVIDEKSLEEIFHSEIRDIPILYVDSVNNNAYIRNTL 362
            + G  VA+D ++  TGE+   A   +    L ++  S  + I  L+ + +++  YI  TL
Sbjct: 292  IAGKVVAKDYIDESTGELICAANMELSLDLLAKLSQSGHKRIETLFTNDLDHGPYISETL 351

Query: 363  VTDKNKDRKDALLDIYRVMRPGDVSTFSVAESMFNFLFFDSDKYDLSTVGRVKMNMRLNL 422
              D   DR  AL++IYR+MRPG+  T   AES+F  LFF  D+YDLS VGR+K N  L  
Sbjct: 352  RVDPTNDRLSALVEIYRMMRPGEPPTREAAESLFENLFFSEDRYDLSAVGRMKFNRSLLR 411

Query: 423  DTPDDVRHIRKEDIIAIIKILVDLRNGKGTIDDIDNLGNRRVRSVGEMLKNQYRLGLLRM 482
            +  +    + K+DII ++K L+D+RNGKG +DDID+LGNRR+RSVGEM +NQ+R+GL+R+
Sbjct: 412  EEIEGSGILSKDDIIDVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGEMAENQFRVGLVRV 471

Query: 483  ERSIKERISSVDIDSVMPQDLINAKPVVSAVCEFFCSSQLSQLEEHVNSLSRITHTRRLS 542
            ER++KER+S  D+D++MPQD+INAKP+ +AV EFF SSQLSQ  +  N LS ITH RR+S
Sbjct: 472  ERAVKERLSLGDLDTLMPQDMINAKPISAAVKEFFGSSQLSQFMDQNNPLSEITHKRRIS 531

Query: 543  ALGQGGVARARAGVEMRDVHPTHYGRICPAETSEGHNIGLVSSLTSFARVNAYGFIETPY 602
            ALG GG+ R RAG E+RDVHPTHYGR+CP ET EG NIGL++SL+ +A+ N YGF+ETPY
Sbjct: 532  ALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLSVYAQTNEYGFLETPY 591

Query: 603  RKVCDGKVTNDVVYLSAMEEENRYIAQANSSLDEDGSFTEELVFCRCAGEEILVPREKID 662
            RKV DG VT+++ YLSA+EE N  IAQANS+LDE+G F E+LV CR  GE  L  R+++D
Sbjct: 592  RKVTDGVVTDEIHYLSAIEEGNYVIAQANSNLDEEGHFVEDLVTCRSKGESSLFSRDQVD 651

Query: 663  FIDASPKQVVSIAASLIPFLENDDSNRVLMGCNMQRQAVPLLKAEAPFVGTGMESVVAKS 722
            ++D S +QVVS+ ASLIPFLE+DD+NR LMG NMQRQAVP L+A+ P VGTGME  VA  
Sbjct: 652  YMDVSTQQVVSVGASLIPFLEHDDANRALMGANMQRQAVPTLRADKPLVGTGMERAVAVD 711

Query: 723  SGAAIVAKRAGIVEQVDAIRIVIRSVEGDLDPSTSGVDIYRLMKFQRSNQNTCVNQRPLV 782
            SG   VAKR G+V+ VDA RIVI+  E ++ P  +G+DIY L K+ RSNQNTC+NQ P V
Sbjct: 712  SGVTAVAKRGGVVQYVDASRIVIKVNEDEMYPGEAGIDIYNLTKYTRSNQNTCINQMPCV 771

Query: 783  KVGDEVRRNDIIADGPSTDLGDLALGRNMLVAFMPWHGYNFEDSMLISERMVSEDVFTSI 842
             +G+ V R D++ADGPSTDLG+LALG+NM VAFMPW+GYNFEDS+L+SER+V ED FT+I
Sbjct: 772  SLGEPVERGDVLADGPSTDLGELALGQNMRVAFMPWNGYNFEDSILVSERVVQEDRFTTI 831

Query: 843  HIEEFEVMARDTKLGPEEITRDIPNVSEEGLKNIDECGIICVGAEVNPGDILVGKITPKG 902
            HI+E   ++RDTKLGPEEIT DIPNV E  L  +DE GI+ +GAEV  GDILVGK+TPKG
Sbjct: 832  HIQELACVSRDTKLGPEEITADIPNVGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKG 891

Query: 903  ESPMTPEEKLLRAIFGEKAVDVRDTSLRVPSGVSGTVVDVRIFNRHGIDKNERSISVERE 962
            E+ +TPEEKLLRAIFGEKA DV+D+SLRVP+GVSGTV+DV++F R G++K++R++ +E  
Sbjct: 892  ETQLTPEEKLLRAIFGEKASDVKDSSLRVPNGVSGTVIDVQVFTRDGVEKDKRALEIEEM 951

Query: 963  QIELLARDKDDEQVILDRNIYSRLMEILCGQNAVSGPKGFKKSTVLSSDLISEYPRSQWW 1022
            Q++   +D  +E  IL+  ++SR+  +L                   ++ + + PR +W 
Sbjct: 952  QLKQAKKDLSEELQILEAGLFSRIRAVLVAGGV-------------EAEKLDKLPRDRWL 998

Query: 1023 QFAVQDEKVQRNVESLKVQYETSKSILEDRFKNKIEKIQWGDDMPPGVLRVVKVFVAMKR 1082
            +  + DE+ Q  +E L  QY+  K   E + + K  KI  GDD+ PGVL++VKV++A+KR
Sbjct: 999  ELGLTDEEKQNQLEQLAEQYDELKHEFEKKLEAKRRKITQGDDLAPGVLKIVKVYLAVKR 1058

Query: 1083 PIQSGDKMAGRHGNKGIVSRILPCEDMPFLKDGTPVDIVLNPLGVPSRMNVGQIFETHLG 1142
             IQ GDKMAGRHGNKG++S+I P EDMP+ ++GTPVDIVLNPLGVPSRMN+GQI ETHLG
Sbjct: 1059 RIQPGDKMAGRHGNKGVISKINPIEDMPYDENGTPVDIVLNPLGVPSRMNIGQILETHLG 1118

Query: 1143 WACVGLGKKIKSLINDYKANGDISPLRSFLEKVIGTGSHTEKISDYDDDSVLRVAEQWKS 1202
             A  G+G KI +++   +    +         +         +S + D+ V+R+AE  + 
Sbjct: 1119 MAAKGIGDKINAMLKQQQEVAKLREFIQRAYDLGADVRQKVDLSTFSDEEVMRLAENLRK 1178

Query: 1203 GVPVSTPVFDGADEEAINSMLRMADLDESGQSILYDGLTGEPFDRPVTVGYIYMLKLNHM 1262
            G+P++TPVFDGA E  I  +L++ DL  SGQ  LYDG TGE F+RPVTVGY+YMLKLNH+
Sbjct: 1179 GMPIATPVFDGAKEAEIKELLKLGDLPTSGQIRLYDGRTGEQFERPVTVGYMYMLKLNHL 1238

Query: 1263 VSDKVYARSTGSYSLVTQQPLGGKSNRGGQRLGEMEVWCIQAYGAAYVLQEMLTIKSDDV 1322
            V DK++ARSTGSYSLVTQQPLGGK+  GGQR GEMEVW ++AYGAAY LQEMLT+KSDDV
Sbjct: 1239 VDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDV 1298

Query: 1323 VGRTRVYESIVAGNDTFETGTPESFNVLVKEMQALGLSIDLENS 1366
             GRT++Y++IV GN   E G PESFNVL+KE+++LG++I+LE+ 
Sbjct: 1299 NGRTKMYKNIVDGNHQMEPGMPESFNVLLKEIRSLGINIELEDE 1342


>gi|307776497|pdb|3LU0|C Chain C, Molecular Model Of Escherichia Coli Core Rna Polymerase Length = 1342 Back     alignment and structure
>gi|21466005|pdb|1L9U|C Chain C, Thermus Aquaticus Rna Polymerase Holoenzyme At 4 A Resolution Length = 1118 Back     alignment and structure
gi|62738682|pdb|1YNJ|C Chain C, Taq Rna Polymerase-Sorangicin Complex Length = 1119 Back     alignment and structure
>gi|13096178|pdb|1HQM|C Chain C, Crystal Structure Of Thermus Aquaticus Core Rna Polymerase- Includes Complete Structure With Side-Chains (Except For Disordered Regions)-Further Refined From Original Deposition-Contains Additional Sequence Information Length = 1119 Back     alignment and structure
>gi|14278483|pdb|1I6V|C Chain C, Thermus Aquaticus Core Rna Polymerase-Rifampicin Complex Length = 1118 Back     alignment and structure
gi|21730339|pdb|1IW7|C Chain C, Crystal Structure Of The Rna Polymerase Holoenzyme From Thermus Thermophilus At 2.6a Resolution Length = 1119 Back     alignment and structure
>gi|21466005|pdb|1L9U|C Chain C, Thermus Aquaticus Rna Polymerase Holoenzyme At 4 A Resolution Length = 1118 Back     alignment and structure
gi|62738682|pdb|1YNJ|C Chain C, Taq Rna Polymerase-Sorangicin Complex Length = 1119 Back     alignment and structure
>gi|13096178|pdb|1HQM|C Chain C, Crystal Structure Of Thermus Aquaticus Core Rna Polymerase- Includes Complete Structure With Side-Chains (Except For Disordered Regions)-Further Refined From Original Deposition-Contains Additional Sequence Information Length = 1119 Back     alignment and structure
>gi|14278483|pdb|1I6V|C Chain C, Thermus Aquaticus Core Rna Polymerase-Rifampicin Complex Length = 1118 Back     alignment and structure
gi|21730339|pdb|1IW7|C Chain C, Crystal Structure Of The Rna Polymerase Holoenzyme From Thermus Thermophilus At 2.6a Resolution Length = 1119 Back     alignment and structure
>gi|21466005|pdb|1L9U|C Chain C, Thermus Aquaticus Rna Polymerase Holoenzyme At 4 A Resolution Length = 1118 Back     alignment and structure
gi|62738682|pdb|1YNJ|C Chain C, Taq Rna Polymerase-Sorangicin Complex Length = 1119 Back     alignment and structure
>gi|13096178|pdb|1HQM|C Chain C, Crystal Structure Of Thermus Aquaticus Core Rna Polymerase- Includes Complete Structure With Side-Chains (Except For Disordered Regions)-Further Refined From Original Deposition-Contains Additional Sequence Information Length = 1119 Back     alignment and structure
>gi|14278483|pdb|1I6V|C Chain C, Thermus Aquaticus Core Rna Polymerase-Rifampicin Complex Length = 1118 Back     alignment and structure
gi|21730339|pdb|1IW7|C Chain C, Crystal Structure Of The Rna Polymerase Holoenzyme From Thermus Thermophilus At 2.6a Resolution Length = 1119 Back     alignment and structure
gi|14278325|pdb|1I3Q|B Chain B, Rna Polymerase Ii Crystal Form I At 3.1 A Resolution Length = 1224 Back     alignment and structure
gi|14278325|pdb|1I3Q|B Chain B, Rna Polymerase Ii Crystal Form I At 3.1 A Resolution Length = 1224 Back     alignment and structure
gi|256599716|pdb|3H0G|B Chain B, Rna Polymerase Ii From Schizosaccharomyces Pombe Length = 1210 Back     alignment and structure
gi|256599716|pdb|3H0G|B Chain B, Rna Polymerase Ii From Schizosaccharomyces Pombe Length = 1210 Back     alignment and structure
gi|167744883|pdb|2PMZ|B Chain B, Archaeal Rna Polymerase From Sulfolobus Solfataricus Length = 1124 Back     alignment and structure
>gi|237823479|pdb|2WAQ|B Chain B, The Complete Structure Of The Archaeal 13-Subunit Dna- Directed Rna Polymerase Length = 1131 Back     alignment and structure
gi|167744883|pdb|2PMZ|B Chain B, Archaeal Rna Polymerase From Sulfolobus Solfataricus Length = 1124 Back     alignment and structure
>gi|237823479|pdb|2WAQ|B Chain B, The Complete Structure Of The Archaeal 13-Subunit Dna- Directed Rna Polymerase Length = 1131 Back     alignment and structure