254780145

254780145

50S ribosomal protein L10

GeneID in NCBI database:8209120Locus tag:CLIBASIA_00120
Protein GI in NCBI database:254780145Protein Accession:YP_003064558.1
Gene range:-(28887, 29405)Protein Length:172aa
Gene description:50S ribosomal protein L10
COG prediction:[J] Ribosomal protein L10
KEGG prediction:rplJ; 50S ribosomal protein L10; K02864 large subunit ribosomal protein L10
SEED prediction:LSU ribosomal protein L10p (P0)
Pathway involved in KEGG:Ribosome [PATH:las03010]
Subsystem involved in SEED:Ribosome LSU bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--
MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG
ccHHHHHHHHHHHHHHHHHccEEEEEEEccccHHHHHHHHHHHHHcccEEEEEEHHHHHHHHccccccHHHHHccccEEEEEEccccHHHHHHHHHHHcccccEEEEEEEccEEccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccHHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHccccEEEEccHHHHHHHHccccHcHHHHccccEEEEEcccccHHHHHHHHHHHHcccEEEEEEEEcccEccHHHHHHHHccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREagggvkvaKNRLVKIAIrdtsirgisdlfvgqslivysdspviapkisvsfsndnnefRVLGGVVEKGVLNQDSIKQiaslpdleGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG
MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMReagggvkvaknrlvkiairdtsirgisdLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG
MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG
*****KSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK****
**********SELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG
MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG
MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG
MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target172 50S ribosomal protein L10 [Candidatus Liberibacter asia
739025172 ribosomal protein L10 Length = 172 1 1e-90
113473651171 ribosomal protein L10 [Candidatus Liberibacter asiaticu 1 3e-90
30351057166 ribosomal protein [Candidatus Liberibacter asiaticus] L 1 3e-87
73698037166 ribosomal protein [Candidatus Liberibacter asiaticus] L 1 1e-86
206601310166 ribosomal protein [Candidatus Liberibacter asiaticus] L 1 3e-86
262093732164 ribosomal protein L10 [Candidatus Liberibacter asiaticu 1 7e-86
162956935161 ribosomal protein L10 [Candidatus Liberibacter asiaticu 1 2e-84
308523800150 50S ribosomal subunit protein L10 [Candidatus Liberibac 1 1e-77
730520172 RecName: Full=50S ribosomal protein L10 Length = 172 1 2e-73
264668448165 50S ribosomal subunit protein L10 [Candidatus Liberibac 1 1e-69
>gi|739025|prf||2002224D ribosomal protein L10 Length = 172 Back     alignment and organism information
 Score =  335 bits (859), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 171/172 (99%), Positives = 172/172 (100%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60
           +NRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI
Sbjct: 1   LNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKI 60

Query: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120
           AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI
Sbjct: 61  AIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSFSNDNNEFRVLGGVVEKGVLNQDSI 120

Query: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172
           KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG
Sbjct: 121 KQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQG 172


Species: Citrus greening disease-associated bacterium
Genus: 
Family: 
Order: 
Class: Gammaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|113473651|gb|ABI35994.1| ribosomal protein L10 [Candidatus Liberibacter asiaticus] Length = 171 Back     alignment and organism information
>gi|30351057|gb|AAP22421.1| ribosomal protein [Candidatus Liberibacter asiaticus] Length = 166 Back     alignment and organism information
>gi|73698037|gb|AAZ81564.1| ribosomal protein [Candidatus Liberibacter asiaticus] Length = 166 Back     alignment and organism information
>gi|206601310|gb|ACI16379.1| ribosomal protein [Candidatus Liberibacter asiaticus] Length = 166 Back     alignment and organism information
>gi|262093732|gb|ACY26056.1| ribosomal protein L10 [Candidatus Liberibacter asiaticus] Length = 164 Back     alignment and organism information
>gi|162956935|gb|ABY25857.1| ribosomal protein L10 [Candidatus Liberibacter asiaticus] Length = 161 Back     alignment and organism information
>gi|308523800|gb|ADO33740.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter asiaticus] Length = 150 Back     alignment and organism information
>gi|730520|sp|P41191|RL10_LIBAF RecName: Full=50S ribosomal protein L10 Length = 172 Back     alignment and organism information
>gi|264668448|gb|ACY71597.1| 50S ribosomal subunit protein L10 [Candidatus Liberibacter africanus] Length = 165 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target172 50S ribosomal protein L10 [Candidatus Liberibacter asia
PRK00099172 PRK00099, rplJ, 50S ribosomal protein L10; Reviewed 2e-43
cd00379155 cd00379, Ribosomal_L10_P0, Ribosomal protein L10 family 1e-29
COG0244175 COG0244, RplJ, Ribosomal protein L10 [Translation, ribo 3e-29
cd05797157 cd05797, Ribosomal_L10, Ribosomal protein L10 family, L 3e-37
pfam00466100 pfam00466, Ribosomal_L10, Ribosomal protein L10 1e-21
PRK04019 330 PRK04019, rplP0, acidic ribosomal protein P0; Validated 8e-07
cd05795175 cd05795, Ribosomal_P0_L10e, Ribosomal protein L10 famil 3e-04
>gnl|CDD|178862 PRK00099, rplJ, 50S ribosomal protein L10; Reviewed Back     alignment and domain information
>gnl|CDD|88594 cd00379, Ribosomal_L10_P0, Ribosomal protein L10 family; composed of the large subunit ribosomal protein called L10 in bacteria, P0 in eukaryotes, and L10e in archaea, as well as uncharacterized P0-like eukaryotic proteins Back     alignment and domain information
>gnl|CDD|30593 COG0244, RplJ, Ribosomal protein L10 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|88597 cd05797, Ribosomal_L10, Ribosomal protein L10 family, L10 subfamily; composed of bacterial 50S ribosomal protein and eukaryotic mitochondrial 39S ribosomal protein, L10 Back     alignment and domain information
>gnl|CDD|144164 pfam00466, Ribosomal_L10, Ribosomal protein L10 Back     alignment and domain information
>gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated Back     alignment and domain information
>gnl|CDD|88595 cd05795, Ribosomal_P0_L10e, Ribosomal protein L10 family, P0 and L10e subfamily; composed of eukaryotic 60S ribosomal protein P0 and the archaeal P0 homolog, L10e Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 172 50S ribosomal protein L10 [Candidatus Liberibacter asia
PRK00099164 rplJ 50S ribosomal protein L10; Reviewed 100.0
cd05797157 Ribosomal_L10 Ribosomal protein L10 family, L10 subfami 100.0
COG0244175 RplJ Ribosomal protein L10 [Translation, ribosomal stru 100.0
cd00379155 Ribosomal_L10_P0 Ribosomal protein L10 family; composed 100.0
KOG4241245 consensus 99.8
pfam00466100 Ribosomal_L10 Ribosomal protein L10. 99.86
PRK04019 328 rplP0 acidic ribosomal protein P0; Validated 99.45
cd05795175 Ribosomal_P0_L10e Ribosomal protein L10 family, P0 and 99.37
PTZ00135 312 ribosomal phosphoprotein P0; Provisional 99.33
PTZ00240 323 60S ribosomal protein P0; Provisional 99.2
cd05796163 Ribosomal_P0_like Ribosomal protein L10 family, P0-like 99.19
KOG0816223 consensus 97.99
KOG0815245 consensus 97.93
>PRK00099 rplJ 50S ribosomal protein L10; Reviewed Back     alignment and domain information
>cd05797 Ribosomal_L10 Ribosomal protein L10 family, L10 subfamily; composed of bacterial 50S ribosomal protein and eukaryotic mitochondrial 39S ribosomal protein, L10 Back     alignment and domain information
>COG0244 RplJ Ribosomal protein L10 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00379 Ribosomal_L10_P0 Ribosomal protein L10 family; composed of the large subunit ribosomal protein called L10 in bacteria, P0 in eukaryotes, and L10e in archaea, as well as uncharacterized P0-like eukaryotic proteins Back     alignment and domain information
>KOG4241 consensus Back     alignment and domain information
>pfam00466 Ribosomal_L10 Ribosomal protein L10 Back     alignment and domain information
>PRK04019 rplP0 acidic ribosomal protein P0; Validated Back     alignment and domain information
>cd05795 Ribosomal_P0_L10e Ribosomal protein L10 family, P0 and L10e subfamily; composed of eukaryotic 60S ribosomal protein P0 and the archaeal P0 homolog, L10e Back     alignment and domain information
>PTZ00135 ribosomal phosphoprotein P0; Provisional Back     alignment and domain information
>PTZ00240 60S ribosomal protein P0; Provisional Back     alignment and domain information
>cd05796 Ribosomal_P0_like Ribosomal protein L10 family, P0-like protein subfamily; composed of uncharacterized eukaryotic proteins with similarity to the 60S ribosomal protein P0, including the Saccharomyces cerevisiae protein called mRNA turnover protein 4 (MRT4) Back     alignment and domain information
>KOG0816 consensus Back     alignment and domain information
>KOG0815 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target172 50S ribosomal protein L10 [Candidatus Liberibacter asia
1zav_A180 Ribosomal Protein L10-L12(Ntd) Complex, Space Group 1e-28
1zaw_A180 Ribosomal Protein L10-L12(Ntd) Complex, Space Group 3e-28
3d5b_J173 Structural Basis For Translation Termination On The 6e-23
3izs_s 312 Localization Of The Large Subunit Ribosomal Protein 0.002
3o5h_M 312 Yeast 80s Ribosome. This Entry Consists Of The 60s 0.003
>gi|73535857|pdb|1ZAV|A Chain A, Ribosomal Protein L10-L12(Ntd) Complex, Space Group P21 Length = 180 Back     alignment and structure
 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 43/178 (24%), Positives = 85/178 (47%), Gaps = 7/178 (3%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREA---GGGVKVAKNRL 57
           + RQ K + + E+S+IF  +  I+ A + G +VA + +LR ++RE    G   +V KN L
Sbjct: 3   LTRQQKELIVKEMSEIFKKTSLILFADFLGFTVADLTELRSRLREKYGDGARFRVVKNTL 62

Query: 58  VKIAIRDTSIRGISDLFVGQSLIVY---SDSPVIAPKISVSFSNDNNEFR-VLGGVVEKG 113
           + +A+++    G  +   G + ++Y    D       I   + +   +   + GG +E  
Sbjct: 63  LNLALKNAEYEGYEEFLKGPTAVLYVTEGDPVEAVKIIYNFYKDKKADLSRLKGGFLEGK 122

Query: 114 VLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQQ 171
               + ++ IA LP  E + A ++  +++  T LV  L      +V  ++A  +K  +
Sbjct: 123 KFTAEEVENIAKLPSKEELYAMLVGRVKAPITGLVFALSGILRNLVYVLNAIKEKKSE 180


>gi|73535864|pdb|1ZAW|A Chain A, Ribosomal Protein L10-L12(Ntd) Complex, Space Group P212121, Form A Length = 180 Back     alignment and structure
gi|209156526|pdb|3D5B|J Chain J, Structural Basis For Translation Termination On The 70s Ribosome. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes As Described In Remark 400. Length = 173 Back     alignment and structure
>gi|315113308|pdb|3IZS|SS Chain s, Localization Of The Large Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 312 Back     alignment and structure
>gi|315113583|pdb|3O5H|M Chain M, Yeast 80s Ribosome. This Entry Consists Of The 60s Subunit Of The Second 80s In The Asymmetric Unit. Length = 312 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target172 50S ribosomal protein L10 [Candidatus Liberibacter asia
2j01_J173 50S ribosomal protein L10; ribosome, tRNA, paromomycin, 3e-28
1zav_A180 50S ribosomal protein L10; ribosome structure and funct 4e-28
1vq8_G 348 Acidic ribosomal protein P0 homolog; ribosome 50S, prot 8e-15
3a1y_G 284 Acidic ribosomal protein P0; stalk, ribosomal protein,h 7e-14
3jsy_A213 Acidic ribosomal protein P0 homolog; ribonucleoprotein; 4e-11
3jyw_8118 60S ribosomal protein LP0; eukaryotic ribosome, RACK1 p 4e-11
2zkr_g 317 60S acidic ribosomal protein P0; protein-RNA complex, 6 2e-09
>1zav_A 50S ribosomal protein L10; ribosome structure and function, L10-L12 complex structure, L10E structure, L7/12 ribosomal stalk; 1.90A {Thermotoga maritima} SCOP: d.58.62.1 PDB: 1zaw_A 1zax_A Length = 180 Back     alignment and structure
>1vq8_G Acidic ribosomal protein P0 homolog; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: j.84.1.1 PDB: 1k73_I* 1k8a_I* 1k9m_I* 1kc8_I* 1kd1_I* 1kqs_G* 1m1k_I* 1m90_I* 1n8r_I* 1nji_I* 1q7y_I* 1q81_I* 1q82_I* 1q86_I* 1qvf_G 1qvg_G 1s72_G* 1vq4_G* 1vq5_G* 1vq6_G* ... Length = 348 Back     alignment and structure
>3a1y_G Acidic ribosomal protein P0; stalk, ribosomal protein,helix SPIN, ribonucleoprotein; 2.13A {Pyrococcus horikoshii} Length = 284 Back     alignment and structure
>3jsy_A Acidic ribosomal protein P0 homolog; ribonucleoprotein; 1.60A {Methanocaldococcus jannaschii} Length = 213 Back     alignment and structure
>3jyw_8 60S ribosomal protein LP0; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} Length = 118 Back     alignment and structure
>2zkr_g 60S acidic ribosomal protein P0; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 317 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target172 50S ribosomal protein L10 [Candidatus Liberibacter asia
2j01_J173 50S ribosomal protein L10; ribosome, tRNA, paromomycin, 100.0
1zav_A180 50S ribosomal protein L10; ribosome structure and funct 100.0
3jyw_8118 60S ribosomal protein LP0; eukaryotic ribosome, RACK1 p 99.74
3jsy_A213 Acidic ribosomal protein P0 homolog; ribonucleoprotein; 99.7
3a1y_G 284 Acidic ribosomal protein P0; stalk, helix SPIN, ribonuc 99.66
1vq8_G 348 Acidic ribosomal protein P0 homolog; ribosome 50S, prot 99.61
2zkr_g 317 60S acidic ribosomal protein P0; protein-RNA complex, 6 99.42
>1zav_A 50S ribosomal protein L10; ribosome structure and function, L10-L12 complex structure, L10E structure, L7/12 ribosomal stalk; 1.90A {Thermotoga maritima} SCOP: d.58.62.1 PDB: 1zaw_A 1zax_A Back     alignment and structure
>3jyw_8 60S ribosomal protein LP0; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} Back     alignment and structure
>3jsy_A Acidic ribosomal protein P0 homolog; ribonucleoprotein; 1.60A {Methanocaldococcus jannaschii} Back     alignment and structure
>3a1y_G Acidic ribosomal protein P0; stalk, helix SPIN, ribonucleoprotein; 2.13A {Pyrococcus horikoshii} Back     alignment and structure
>1vq8_G Acidic ribosomal protein P0 homolog; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: j.84.1.1 PDB: 1k73_I* 1k8a_I* 1k9m_I* 1kc8_I* 1kd1_I* 1kqs_G* 1m1k_I* 1m90_I* 1n8r_I* 1nji_I* 1q7y_I* 1q81_I* 1q82_I* 1q86_I* 1qvf_G 1qvg_G 1s72_G* 1vq4_G* 1vq5_G* 1vq6_G* ... Back     alignment and structure
>2zkr_g 60S acidic ribosomal protein P0; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 172 50S ribosomal protein L10 [Candidatus Liberibacter asia
d1zava1177 d.58.62.1 (A:1-177) Ribosomal protein L10 {Thermotoga m 3e-28
>d1zava1 d.58.62.1 (A:1-177) Ribosomal protein L10 {Thermotoga maritima [TaxId: 2336]} Length = 177 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Ribosomal protein L10-like
family: Ribosomal protein L10-like
domain: Ribosomal protein L10
species: Thermotoga maritima [TaxId: 2336]
 Score =  118 bits (296), Expect = 3e-28
 Identities = 49/175 (28%), Positives = 89/175 (50%), Gaps = 7/175 (4%)

Query: 1   MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREA---GGGVKVAKNRL 57
           + RQ K + + E+S+IF  +  I+ A + G +VA + +LR ++RE    G   +V KN L
Sbjct: 2   LTRQQKELIVKEMSEIFKKTSLILFADFLGFTVADLTELRSRLREKYGDGARFRVVKNTL 61

Query: 58  VKIAIRDTSIRGISDLFVGQSLIVY--SDSPVIAPKISVSFSND--NNEFRVLGGVVEKG 113
           + +A+++    G  +   G + ++Y     PV A KI  +F  D   +  R+ GG +E  
Sbjct: 62  LNLALKNAEYEGYEEFLKGPTAVLYVTEGDPVEAVKIIYNFYKDKKADLSRLKGGFLEGK 121

Query: 114 VLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168
               + ++ IA LP  E + A ++  +++  T LV  L      +V  ++A  +K
Sbjct: 122 KFTAEEVENIAKLPSKEELYAMLVGRVKAPITGLVFALSGILRNLVYVLNAIKEK 176


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target172 50S ribosomal protein L10 [Candidatus Liberibacter asia
d1zava1177 Ribosomal protein L10 {Thermotoga maritima [TaxId: 2336 100.0
>d1zava1 d.58.62.1 (A:1-177) Ribosomal protein L10 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Ribosomal protein L10-like
family: Ribosomal protein L10-like
domain: Ribosomal protein L10
species: Thermotoga maritima [TaxId: 2336]
Probab=100.00  E-value=7.8e-44  Score=307.45  Aligned_cols=169  Identities=29%  Similarity=0.518  Sum_probs=163.0

Q ss_pred             CCHHHHHHHHHHHHHHHHHCCEEEEEEECCCCHHHHHHHHHHHHHC---CCEEEEECHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             9748999999999999950897999982799889999999999656---9589986157999997313742120015784
Q gi|254780145|r    1 MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREA---GGGVKVAKNRLVKIAIRDTSIRGISDLFVGQ   77 (172)
Q Consensus         1 m~r~~K~~~V~~l~~~l~~s~~~~v~~y~gltv~~~~~lR~~lr~~---~~~~~VvKNtL~k~A~~~~~~~~l~~~l~G~   77 (172)
                      |+|++|+++|+++++.|++++++++++|+||||+|+++||+++|++   |++++|+||||+|+|+++++++++.++|.||
T Consensus         2 m~r~~K~~~v~~l~~~l~~s~~vv~~~y~gLtv~e~~~LR~~lre~~~~g~~~kV~KNtL~k~Al~~t~~~~l~~~l~g~   81 (177)
T d1zava1           2 LTRQQKELIVKEMSEIFKKTSLILFADFLGFTVADLTELRSRLREKYGDGARFRVVKNTLLNLALKNAEYEGYEEFLKGP   81 (177)
T ss_dssp             CCHHHHHHHHHHHHHHHTTCSEEEEECCTTCCHHHHHHHHHHHHHHHTTSEEEEEECHHHHHHHHHHTTCCSCGGGCSSS
T ss_pred             CCHHHHHHHHHHHHHHHHHCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEECHHHHHHHHHCCCCCHHHHHHHHC
T ss_conf             98799999999999999759989999638998899999999999734698399996269999998557852136777525


Q ss_pred             EEEEEE--CCCCHHHHHHHHHHHHCCH--HHHHHHHCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             378762--2342157887888641000--122321024110798999998469998999999999999899999999977
Q gi|254780145|r   78 SLIVYS--DSPVIAPKISVSFSNDNNE--FRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGT  153 (172)
Q Consensus        78 ~a~~f~--~d~~~~aK~~~~f~k~~~~--l~i~gg~~eg~~l~~~~i~~lakLPs~~el~a~lv~~l~~p~~~l~~~L~~  153 (172)
                      ++++|+  +||+.++|++.+|.|+++.  ++++||++||+++|.+++++||+|||+||++|+|+|+|++|+++++++|++
T Consensus        82 ~a~~~~~~~d~~~~aK~l~~f~k~~k~~~~~i~gg~~eg~~l~~~~i~~la~LPs~eel~a~l~~~L~ap~~~l~~~L~~  161 (177)
T d1zava1          82 TAVLYVTEGDPVEAVKIIYNFYKDKKADLSRLKGGFLEGKKFTAEEVENIAKLPSKEELYAMLVGRVKAPITGLVFALSG  161 (177)
T ss_dssp             EEEEEESSSCTHHHHHHHHHHHHHTTCCGGGEEEEEETTEEEEHHHHHHHHTCCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             41013425870456567777766403333302378743766699999999649999999999999998689999999975


Q ss_pred             HHHHHHHHHHHHHHHH
Q ss_conf             6879999999999976
Q gi|254780145|r  154 PQTQVVRAISAFVDKN  169 (172)
Q Consensus       154 ~~~~l~~~L~~~~~k~  169 (172)
                      ++++|+++|+++.+|+
T Consensus       162 ~~~~l~~~L~a~~~kk  177 (177)
T d1zava1         162 ILRNLVYVLNAIKEKK  177 (177)
T ss_dssp             HHHHHHHHHHHHHHTC
T ss_pred             HHHHHHHHHHHHHHCC
T ss_conf             8999999999997339



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 172 50S ribosomal protein L10 [Candidatus Liberibacter
3i8i_Y_173 (Y:) Elongation Complex Of The 70s Ribosome With T 3e-29
1vq8_G_ 348 (G:) Acidic ribosomal protein P0 homolog; ribosome 1e-23
3a1y_G_1-206206 (G:1-206) Acidic ribosomal protein P0; stalk, ribo 2e-22
2zkr_g_ 317 (g:) 60S acidic ribosomal protein P0; protein-RNA 3e-19
1zav_A_1-136136 (A:1-136) 50S ribosomal protein L10; ribosome stru 4e-23
3jyw_8_118 (8:) 60S ribosomal protein LP0; eukaryotic ribosom 9e-16
>3i8i_Y (Y:) Elongation Complex Of The 70s Ribosome With Three Trnas And Mrna. This Entry 3i8i Contains 50s Ribosomal Subnit. {Thermus thermophilus}Length = 173 Back     alignment and structure
 Score =  122 bits (307), Expect = 3e-29
 Identities = 43/173 (24%), Positives = 90/173 (52%), Gaps = 4/173 (2%)

Query: 1   MNRQGKSVEISELSKIFS-SSGSIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVK 59
           M  +     ++ L +    + GS  + +Y+G+   +   LR+ +++ G  + VAKN L++
Sbjct: 1   MPNKRNVELLATLKENLERAQGSFFLVNYQGLPAKETHALRQALKQNGARLFVAKNTLIR 60

Query: 60  IAIRDTSIRGISDLFVGQSLIVYSDSPVIAPKISVSF--SNDNNEFRVLGGVVEKGVLNQ 117
           +A+++  +  +  L  G S +V+ + PV A K  V F  SN     +V  G+++  +L  
Sbjct: 61  LALKELGLPELDGLQ-GPSAVVFYEDPVAAAKTLVQFAKSNPKGIPQVKSGLLQGQILTA 119

Query: 118 DSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDKNQ 170
             ++ +A LP ++ +RA ++  +Q+    LV +LG    ++V  + A+ +K  
Sbjct: 120 KDVEALAELPTMDELRAELVGVLQAPMAELVGVLGGVARELVGILEAYAEKKA 172


>1vq8_G (G:) Acidic ribosomal protein P0 homolog; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui}Length = 348 Back     alignment and structure
>3a1y_G (G:1-206) Acidic ribosomal protein P0; stalk, ribosomal protein,helix SPIN, ribonucleoprotein; 2.13A {Pyrococcus horikoshii}Length = 206 Back     alignment and structure
>2zkr_g (g:) 60S acidic ribosomal protein P0; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris}Length = 317 Back     alignment and structure
>1zav_A (A:1-136) 50S ribosomal protein L10; ribosome structure and function, L10-L12 complex structure, L10E structure, L7/12 ribosomal stalk; 1.90A {Thermotoga maritima}Length = 136 Back     alignment and structure
>3jyw_8 (8:) 60S ribosomal protein LP0; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus}Length = 118 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target172 50S ribosomal protein L10 [Candidatus Liberibacter asia
3i8i_Y_173 Elongation Complex Of The 70s Ribosome With Three 100.0
3a1y_G_1-206206 Acidic ribosomal protein P0; stalk, ribosomal prot 99.97
1vq8_G_ 348 Acidic ribosomal protein P0 homolog; ribosome 50S, 99.92
2zkr_g_ 317 60S acidic ribosomal protein P0; protein-RNA compl 99.84
1zav_A_1-136136 50S ribosomal protein L10; ribosome structure and 99.94
3jyw_8_118 60S ribosomal protein LP0; eukaryotic ribosome, RA 99.78
1zav_A_137-18044 50S ribosomal protein L10; ribosome structure and 98.82
>3i8i_Y (Y:) Elongation Complex Of The 70s Ribosome With Three Trnas And Mrna. This Entry 3i8i Contains 50s Ribosomal Subnit. {Thermus thermophilus} Back     alignment and structure
Probab=100.00  E-value=8.5e-39  Score=276.72  Aligned_cols=169  Identities=24%  Similarity=0.480  Sum_probs=161.5

Q ss_pred             CCHHHHHHHHHHHHHHHHHCC-EEEEEEECCCCHHHHHHHHHHHHHCCCEEEEECHHHHHHHHHHCCCCCCCCCCCCCEE
Q ss_conf             974899999999999995089-7999982799889999999999656958998615799999731374212001578437
Q gi|254780145|r    1 MNRQGKSVEISELSKIFSSSG-SIVVAHYKGISVAQIKDLRKKMREAGGGVKVAKNRLVKIAIRDTSIRGISDLFVGQSL   79 (172)
Q Consensus         1 m~r~~K~~~V~~l~~~l~~s~-~~~v~~y~gltv~~~~~lR~~lr~~~~~~~VvKNtL~k~A~~~~~~~~l~~~l~G~~a   79 (172)
                      |+|++|+++|+++++.|++++ ++++++|+||+++++++||++||+.|++++|+||||+++|+++++++.+ +.|+|||+
T Consensus         1 m~r~~K~~~v~~l~~~l~~s~~~i~i~~~~gl~~~~~~~lR~~lr~~~~~~~v~KNtl~k~Al~~t~~e~l-~~l~G~~a   79 (173)
T 3i8i_Y            1 MPNKRNVELLATLKENLERAQGSFFLVNYQGLPAKETHALRQALKQNGARLFVAKNTLIRLALKELGLPEL-DGLQGPSA   79 (173)
T ss_dssp             CCCTTSTHHHHHTTSSTTSSCSSBCCCCCSCCSCSSSCSCSCSSSSCCSSCCCCTTHHHHHHCCCSSCCCC-CBTCCCSS
T ss_pred             CCCHHHHHHHHHHHHHHHHHCCEEEEEEECCCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHCCCCHH-HHCCCCEE
T ss_conf             98588999999999999841898899962387889999999999867967998653999999850683002-32148658


Q ss_pred             EEEECCCCHHHHHHHHHHHH--CCHHHHHHHHCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             87622342157887888641--0001223210241107989999984699989999999999998999999999776879
Q gi|254780145|r   80 IVYSDSPVIAPKISVSFSND--NNEFRVLGGVVEKGVLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQ  157 (172)
Q Consensus        80 ~~f~~d~~~~aK~~~~f~k~--~~~l~i~gg~~eg~~l~~~~i~~lakLPs~~el~a~lv~~l~~p~~~l~~~L~~~~~~  157 (172)
                      ++|++|++.+++.+.+|.++  ++.+.++||++||++++.+++..|++|||+++++++++|+|++|+++++++|++++++
T Consensus        80 ~~f~~~~~~~~~~~~~~~~~~k~~~~~~~gg~~~g~il~~~~i~~la~lPs~~~l~~~l~~~l~~~~~~l~~~l~~~~~~  159 (173)
T 3i8i_Y           80 VVFYEDPVAAAKTLVQFAKSNPKGIPQVKSGLLQGQILTAKDVEALAELPTMDELRAELVGVLQAPMAELVGVLGGVARE  159 (173)
T ss_dssp             CCCCCCSCHHHHHHTTSCCCSSCSSSCCCCCCCBSSSCCBCCHHHHSSSCCCSTTSTTTSSCSSCC--------------
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCCCHHHEEEECCCEEECHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99865863237999999984166402420022076154687776541577468999999998744488999998650899


Q ss_pred             HHHHHHHHHHHHH
Q ss_conf             9999999999762
Q gi|254780145|r  158 VVRAISAFVDKNQ  170 (172)
Q Consensus       158 l~~~L~~~~~k~e  170 (172)
                      |+++|+++.+|+|
T Consensus       160 la~~L~~~~~kke  172 (173)
T 3i8i_Y          160 LVGILEAYAEKKA  172 (173)
T ss_dssp             -------------
T ss_pred             HHHHHHHHHHHHC
T ss_conf             9999999998621



>3a1y_G (G:1-206) Acidic ribosomal protein P0; stalk, ribosomal protein,helix SPIN, ribonucleoprotein; 2.13A {Pyrococcus horikoshii} Back     alignment and structure
>1vq8_G (G:) Acidic ribosomal protein P0 homolog; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} Back     alignment and structure
>2zkr_g (g:) 60S acidic ribosomal protein P0; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>1zav_A (A:1-136) 50S ribosomal protein L10; ribosome structure and function, L10-L12 complex structure, L10E structure, L7/12 ribosomal stalk; 1.90A {Thermotoga maritima} Back     alignment and structure
>3jyw_8 (8:) 60S ribosomal protein LP0; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} Back     alignment and structure
>1zav_A (A:137-180) 50S ribosomal protein L10; ribosome structure and function, L10-L12 complex structure, L10E structure, L7/12 ribosomal stalk; 1.90A {Thermotoga maritima} Back     alignment and structure