254780144

254780144

50S ribosomal protein L12P

GeneID in NCBI database:8209119Locus tag:CLIBASIA_00115
Protein GI in NCBI database:254780144Protein Accession:YP_003064557.1
Gene range:-(28458, 28838)Protein Length:126aa
Gene description:50S ribosomal protein L12P
COG prediction:[J] Ribosomal protein L7/L12
KEGG prediction:50S ribosomal protein L12P; K02935 large subunit ribosomal protein L7/L12
SEED prediction:LSU ribosomal protein L7/L12 (P1/P2)
Pathway involved in KEGG:Ribosome [PATH:las03010]
Subsystem involved in SEED:Ribosome LSU bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120------
MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR
cccHHHHHHHHHHccHHHHHHHHHHHHHHHccccccHHHHHcccccccccHHHHHHEEEEEEEEcccHHHHHHHHHHHHHcccccHHHHHHHHHHccHHHHccccHHHHHHHHHHHHHcccEEEEc
cccHHHHHHHHHcccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEccccccccHHHHHHHHHcccHHHHHHHHccccccccEEEEEEcHHHHHHHHHHHHccccEEEEc
MSNIESIVEKLSSLTLIEAAELSKRLEkewgvsasapvsvVAPVAaeagsaasekTEFEVVLkgfddpkkkIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDagatvelr
MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEagsaasektefevvlkgfddpkkkiavIKEVRAITDLGLKEAKelvesapkslktglskdeanemkkkledagatvelr
MSNIESIVEKLSSLTLIEAAELSKRLEKEWgvsasapvsvvapvaaeagsaaseKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR
**NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVA*********ASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKT*L******EMKKKLEDAGATVELR
MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVA***********EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEAN****************
*SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR
MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR
MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target126 50S ribosomal protein L12P [Candidatus Liberibacter asi
548775122 RecName: Full=50S ribosomal protein L7/L12 Length = 122 1 8e-59
730573125 RecName: Full=50S ribosomal protein L7/L12 Length = 125 1 5e-36
14195176124 RecName: Full=50S ribosomal protein L7/L12 Length = 124 1 8e-34
194293715124 50S ribosomal subunit protein L12 [Candidatus Liberibac 1 1e-32
289546830127 50S ribosomal subunit protein L12 [Candidatus Liberibac 1 2e-32
315122746124 50S ribosomal protein L12P [Candidatus Liberibacter sol 1 2e-32
218683242123 50S ribosomal protein L12 [Candidatus Liberibacter sp. 1 7e-32
218683246123 50S ribosomal protein L12 [Candidatus Liberibacter sp. 1 1e-31
256427010119 50S ribosomal protein L12 [Candidatus Liberibacter psyl 1 1e-30
153005083125 ribosomal protein L7/L12 [Anaeromyxobacter sp. Fw109-5] 1 2e-26
>gi|548775|sp|P36247|RL7_LIBAS RecName: Full=50S ribosomal protein L7/L12 Length = 122 Back     alignment and organism information
 Score =  229 bits (585), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 122/122 (100%), Positives = 122/122 (100%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV
Sbjct: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG
Sbjct: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120

Query: 121 AT 122
           AT
Sbjct: 121 AT 122


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|730573|sp|P41189|RL7_LIBAF RecName: Full=50S ribosomal protein L7/L12 Length = 125 Back     alignment and organism information
>gi|14195176|sp|Q9L5W4|RL7_LIBAC RecName: Full=50S ribosomal protein L7/L12 Length = 124 Back     alignment and organism information
>gi|194293715|gb|ACF39953.1| 50S ribosomal subunit protein L12 [Candidatus Liberibacter solanacearum] Length = 124 Back     alignment and organism information
>gi|289546830|gb|ADD10123.1| 50S ribosomal subunit protein L12 [Candidatus Liberibacter solanacearum] Length = 127 Back     alignment and organism information
>gi|315122746|ref|YP_004063235.1| 50S ribosomal protein L12P [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 124 Back     alignment and organism information
>gi|218683242|gb|ACL00660.1| 50S ribosomal protein L12 [Candidatus Liberibacter sp. CA DP-1] Length = 123 Back     alignment and organism information
>gi|218683246|gb|ACL00662.1| 50S ribosomal protein L12 [Candidatus Liberibacter sp. Burns] Length = 123 Back     alignment and organism information
>gi|256427010|gb|ACU81078.1| 50S ribosomal protein L12 [Candidatus Liberibacter psyllaurous] Length = 119 Back     alignment and organism information
>gi|153005083|ref|YP_001379408.1| ribosomal protein L7/L12 [Anaeromyxobacter sp. Fw109-5] Length = 125 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target126 50S ribosomal protein L12P [Candidatus Liberibacter asi
PRK00157123 PRK00157, rplL, 50S ribosomal protein L7/L12; Reviewed 7e-32
CHL00083131 CHL00083, rpl12, ribosomal protein L12 4e-28
TIGR00855126 TIGR00855, L12, ribosomal protein L7/L12 8e-26
COG0222124 COG0222, RplL, Ribosomal protein L7/L12 [Translation, r 1e-22
KOG1715187 KOG1715, KOG1715, KOG1715, Mitochondrial/chloroplast ri 7e-20
cd00387127 cd00387, Ribosomal_L7_L12, Ribosomal protein L7/L12 7e-32
pfam0054268 pfam00542, Ribosomal_L12, Ribosomal protein L7/L12 C-te 4e-19
>gnl|CDD|178906 PRK00157, rplL, 50S ribosomal protein L7/L12; Reviewed Back     alignment and domain information
>gnl|CDD|177022 CHL00083, rpl12, ribosomal protein L12 Back     alignment and domain information
>gnl|CDD|162069 TIGR00855, L12, ribosomal protein L7/L12 Back     alignment and domain information
>gnl|CDD|30571 COG0222, RplL, Ribosomal protein L7/L12 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|36927 KOG1715, KOG1715, KOG1715, Mitochondrial/chloroplast ribosomal protein L12 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|100102 cd00387, Ribosomal_L7_L12, Ribosomal protein L7/L12 Back     alignment and domain information
>gnl|CDD|144215 pfam00542, Ribosomal_L12, Ribosomal protein L7/L12 C-terminal domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 126 50S ribosomal protein L12P [Candidatus Liberibacter asi
TIGR00855131 L12 ribosomal protein L7/L12; InterPro: IPR000206 Ribos 100.0
CHL00083129 rpl12 ribosomal protein L12 100.0
PRK00157124 rplL 50S ribosomal protein L7/L12; Reviewed 100.0
cd00387127 Ribosomal_L7_L12 Ribosomal protein L7/L12. Ribosomal pr 100.0
COG0222124 RplL Ribosomal protein L7/L12 [Translation, ribosomal s 100.0
KOG1715187 consensus 100.0
pfam0054268 Ribosomal_L12 Ribosomal protein L7/L12 C-terminal domai 99.89
>TIGR00855 L12 ribosomal protein L7/L12; InterPro: IPR000206 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>CHL00083 rpl12 ribosomal protein L12 Back     alignment and domain information
>PRK00157 rplL 50S ribosomal protein L7/L12; Reviewed Back     alignment and domain information
>cd00387 Ribosomal_L7_L12 Ribosomal protein L7/L12 Back     alignment and domain information
>COG0222 RplL Ribosomal protein L7/L12 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1715 consensus Back     alignment and domain information
>pfam00542 Ribosomal_L12 Ribosomal protein L7/L12 C-terminal domain Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target126 50S ribosomal protein L12P [Candidatus Liberibacter asi
2zjq_5122 Interaction Of L7 With L11 Induced By Microccocin B 1e-13
2ftc_E137 Structural Model For The Large Subunit Of The Mamma 2e-12
2xtg_L121 Trna Tranlocation On The 70s Ribosome: The Pre- Tra 5e-11
1rqu_A120 Nmr Structure Of L7 Dimer From E.Coli Length = 120 6e-11
2gya_3119 Structure Of The 50s Subunit Of A Pre-Translocation 9e-11
3i8i_I125 Elongation Complex Of The 70s Ribosome With Three T 8e-10
1dd3_A128 Crystal Structure Of Ribosomal Protein L12 From The 1e-09
1rqs_A74 Nmr Structure Of C-Terminal Domain Of Ribosomal Pro 1e-05
2bcw_B68 Coordinates Of The N-Terminal Domain Of Ribosomal P 2e-05
gi|190613548|pdb|2ZJQ|5 Chain 5, Interaction Of L7 With L11 Induced By Microccocin Binding To The Deinococcus Radiodurans 50s Subunit Length = 122 Back     alignment and structure
 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 60/124 (48%), Positives = 83/124 (66%), Gaps = 5/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           + ++++++L  LT++E A+L   L++ WGV+A+  VS     A  A  AA EKTEF+VVL
Sbjct: 4   DKQALIDQLGQLTIMELADLIDGLKETWGVTAAVAVSGG--GAGAASPAAEEKTEFDVVL 61

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              D    KI VIKE+R IT LGLKEAK++ E     LK G++KDEA +MK +LE AGA 
Sbjct: 62  --IDAGASKINVIKEIRGITGLGLKEAKDMSEKGG-VLKEGVAKDEAEKMKAQLEAAGAR 118

Query: 123 VELR 126
           VEL+
Sbjct: 119 VELK 122


>gi|99032311|pdb|2FTC|E Chain E, Structural Model For The Large Subunit Of The Mammalian Mitochondrial Ribosome Length = 137 Back     alignment and structure
gi|313754042|pdb|2XTG|L Chain L, Trna Tranlocation On The 70s Ribosome: The Pre- Translocational Translocation Intermediate Ti(Pre) Length = 121 Back     alignment and structure
>gi|46015538|pdb|1RQU|A Chain A, Nmr Structure Of L7 Dimer From E.Coli Length = 120 Back     alignment and structure
>gi|116667433|pdb|2GYA|3 Chain 3, Structure Of The 50s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 119 Back     alignment and structure
gi|294979561|pdb|3I8I|I Chain I, Elongation Complex Of The 70s Ribosome With Three Trnas And Entry 3i8i Contains 50s Ribosomal Subnit. The 30s Ribosomal Can Be Found In Pdb Entry 3i8h. Molecule A In The Same Asym Unit Is Deposited As 3i8f (50s) And 3i8g (30s). Length = 125 Back     alignment and structure
gi|11513815|pdb|1DD3|A Chain A, Crystal Structure Of Ribosomal Protein L12 From Thermotoga Maritima Length = 128 Back     alignment and structure
>gi|46015535|pdb|1RQS|A Chain A, Nmr Structure Of C-Terminal Domain Of Ribosomal Protein L7 From E.Coli Length = 74 Back     alignment and structure
>gi|85544273|pdb|2BCW|B Chain B, Coordinates Of The N-Terminal Domain Of Ribosomal Protein L11,C-Terminal Domain Of Ribosomal Protein L7L12 AND A Portion Of The G' Domain Of Elongation Factor G, As Fitted Into Cryo-Em Map Of An Escherichia Coli 70sEf- GGdpFusidic Acid Complex Length = 68 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target126 50S ribosomal protein L12P [Candidatus Liberibacter asi
2j01_L125 50S ribosomal protein L7; ribosome, tRNA, paromomycin, 2e-24
2zjq_5122 50S ribosomal protein L7/L12; ribosome, ribosomal subun 4e-24
1dd3_A128 50S ribosomal protein L7/L12; dimer formation, flexibil 6e-24
2ftc_E137 Mitochondrial ribosomal protein L7/12, mitochondrial 39 8e-22
1rqu_A120 L8, 50S ribosomal protein L7/L12; ribosome,; NMR {Esche 2e-20
1ctf_A74 Ribosomal protein L7/L12; 1.70A {Escherichia coli} SCOP 2e-16
1dd4_C40 50S ribosomal protein L7/L12; dimer formation, flexibil 6e-04
>2zjq_5 50S ribosomal protein L7/L12; ribosome, ribosomal subunit, thiopeptide antibiotics, complex, translational regulation, molecular switch; 3.30A {Deinococcus radiodurans} SCOP: d.45.1.1 Length = 122 Back     alignment and structure
>1dd3_A 50S ribosomal protein L7/L12; dimer formation, flexibility, hinge region, four-helix- bundle, five-helix- bundle, alpha-beta structure; 2.00A {Thermotoga maritima} SCOP: a.108.1.1 d.45.1.1 PDB: 1dd4_A* 1giy_I 1yl3_I Length = 128 Back     alignment and structure
>2ftc_E Mitochondrial ribosomal protein L7/12, mitochondrial 39S ribosomal protein L3; mitochondrial ribosome, large ribosomal subunit, ribosomal RNA; 12.10A {Bos taurus} Length = 137 Back     alignment and structure
>1rqu_A L8, 50S ribosomal protein L7/L12; ribosome,; NMR {Escherichia coli} SCOP: a.108.1.1 d.45.1.1 PDB: 1rqv_A 2gya_3 2gyc_3 Length = 120 Back     alignment and structure
>1ctf_A Ribosomal protein L7/L12; 1.70A {Escherichia coli} SCOP: d.45.1.1 PDB: 1rqs_A 2bcw_B Length = 74 Back     alignment and structure
>1dd4_C 50S ribosomal protein L7/L12; dimer formation, flexibility, hinge region, four-helix- bundle, five-helix- bundle, alpha-beta structure; HET: TBR; 2.40A {Thermotoga maritima} SCOP: a.108.1.1 Length = 40 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target126 50S ribosomal protein L12P [Candidatus Liberibacter asi
2ftc_E137 Mitochondrial ribosomal protein L7/12, mitochondrial 39 100.0
2j01_L125 50S ribosomal protein L7; ribosome, tRNA, paromomycin, 100.0
2zjq_5122 50S ribosomal protein L7/L12; ribosome, ribosomal subun 100.0
1rqu_A120 L8, 50S ribosomal protein L7/L12; ribosome,; NMR {Esche 100.0
1dd3_A128 50S ribosomal protein L7/L12; dimer formation, flexibil 100.0
1ctf_A74 Ribosomal protein L7/L12; 1.70A {Escherichia coli} SCOP 99.92
1dd4_C40 50S ribosomal protein L7/L12; dimer formation, flexibil 98.59
1rqt_A37 L8, 50S ribosomal protein L7/L12; protein L7/L12,riboso 97.75
1zav_U30 50S ribosomal protein L7/L12; ribosome structure and fu 97.05
>2ftc_E Mitochondrial ribosomal protein L7/12, mitochondrial 39S ribosomal protein L3; mitochondrial ribosome, large ribosomal subunit, ribosomal RNA; 12.10A {Bos taurus} Back     alignment and structure
Probab=100.00  E-value=1.2e-38  Score=252.39  Aligned_cols=123  Identities=33%  Similarity=0.495  Sum_probs=106.6

Q ss_pred             CHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCCCCCCCC------------CCCCCCCCCCCCCCCCCEEEEEECCCCCC
Q ss_conf             189999999609999999999999999378710001223------------55444432222222431157774377554
Q gi|254780144|r    3 NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV------------APVAAEAGSAASEKTEFEVVLKGFDDPKK   70 (126)
Q Consensus         3 ki~~ive~i~~LTllE~~eLv~~leekfgv~~~~~~~~~------------~~~~~~~~~~~~EKt~fdV~L~~~~~~~~   70 (126)
                      |+++|+|+|++|||+|++||++.|+++|||+..++++++            +++.+..++..+|||+|||+|++|++ ++
T Consensus         2 kv~~iv~~i~~LtllE~~eL~~~le~k~gv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~EKt~FdV~L~~~~~-~~   80 (137)
T 2ftc_E            2 KIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLMPMGGMVPGAAPAPTAPEAAEEDVPKQKERTHFTVRLTEAKP-VD   80 (137)
T ss_pred             CHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCEEEEEECCCCC-HH
T ss_conf             68999999970989999999999999969984311221223344555445566555442100013357887324772-12


Q ss_pred             CHHHHHHHHH-HCCCCHHHHHHHHHHCCHHHHHCCCHHHHHHHHHHHHHCCCEEEEC
Q ss_conf             3357877677-6599889999998637977660999899999999999748579939
Q gi|254780144|r   71 KIAVIKEVRA-ITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR  126 (126)
Q Consensus        71 Ki~vIK~vR~-it~LgLkEAK~lVe~~P~~ike~v~keeAE~ik~~Le~aGa~VeiK  126 (126)
                      ||+|||+||+ +|||||||||+|||++|++||+|+||+|||++|++|+++||+|+|+
T Consensus        81 KI~vIK~VR~~it~LgLkEAK~lVE~~P~~iKe~vsKeEAE~ik~kLe~aGA~Vele  137 (137)
T 2ftc_E           81 KVKLIKEIKNYVQGINLVQAKKLVESLPQEIKANVAKAEAEKIKAALEAVGGTVVLE  137 (137)
T ss_pred             HHHHHHHHHHHCCCCCHHHHHHHHHHCCHHHHCCCCHHHHHHHHHHHHHCCCEEEEC
T ss_conf             678999999871799859999998808898872899999999999999859979729



>2zjq_5 50S ribosomal protein L7/L12; ribosome, ribosomal subunit, thiopeptide antibiotics, complex, translational regulation, molecular switch; 3.30A {Deinococcus radiodurans} SCOP: d.45.1.1 Back     alignment and structure
>1rqu_A L8, 50S ribosomal protein L7/L12; ribosome,; NMR {Escherichia coli} SCOP: a.108.1.1 d.45.1.1 PDB: 1rqv_A 2gya_3 2gyc_3 Back     alignment and structure
>1dd3_A 50S ribosomal protein L7/L12; dimer formation, flexibility, hinge region, four-helix- bundle, five-helix- bundle, alpha-beta structure; 2.00A {Thermotoga maritima} SCOP: a.108.1.1 d.45.1.1 PDB: 1dd4_A* 1giy_I 1yl3_I Back     alignment and structure
>1ctf_A Ribosomal protein L7/L12; 1.70A {Escherichia coli} SCOP: d.45.1.1 PDB: 1rqs_A 2bcw_B Back     alignment and structure
>1dd4_C 50S ribosomal protein L7/L12; dimer formation, flexibility, hinge region, four-helix- bundle, five-helix- bundle, alpha-beta structure; HET: TBR; 2.40A {Thermotoga maritima} SCOP: a.108.1.1 Back     alignment and structure
>1rqt_A L8, 50S ribosomal protein L7/L12; protein L7/L12,ribosome,; NMR {Escherichia coli} SCOP: a.108.1.1 Back     alignment and structure
>1zav_U 50S ribosomal protein L7/L12; ribosome structure and function, L10-L12 complex structure, L10E structure, L7/12 ribosomal stalk; 1.90A {Thermotoga maritima} SCOP: a.108.1.1 PDB: 1zaw_U 1zax_U 1dd3_C Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 126 50S ribosomal protein L12P [Candidatus Liberibacter asi
d1ctfa_68 d.45.1.1 (A:) Ribosomal protein L7/12, C-terminal domai 1e-14
d1dd3a271 d.45.1.1 (A:58-128) Ribosomal protein L7/12, C-terminal 4e-14
d1dd3a157 a.108.1.1 (A:1-57) Ribosomal protein L7/12, oligomerisa 3e-05
>d1ctfa_ d.45.1.1 (A:) Ribosomal protein L7/12, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 68 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: ClpS-like
superfamily: ClpS-like
family: Ribosomal protein L7/12, C-terminal domain
domain: Ribosomal protein L7/12, C-terminal domain
species: Escherichia coli [TaxId: 562]
 Score = 72.4 bits (178), Expect = 1e-14
 Identities = 42/70 (60%), Positives = 53/70 (75%), Gaps = 2/70 (2%)

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           EF+V+LK       K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A  +KK L
Sbjct: 1   EFDVILKAAGA--NKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKAL 58

Query: 117 EDAGATVELR 126
           E+AGA VE++
Sbjct: 59  EEAGAEVEVK 68


>d1dd3a2 d.45.1.1 (A:58-128) Ribosomal protein L7/12, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 71 Back     information, alignment and structure
>d1dd3a1 a.108.1.1 (A:1-57) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Thermotoga maritima [TaxId: 2336]} Length = 57 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target126 50S ribosomal protein L12P [Candidatus Liberibacter asi
d2zjq5171 Ribosomal protein L7/12, C-terminal domain {Deinococcus 99.91
d1ctfa_68 Ribosomal protein L7/12, C-terminal domain {Escherichia 99.89
d1dd3a271 Ribosomal protein L7/12, C-terminal domain {Thermotoga 99.88
d1dd3a157 Ribosomal protein L7/12, oligomerisation (N-terminal) d 98.93
d2gyc3147 Ribosomal protein L7/12, oligomerisation (N-terminal) d 98.31
d1zavu130 Ribosomal protein L7/12, oligomerisation (N-terminal) d 97.05
>d2zjq51 d.45.1.1 (5:52-122) Ribosomal protein L7/12, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: ClpS-like
superfamily: ClpS-like
family: Ribosomal protein L7/12, C-terminal domain
domain: Ribosomal protein L7/12, C-terminal domain
species: Deinococcus radiodurans [TaxId: 1299]
Probab=99.91  E-value=7e-25  Score=168.06  Aligned_cols=71  Identities=59%  Similarity=0.798  Sum_probs=67.5

Q ss_pred             CCCCCCEEEEEECCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHCCHHHHHCCCHHHHHHHHHHHHHCCCEEEEC
Q ss_conf             22243115777437755433578776776599889999998637977660999899999999999748579939
Q gi|254780144|r   53 SEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR  126 (126)
Q Consensus        53 ~EKt~fdV~L~~~~~~~~Ki~vIK~vR~it~LgLkEAK~lVe~~P~~ike~v~keeAE~ik~~Le~aGa~VeiK  126 (126)
                      +|||+|||+|++|++  +||+|||+||++|||||+|||+|||+ |.+|++|++|+|||++|++|+++||+|+||
T Consensus         1 EEKt~F~V~L~~~~~--~Ki~vIK~VR~it~LgLkeAK~lVe~-p~~ike~vsKeeAE~~k~~Le~aGA~VelK   71 (71)
T d2zjq51           1 EEKTEFDVVLIDAGA--SKINVIKEIRGITGLGLKEAKDMSEK-GGVLKEGVAKDEAEKMKAQLEAAGARVELK   71 (71)
T ss_pred             CCCCEEEEEEEECCC--CHHHHHHHHHHHCCCCHHHHHHHCCC-CHHHHCCCCHHHHHHHHHHHHHCCCEEEEC
T ss_conf             987378999841786--40368999988659988999862138-637651898999999999999849989849



>d1ctfa_ d.45.1.1 (A:) Ribosomal protein L7/12, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dd3a2 d.45.1.1 (A:58-128) Ribosomal protein L7/12, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dd3a1 a.108.1.1 (A:1-57) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gyc31 a.108.1.1 (3:2-48) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zavu1 a.108.1.1 (U:1-30) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 126 50S ribosomal protein L12P [Candidatus Liberibacte
3i8i_J_125 (J:) Elongation Complex Of The 70s Ribosome With T 9e-25
2zjq_5_122 (5:) 50S ribosomal protein L7/L12; ribosome, ribos 7e-24
1ctf_A_74 (A:) Ribosomal protein L7/L12; 1.70A {Escherichia 2e-16
1rqu_A_41-12080 (A:41-120) L8, 50S ribosomal protein L7/L12; ribos 3e-16
2ftc_E_66-13772 (E:66-137) Mitochondrial ribosomal protein L7/12, 7e-15
1dd3_A_58-12871 (A:58-128) 50S ribosomal protein L7/L12; dimer for 3e-13
1dd3_A_1-5757 (A:1-57) 50S ribosomal protein L7/L12; dimer forma 3e-06
>3i8i_J (J:) Elongation Complex Of The 70s Ribosome With Three Trnas And Mrna. This Entry 3i8i Contains 50s Ribosomal Subnit. {Thermus thermophilus HB8}Length = 125 Back     alignment and structure
 Score =  106 bits (267), Expect = 9e-25
 Identities = 67/125 (53%), Positives = 87/125 (69%), Gaps = 4/125 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAG-SAASEKTEFEVV 61
           +IE I E+LS  T++E  +L   L++ WGV+A+APV+V A  AA A  + A EKTEF+V+
Sbjct: 4   DIERIKEELSQATVLELKQLIDALKEAWGVTAAAPVAVAAAPAAGAAAAPAEEKTEFDVI 63

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           LK      KK+ VIKE+RAIT LGLKEAK+L E     +K G+SK EA E+KKKLE  GA
Sbjct: 64  LKEAGA--KKLEVIKELRAITGLGLKEAKDLAE-KGGPVKEGVSKQEAEEIKKKLEAVGA 120

Query: 122 TVELR 126
            VEL+
Sbjct: 121 VVELK 125


>2zjq_5 (5:) 50S ribosomal protein L7/L12; ribosome, ribosomal subunit, thiopeptide antibiotics, complex, translational regulation, molecular switch; 3.30A {Deinococcus radiodurans}Length = 122 Back     alignment and structure
>1ctf_A (A:) Ribosomal protein L7/L12; 1.70A {Escherichia coli}Length = 74 Back     alignment and structure
>1rqu_A (A:41-120) L8, 50S ribosomal protein L7/L12; ribosome,; NMR {Escherichia coli}Length = 80 Back     alignment and structure
>2ftc_E (E:66-137) Mitochondrial ribosomal protein L7/12, mitochondrial 39S ribosomal protein L3; mitochondrial ribosome, large ribosomal subunit, ribosomal RNA; 12.10A {Bos taurus}Length = 72 Back     alignment and structure
>1dd3_A (A:58-128) 50S ribosomal protein L7/L12; dimer formation, flexibility, hinge region, four-helix- bundle, five-helix- bundle, alpha-beta structure; 2.00A {Thermotoga maritima}Length = 71 Back     alignment and structure
>1dd3_A (A:1-57) 50S ribosomal protein L7/L12; dimer formation, flexibility, hinge region, four-helix- bundle, five-helix- bundle, alpha-beta structure; 2.00A {Thermotoga maritima}Length = 57 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target126 50S ribosomal protein L12P [Candidatus Liberibacter asi
2zjq_5_122 50S ribosomal protein L7/L12; ribosome, ribosomal 100.0
3i8i_J_125 Elongation Complex Of The 70s Ribosome With Three 100.0
1rqu_A_41-12080 L8, 50S ribosomal protein L7/L12; ribosome,; NMR { 99.92
1ctf_A_74 Ribosomal protein L7/L12; 1.70A {Escherichia coli} 99.9
2ftc_E_66-13772 Mitochondrial ribosomal protein L7/12, mitochondri 99.9
1dd3_A_58-12871 50S ribosomal protein L7/L12; dimer formation, fle 99.88
1dd3_A_1-5757 50S ribosomal protein L7/L12; dimer formation, fle 99.01
1dd4_C_40 50S ribosomal protein L7/L12; dimer formation, fle 98.38
2ftc_E_1-6565 Mitochondrial ribosomal protein L7/12, mitochondri 98.36
1rqt_A_37 L8, 50S ribosomal protein L7/L12; protein L7/L12,r 97.63
1zav_U_30 50S ribosomal protein L7/L12; ribosome structure a 96.83
>2zjq_5 (5:) 50S ribosomal protein L7/L12; ribosome, ribosomal subunit, thiopeptide antibiotics, complex, translational regulation, molecular switch; 3.30A {Deinococcus radiodurans} Back     alignment and structure
Probab=100.00  E-value=6.7e-38  Score=248.87  Aligned_cols=120  Identities=49%  Similarity=0.697  Sum_probs=107.9

Q ss_pred             CCHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCHHHHHHHHHH
Q ss_conf             71899999996099999999999999993787100012235544443222222243115777437755433578776776
Q gi|254780144|r    2 SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKGFDDPKKKIAVIKEVRAI   81 (126)
Q Consensus         2 aki~~ive~i~~LTllE~~eLv~~leekfgv~~~~~~~~~~~~~~~~~~~~~EKt~fdV~L~~~~~~~~Ki~vIK~vR~i   81 (126)
                      .+.++|+++|++||++|++||++.|+++|||++.+++++  ++++++.++++|||+|||+|++|+  ++||+|||+||++
T Consensus         3 ~~~~~ive~i~~LTllE~~eLv~~leek~gv~~~~~~~~--~~~~~~~~~~~ekt~F~V~L~~~~--~~Ki~vIK~vR~i   78 (122)
T 2zjq_5            3 YDKQALIDQLGQLTIMELADLIDGLKETWGVTAAVAVSG--GGAGAASPAAEEKTEFDVVLIDAG--ASKINVIKEIRGI   78 (122)
T ss_pred             CCHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCCCCCCC--CCCCCCCCCCCCCCEEEEEEECCC--CCCCCHHHHHHHC
T ss_conf             769999999970889999999999999969984444566--666666665555554677630278--7652013498761


Q ss_pred             CCCCHHHHHHHHHHCCHHHHHCCCHHHHHHHHHHHHHCCCEEEEC
Q ss_conf             599889999998637977660999899999999999748579939
Q gi|254780144|r   82 TDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR  126 (126)
Q Consensus        82 t~LgLkEAK~lVe~~P~~ike~v~keeAE~ik~~Le~aGa~VeiK  126 (126)
                      |||||||||+|||+ |++||+|+||+|||++|++|+++||+|+||
T Consensus        79 t~LgLkEAK~lVE~-p~~ike~vsKeeAE~ikkkLe~aGA~VeiK  122 (122)
T 2zjq_5           79 TGLGLKEAKDMSEK-GGVLKEGVAKDEAEKMKAQLEAAGARVELK  122 (122)
T ss_pred             CCCCHHHHHHHHHC-CHHHHCCCCHHHHHHHHHHHHHCCCEEEEC
T ss_conf             79988999987607-657751899999999999999859979739



>3i8i_J (J:) Elongation Complex Of The 70s Ribosome With Three Trnas And Mrna. This Entry 3i8i Contains 50s Ribosomal Subnit. {Thermus thermophilus HB8} Back     alignment and structure
>1rqu_A (A:41-120) L8, 50S ribosomal protein L7/L12; ribosome,; NMR {Escherichia coli} Back     alignment and structure
>1ctf_A (A:) Ribosomal protein L7/L12; 1.70A {Escherichia coli} Back     alignment and structure
>2ftc_E (E:66-137) Mitochondrial ribosomal protein L7/12, mitochondrial 39S ribosomal protein L3; mitochondrial ribosome, large ribosomal subunit, ribosomal RNA; 12.10A {Bos taurus} Back     alignment and structure
>1dd3_A (A:58-128) 50S ribosomal protein L7/L12; dimer formation, flexibility, hinge region, four-helix- bundle, five-helix- bundle, alpha-beta structure; 2.00A {Thermotoga maritima} Back     alignment and structure
>1dd3_A (A:1-57) 50S ribosomal protein L7/L12; dimer formation, flexibility, hinge region, four-helix- bundle, five-helix- bundle, alpha-beta structure; 2.00A {Thermotoga maritima} Back     alignment and structure
>1dd4_C (C:) 50S ribosomal protein L7/L12; dimer formation, flexibility, hinge region, four-helix- bundle, five-helix- bundle, alpha-beta structure; HET: TBR; 2.40A {Thermotoga maritima} Back     alignment and structure
>2ftc_E (E:1-65) Mitochondrial ribosomal protein L7/12, mitochondrial 39S ribosomal protein L3; mitochondrial ribosome, large ribosomal subunit, ribosomal RNA; 12.10A {Bos taurus} Back     alignment and structure
>1rqt_A (A:) L8, 50S ribosomal protein L7/L12; protein L7/L12,ribosome,; NMR {Escherichia coli} Back     alignment and structure
>1zav_U (U:) 50S ribosomal protein L7/L12; ribosome structure and function, L10-L12 complex structure, L10E structure, L7/12 ribosomal stalk; 1.90A {Thermotoga maritima} Back     alignment and structure