254780147

254780147

50S ribosomal protein L11

GeneID in NCBI database:8209122Locus tag:CLIBASIA_00130
Protein GI in NCBI database:254780147Protein Accession:YP_003064560.1
Gene range:-(30278, 30706)Protein Length:142aa
Gene description:50S ribosomal protein L11
COG prediction:[J] Ribosomal protein L11
KEGG prediction:rplK; 50S ribosomal protein L11; K02867 large subunit ribosomal protein L11
SEED prediction:LSU ribosomal protein L11p (L12e)
Pathway involved in KEGG:Ribosome [PATH:las03010]
Subsystem involved in SEED:Ribosome LSU bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140--
MAKVVSRIVKLQIESGSAKPSPPVGPAIGQAGIPIMAFCKAFNAATEGMEKGIPIPTTVTCYKDKSFTFTMSQPPVSFFLKKEVGIKSGSKLPGKESCGSITRENIRKIAQLKMQDMGAIDIEGAMRMVEGSACSMGISVVD
ccHHHHHEEEEEEEcccccccccHHHHHccccccHHHHHHHHHHHHHHHHcccEEEEEEEEEcccEEEEEEEcccHHHHHHHHcccccccccccccEEEEccHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccEEEEc
ccHHHHHHHHHHHHHccccccccccccHccccccHHHHHHHHHHHcccHccccccEEEEEEEEcccEEEEEcccHHHHHHHHHcccccccccccccEEEEccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccEEcc
MAKVVSRIVKLQIesgsakpsppvgpaigqagiPIMAFCKAFNAATegmekgipipttvtcykdksftftmsqppvsfflkkevgiksgsklpgkescgsiTRENIRKIAQLKMQDMGAIDIEGAMRMVEGSAcsmgisvvd
MAKVVSRIVKLQiesgsakpsppvGPAIGQAGIPIMAFCKAFNAATEGMEKGIPIPTTVTCYKDKSFTFTMSQPPVSFFLKKEVGiksgsklpgkescgsiTRENIRKIAQLKMQDMGAIDIEGAMRMVEGSAcsmgisvvd
MAKVVSRIVKLQIESGSAKPSPPVGPAIGQAGIPIMAFCKAFNAATEGMEKGIPIPTTVTCYKDKSFTFTMSQPPVSFFLKKEVGIKSGSKLPGKESCGSITRENIRKIAQLKMQDMGAIDIEGAMRMVEGSACSMGISVVD
*AKVVSRIVKLQIESGSAKPSPPVGPAIGQAGIPIMAFCKAFNAATEGMEKGIPIPTTVTCYKDKSFTFTMSQPPVSFFLKKE***************GSITRENIRKIAQLKMQDMGAIDIEGAMRMVEGSACSMGISV**
MAKVVSRIVKLQIE*********VGPAIGQAGIPIMAFCKAFNAATEGMEKGIPIPTTVTCYKDKSFTFTMSQPPVSFFLKKEVGIKSG**********SITRENIRKIAQLKMQDMGAIDIEGAMRMVEGSACSMGISVVD
*AKVVSRIVKLQIESGSAKPSPPVGPAIGQAGIPIMAFCKAFNAATEGMEKGIPIPTTVTCYKDKSFTFTMSQPPVSFFLKKEVGIKSGSKLPGKESCGSITRENIRKIAQLKMQDMGAIDIEGAMRMVEGSACSMGISV**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKVVSRIVKLQIESGSAKPSPPVGPAIGQAGIPIMAFCKAFNAATEGMEKGIPIPTTVTCYKDKSFTFTMSQPPVSFFLKKEVGIKSGSKLPGKESCGSITRENIRKIAQLKMQDMGAIDIEGAMRMVEGSACSMGISVVD
MAKVVSRIVKLQIESGSAKPSPPVGPAIGQAGIPIMAFCKAFNAATEGMEKGIPIPTTVTCYKDKSFTFTMSQPPVSFFLKKEVGIKSGSKLPGKESCGSITRENIRKIAQLKMQDMGAIDIEGAMRMVEGSACSMGISVVD
MAKVVSRIVKLQIESGSAKPSPPVGPAIGQAGIPIMAFCKAFNAATEGMEKGIPIPTTVTCYKDKSFTFTMSQPPVSFFLKKEVGIKSGSKLPGKESCGSITRENIRKIAQLKMQDMGAIDIEGAMRMVEGSACSMGISVVD

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target142 50S ribosomal protein L11 [Candidatus Liberibacter asia
255957884142 50S ribosomal subunit protein L11 [Candidatus Liberibac 1 2e-74
157704380142 50S ribosomal subunit protein L11 [Candidatus Liberibac 1 2e-74
157690446142 50S ribosomal subunit protein L11 [Candidatus Liberibac 1 4e-62
133872296142 50S ribosomal subunit protein L11 [Candidatus Liberibac 1 5e-59
315122749142 50S ribosomal protein L11 [Candidatus Liberibacter sola 1 5e-52
163759402142 50S ribosomal protein L11 [Hoeflea phototrophica DFL-43 1 4e-49
227821743142 50S ribosomal protein L11 [Sinorhizobium fredii NGR234] 1 2e-47
49475394142 50S ribosomal protein L11 [Bartonella henselae str. Hou 1 6e-47
239832135142 ribosomal protein L11 [Ochrobactrum intermedium LMG 330 1 1e-46
148560091142 50S ribosomal protein L11 [Brucella ovis ATCC 25840] Le 1 1e-46
>gi|255957884|dbj|BAH96854.1| 50S ribosomal subunit protein L11 [Candidatus Liberibacter asiaticus] Length = 142 Back     alignment and organism information
 Score =  281 bits (720), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 141/142 (99%), Positives = 141/142 (99%)

Query: 1   MAKVVSRIVKLQIESGSAKPSPPVGPAIGQAGIPIMAFCKAFNAATEGMEKGIPIPTTVT 60
           MAKVVSRIVKLQIESGSAKPSPPVGPAIGQAGI IMAFCKAFNAATEGMEKGIPIPTTVT
Sbjct: 1   MAKVVSRIVKLQIESGSAKPSPPVGPAIGQAGISIMAFCKAFNAATEGMEKGIPIPTTVT 60

Query: 61  CYKDKSFTFTMSQPPVSFFLKKEVGIKSGSKLPGKESCGSITRENIRKIAQLKMQDMGAI 120
           CYKDKSFTFTMSQPPVSFFLKKEVGIKSGSKLPGKESCGSITRENIRKIAQLKMQDMGAI
Sbjct: 61  CYKDKSFTFTMSQPPVSFFLKKEVGIKSGSKLPGKESCGSITRENIRKIAQLKMQDMGAI 120

Query: 121 DIEGAMRMVEGSACSMGISVVD 142
           DIEGAMRMVEGSACSMGISVVD
Sbjct: 121 DIEGAMRMVEGSACSMGISVVD 142


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|157704380|gb|ABV68879.1| 50S ribosomal subunit protein L11 [Candidatus Liberibacter asiaticus] Length = 142 Back     alignment and organism information
>gi|157690446|gb|ABO40222.1| 50S ribosomal subunit protein L11 [Candidatus Liberibacter africanus] Length = 142 Back     alignment and organism information
>gi|133872296|gb|ABO40216.1| 50S ribosomal subunit protein L11 [Candidatus Liberibacter americanus] Length = 142 Back     alignment and organism information
>gi|315122749|ref|YP_004063238.1| 50S ribosomal protein L11 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 142 Back     alignment and organism information
>gi|163759402|ref|ZP_02166488.1| 50S ribosomal protein L11 [Hoeflea phototrophica DFL-43] Length = 142 Back     alignment and organism information
>gi|227821743|ref|YP_002825713.1| 50S ribosomal protein L11 [Sinorhizobium fredii NGR234] Length = 142 Back     alignment and organism information
>gi|49475394|ref|YP_033435.1| 50S ribosomal protein L11 [Bartonella henselae str. Houston-1] Length = 142 Back     alignment and organism information
>gi|239832135|ref|ZP_04680464.1| ribosomal protein L11 [Ochrobactrum intermedium LMG 3301] Length = 142 Back     alignment and organism information
>gi|148560091|ref|YP_001259166.1| 50S ribosomal protein L11 [Brucella ovis ATCC 25840] Length = 142 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target142 50S ribosomal protein L11 [Candidatus Liberibacter asia
TIGR01632140 TIGR01632, L11_bact, 50S ribosomal protein L11 3e-58
PRK00140141 PRK00140, rplK, 50S ribosomal protein L11; Validated 1e-56
smart00649132 smart00649, RL11, Ribosomal protein L11/L12 3e-47
COG0080141 COG0080, RplK, Ribosomal protein L11 [Translation, ribo 3e-42
CHL00127140 CHL00127, rpl11, ribosomal protein L11; Validated 2e-35
KOG3257168 KOG3257, KOG3257, KOG3257, Mitochondrial/chloroplast ri 2e-31
PRK14539196 PRK14539, PRK14539, 50S ribosomal protein L11/unknown d 2e-22
PRK01143163 PRK01143, rpl11p, 50S ribosomal protein L11P; Validated 1e-21
PTZ00321 342 PTZ00321, PTZ00321, ribosomal protein L11; Provisional 6e-12
cd00349131 cd00349, Ribosomal_L11, Ribosomal protein L11 5e-46
pfam0029869 pfam00298, Ribosomal_L11, Ribosomal protein L11, RNA bi 9e-22
pfam0394659 pfam03946, Ribosomal_L11_N, Ribosomal protein L11, N-te 6e-19
>gnl|CDD|162455 TIGR01632, L11_bact, 50S ribosomal protein L11 Back     alignment and domain information
>gnl|CDD|178895 PRK00140, rplK, 50S ribosomal protein L11; Validated Back     alignment and domain information
>gnl|CDD|128897 smart00649, RL11, Ribosomal protein L11/L12 Back     alignment and domain information
>gnl|CDD|30429 COG0080, RplK, Ribosomal protein L11 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|177049 CHL00127, rpl11, ribosomal protein L11; Validated Back     alignment and domain information
>gnl|CDD|38467 KOG3257, KOG3257, KOG3257, Mitochondrial/chloroplast ribosomal protein L11 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|184732 PRK14539, PRK14539, 50S ribosomal protein L11/unknown domain fusion protein; Provisional Back     alignment and domain information
>gnl|CDD|179232 PRK01143, rpl11p, 50S ribosomal protein L11P; Validated Back     alignment and domain information
>gnl|CDD|140342 PTZ00321, PTZ00321, ribosomal protein L11; Provisional Back     alignment and domain information
>gnl|CDD|100101 cd00349, Ribosomal_L11, Ribosomal protein L11 Back     alignment and domain information
>gnl|CDD|144037 pfam00298, Ribosomal_L11, Ribosomal protein L11, RNA binding domain Back     alignment and domain information
>gnl|CDD|146529 pfam03946, Ribosomal_L11_N, Ribosomal protein L11, N-terminal domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 142 50S ribosomal protein L11 [Candidatus Liberibacter asia
TIGR01632144 L11_bact ribosomal protein L11; InterPro: IPR006519 Rib 100.0
PRK00140142 rplK 50S ribosomal protein L11; Validated 100.0
CHL00127140 rpl11 ribosomal protein L11; Validated 100.0
COG0080141 RplK Ribosomal protein L11 [Translation, ribosomal stru 100.0
PRK01143163 rpl11p 50S ribosomal protein L11P; Validated 100.0
smart00649132 RL11 Ribosomal protein L11/L12. 100.0
cd00349131 Ribosomal_L11 Ribosomal protein L11. Ribosomal protein 100.0
KOG3257168 consensus 100.0
PTZ00105164 60S ribosomal protein L12; Provisional 100.0
KOG0886167 consensus 99.93
PTZ00321 342 ribosomal protein L11; Provisional 99.89
pfam0029869 Ribosomal_L11 Ribosomal protein L11, RNA binding domain 99.91
pfam0394659 Ribosomal_L11_N Ribosomal protein L11, N-terminal domai 99.88
>TIGR01632 L11_bact ribosomal protein L11; InterPro: IPR006519 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK00140 rplK 50S ribosomal protein L11; Validated Back     alignment and domain information
>CHL00127 rpl11 ribosomal protein L11; Validated Back     alignment and domain information
>COG0080 RplK Ribosomal protein L11 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK01143 rpl11p 50S ribosomal protein L11P; Validated Back     alignment and domain information
>smart00649 RL11 Ribosomal protein L11/L12 Back     alignment and domain information
>cd00349 Ribosomal_L11 Ribosomal protein L11 Back     alignment and domain information
>KOG3257 consensus Back     alignment and domain information
>PTZ00105 60S ribosomal protein L12; Provisional Back     alignment and domain information
>KOG0886 consensus Back     alignment and domain information
>PTZ00321 ribosomal protein L11; Provisional Back     alignment and domain information
>pfam00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain Back     alignment and domain information
>pfam03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target142 50S ribosomal protein L11 [Candidatus Liberibacter asia
1mj1_L141 Crystal Structure Of The Ribosome At 5.5 A Resoluti 1e-47
1mms_A140 Crystal Structure Of The Ribosomal Protein L11-Rna 7e-47
1eg0_K140 Fitting Of Components With Known Structure Into An 9e-47
3fin_L138 T. Thermophilus 70s Ribosome In Complex With Mrna, 2e-46
2hgj_L147 Crystal Structure Of The 70s Thermus Thermophilus R 5e-46
1jqm_A139 Fitting Of L11 Protein And Elongation Factor G (Ef- 5e-46
3cjq_B146 Ribosomal Protein L11 Methyltransferase (Prma) In C 6e-46
3cjr_B147 Ribosomal Protein L11 Methyltransferase (Prma) In C 1e-45
1r2w_A141 Coordinates Of L11 With 58nts Of 23s Rrna Fitted In 1e-45
1vs6_I142 Crystal Structure Of The Bacterial Ribosome From Es 3e-45
487d_L133 Seven Ribosomal Proteins Fitted To A Cryo-Electron 1e-44
1p85_G141 Real Space Refined Coordinates Of The 50s Subunit F 2e-44
2gya_G139 Structure Of The 50s Subunit Of A Pre-Translocation 5e-43
1pnu_G143 Crystal Structure Of A Streptomycin Dependent Ribos 5e-43
1nkw_G144 Crystal Structure Of The Large Ribosomal Subunit Fr 6e-43
3bbo_K224 Homology Model For The Spinach Chloroplast 50s Subu 2e-42
3egv_B146 Ribosomal Protein L11 Methyltransferase (Prma) In C 2e-40
2ftc_G145 Structural Model For The Large Subunit Of The Mamma 1e-33
1s72_I162 Refined Crystal Structure Of The Haloarcula Marismo 4e-33
2otj_I161 13-Deoxytedanolide Bound To The Large Subunit Of Ha 4e-33
2zkr_i165 Structure Of A Mammalian Ribosomal 60s Subunit With 1e-26
3izr_J166 Localization Of The Large Subunit Ribosomal Protein 1e-23
3izs_J165 Localization Of The Large Subunit Ribosomal Protein 5e-22
3jyw_K138 Structure Of The 60s Proteins For Eukaryotic Riboso 8e-22
1s1i_K131 Structure Of The Ribosomal 80s-Eef2-Sordarin Comple 8e-21
1hc8_A76 Crystal Structure Of A Conserved Ribosomal Protein- 5e-20
1y39_A76 Co-Evolution Of Protein And Rna Structures Within A 9e-20
1aci_A76 L11 Ribosomal Protein Rna Binding Domain, Nmr, 20 S 4e-19
1qa6_A67 Crystal Structure Of A Conserved Ribosomal Protein- 2e-16
3g4s_I70 Co-Crystal Structure Of Tiamulin Bound To The Large 2e-13
2bcw_A65 Coordinates Of The N-Terminal Domain Of Ribosomal P 4e-19
3cjs_B72 Minimal Recognition Complex Between Prma And Riboso 1e-17
3cju_B77 Ribosomal Protein L11 Methyltransferase (Prma) In C 9e-15
1wib_A92 Solution Structure Of The N-Terminal Domain From Mo 2e-10
>gi|24987762|pdb|1MJ1|L Chain L, Fitting The Ternary Complex Of Ef-TuTRNAGTP AND RIBOSOMAL Proteins Into A 13 A Cryo-Em Map Of The Coli 70s Ribosome Length = 141 Back     alignment and structure
 Score =  192 bits (489), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 73/142 (51%), Positives = 99/142 (69%), Gaps = 1/142 (0%)

Query: 1   MAKVVSRIVKLQIESGSAKPSPPVGPAIGQAGIPIMAFCKAFNAATEGMEKGIPIPTTVT 60
           MAK V+  +KLQ+ +G A P+PPVGPA+GQ G+ IM FCK FNA T   + G+ +P  +T
Sbjct: 1   MAKKVAAQIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETAD-KAGMILPVVIT 59

Query: 61  CYKDKSFTFTMSQPPVSFFLKKEVGIKSGSKLPGKESCGSITRENIRKIAQLKMQDMGAI 120
            Y+DKSFTF +  PP SF LKK  GI+ GS  P ++  G +TR+ I +IA+ KM D+ A 
Sbjct: 60  VYEDKSFTFIIKTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNAN 119

Query: 121 DIEGAMRMVEGSACSMGISVVD 142
            +E AM+++EG+A SMGI VVD
Sbjct: 120 SLEAAMKIIEGTAKSMGIEVVD 141


>gi|7767082|pdb|1MMS|A Chain A, Crystal Structure Of The Ribosomal Protein L11-Rna Complex Length = 140 Back     alignment and structure
>gi|224510788|pdb|3FIN|L Chain L, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas And Ef-Tu.Gdp.Kirromycin Ternary Complex, Fitted To A 6.4 A Cryo-Em Map. This File Contains The 50s Subunit Length = 138 Back     alignment and structure
gi|119389742|pdb|2HGJ|L Chain L, Crystal Structure Of The 70s Thermus Thermophilus Ribosome Showing How The 16s 3'-End Mimicks Mrna E And P Codons. This Entry 2hgj Contains 50s Ribosomal Subunit. The 30s Ribosomal Subunit Can Be Found In Pdb Entry 2hgi. Length = 147 Back     alignment and structure
>gi|15988475|pdb|1JQM|A Chain A, Fitting Of L11 Protein And Elongation Factor G (Ef-G) In The Cryo-Em Map Of E. Coli 70s Ribosome Bound With Ef-G, Gdp And Fusidic Acid Length = 139 Back     alignment and structure
>gi|188596411|pdb|3CJQ|B Chain B, Ribosomal Protein L11 Methyltransferase (Prma) In Complex With Dimethylated Ribosomal Protein L11 In Space Group P212121 Length = 146 Back     alignment and structure
>gi|188596417|pdb|3CJR|B Chain B, Ribosomal Protein L11 Methyltransferase (Prma) In Complex With Ribosomal Protein L11 (K39a) And Inhibitor Sinefungin Length = 147 Back     alignment and structure
>gi|38492991|pdb|1R2W|A Chain A, Coordinates Of L11 With 58nts Of 23s Rrna Fitted Into The Cryo-Em Map Of The 70s Ribosome Length = 141 Back     alignment and structure
gi|116666600|pdb|1VS6|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. Length = 142 Back     alignment and structure
>gi|7767188|pdb|487D|L Chain L, Seven Ribosomal Proteins Fitted To A Cryo-Electron Microscopic Map Of The Large 50s Subunit At 7.5 Angstroms Resolution Length = 133 Back     alignment and structure
gi|33357908|pdb|1P85|G Chain G, Real Space Refined Coordinates Of The 50s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 141 Back     alignment and structure
>gi|116667441|pdb|2GYA|G Chain G, Structure Of The 50s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 139 Back     alignment and structure
>gi|34811560|pdb|1PNU|G Chain G, Crystal Structure Of A Streptomycin Dependent Ribosome From Escherichia Coli, 50s Subunit Of 70s Ribosome. This File, 1pnu, Contains Only Molecules Of The 50s Ribosomal Subunit. The 30s Subunit, Mrna, P-Site Trna, And A-Site Trna Are In The Pdb File 1pns. Length = 143 Back     alignment and structure
gi|28948926|pdb|1NKW|G Chain G, Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans Length = 144 Back     alignment and structure
gi|189096133|pdb|3BBO|K Chain K, Homology Model For The Spinach Chloroplast 50s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome Length = 224 Back     alignment and structure
>gi|206582141|pdb|3EGV|B Chain B, Ribosomal Protein L11 Methyltransferase (Prma) In Complex With Trimethylated Ribosomal Protein L11 Length = 146 Back     alignment and structure
>gi|99032313|pdb|2FTC|G Chain G, Structural Model For The Large Subunit Of The Mammalian Mitochondrial Ribosome Length = 145 Back     alignment and structure
gi|50513478|pdb|1S72|I Chain I, Refined Crystal Structure Of The Haloarcula Marismortui Large Ribosomal Subunit At 2.4 Angstrom Resolution Length = 162 Back     alignment and structure
>gi|145580201|pdb|2OTJ|I Chain I, 13-Deoxytedanolide Bound To The Large Subunit Of Haloarcula Marismortui Length = 161 Back     alignment and structure
gi|187609307|pdb|2ZKR|II Chain i, Structure Of A Mammalian Ribosomal 60s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 165 Back     alignment and structure
>gi|315113288|pdb|3IZR|J Chain J, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 166 Back     alignment and structure
>gi|315113309|pdb|3IZS|J Chain J, Localization Of The Large Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 165 Back     alignment and structure
>gi|281500841|pdb|3JYW|K Chain K, Structure Of The 60s Proteins For Eukaryotic Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 138 Back     alignment and structure
>gi|49258849|pdb|1S1I|K Chain K, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1i, Contains 60s Subunit. The 40s Ribosomal Subunit Is In File 1s1h Length = 131 Back     alignment and structure
>gi|21465588|pdb|1HC8|A Chain A, Crystal Structure Of A Conserved Ribosomal Protein-Rna Complex Length = 76 Back     alignment and structure
>gi|62738581|pdb|1Y39|A Chain A, Co-Evolution Of Protein And Rna Structures Within A Highly Conserved Ribosomal Domain Length = 76 Back     alignment and structure
>gi|157829799|pdb|1ACI|A Chain A, L11 Ribosomal Protein Rna Binding Domain, Nmr, 20 Structures Length = 76 Back     alignment and structure
>gi|5107627|pdb|1QA6|A Chain A, Crystal Structure Of A Conserved Ribosomal Protein-Rna Complex Length = 67 Back     alignment and structure
>gi|228312150|pdb|3G4S|I Chain I, Co-Crystal Structure Of Tiamulin Bound To The Large Ribosomal Subunit Length = 70 Back     alignment and structure
>gi|85544272|pdb|2BCW|A Chain A, Coordinates Of The N-Terminal Domain Of Ribosomal Protein L11,C-Terminal Domain Of Ribosomal Protein L7L12 AND A Portion Of The G' Domain Of Elongation Factor G, As Fitted Into Cryo-Em Map Of An Escherichia Coli 70sEf- GGdpFusidic Acid Complex Length = 65 Back     alignment and structure
>gi|188596419|pdb|3CJS|B Chain B, Minimal Recognition Complex Between Prma And Ribosomal Protein L11 Length = 72 Back     alignment and structure
>gi|159163379|pdb|1WIB|A Chain A, Solution Structure Of The N-Terminal Domain From Mouse Hypothetical Protein Bab22488 Length = 92 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target142 50S ribosomal protein L11 [Candidatus Liberibacter asia
3ofq_I141 50S ribosomal protein L11; protein biosynthesis, riboso 1e-42
1mms_A140 Protein (ribosomal protein L11); RNA-protein complex, R 1e-40
3bbo_K224 Ribosomal protein L11; large ribosomal subunit, spinach 8e-40
3i1n_I142 50S ribosomal protein L11; ribosome structure, protein- 6e-39
2ftc_G145 L11MT, MRP-L11, 39S ribosomal protein L11, mitochondria 5e-37
1vq8_I162 50S ribosomal protein L11P; ribosome 50S, protein-prote 2e-36
3egv_B146 50S ribosomal protein L11, ribosomal protein L11 methyl 3e-36
2zkr_i165 60S ribosomal protein L12; protein-RNA complex, 60S rib 2e-32
3cjs_B72 50S ribosomal protein L11, ribosomal protein L11 methyl 1e-21
1wib_A92 60S ribosomal protein L12; N-terminal domain, structura 3e-16
1hc8_A76 Ribosomal protein L11; ribosome, ribosomal RNA, tertiar 1e-20
1qa6_A67 Ribosomal protein L11; ribosomal RNA, tertiary structur 1e-19
>3ofq_I 50S ribosomal protein L11; protein biosynthesis, ribosomes, RNA, tRNA, transfer, antibi EXIT, peptidyl, ribosomal subunit, large; 3.10A {Escherichia coli} PDB: 1p85_G 1p86_G 2awb_I 2aw4_I 2i2v_I 2j28_I 2i2t_I* 2qao_I* 2qba_I* 2qbc_I* 2qbe_I 2qbg_I 2qbi_I* 2qbk_I* 2qov_I 2qox_I 2qoz_I* 2qp1_I* 2rdo_I 2vhm_I ... Length = 141 Back     alignment and structure
 Score =  167 bits (423), Expect = 1e-42
 Identities = 77/141 (54%), Positives = 95/141 (67%)

Query: 2   AKVVSRIVKLQIESGSAKPSPPVGPAIGQAGIPIMAFCKAFNAATEGMEKGIPIPTTVTC 61
           AK V   VKLQ+ +G A PSPPVGPA+GQ G+ IM FCKAFNA T+ +EKG+PIP  +T 
Sbjct: 1   AKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVITV 60

Query: 62  YKDKSFTFTMSQPPVSFFLKKEVGIKSGSKLPGKESCGSITRENIRKIAQLKMQDMGAID 121
           Y D+SFTF    PP +  LKK  GIKSGS  P K+  G I+R  +++IAQ K  DM   D
Sbjct: 61  YADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRAQLQEIAQTKAADMTGAD 120

Query: 122 IEGAMRMVEGSACSMGISVVD 142
           IE   R +EG+A SMG+ V D
Sbjct: 121 IEAMTRSIEGTARSMGLVVED 141


>1mms_A Protein (ribosomal protein L11); RNA-protein complex, RNA, ribosome, translocation, thiostrepton; 2.57A {Thermotoga maritima} SCOP: a.4.7.1 d.47.1.1 PDB: 1mvr_L 1oln_A* 1giy_L 1mj1_L* 1ml5_l* 1yl3_L 2b66_K 2b9n_K 2b9p_K 2jq7_A* 2k3f_A 1eg0_K 1jqm_A 1jqs_A 1jqt_A 1r2w_A 1r2x_A 487d_L 1pn8_L 1pn7_L Length = 140 Back     alignment and structure
>3bbo_K Ribosomal protein L11; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} SCOP: i.1.1.1 Length = 224 Back     alignment and structure
>3i1n_I 50S ribosomal protein L11; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1vs8_I 3e1b_5 3e1d_5 1vs6_I 3i1p_I 3i1r_I 3i1t_I 3i20_I 3i22_I 2qam_I* 1p85_G 1p86_G 2awb_I 2aw4_I 2i2v_I 2j28_I 2i2t_I* 2qao_I* 2qba_I* 2qbc_I* ... Length = 142 Back     alignment and structure
>2ftc_G L11MT, MRP-L11, 39S ribosomal protein L11, mitochondrial; mitochondrial ribosome, large ribosomal subunit, ribosomal RNA; 12.10A {Bos taurus} PDB: 3iy9_G Length = 145 Back     alignment and structure
>1vq8_I 50S ribosomal protein L11P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: a.4.7.1 PDB: 1vq4_I* 1vq5_I* 1vq6_I* 1vq7_I* 1s72_I* 1vq9_I* 1vqk_I* 1vql_I* 1vqm_I* 1vqn_I* 1vqo_I* 1vqp_I* 1yhq_I* 1yi2_I* 1yij_I* 1yit_I* 1yj9_I* 1yjn_I* 1yjw_I* 2otl_I* ... Length = 162 Back     alignment and structure
>3egv_B 50S ribosomal protein L11, ribosomal protein L11 methyltransferase; post-translational modification, multiple methyltransferase, cytoplasm; HET: SAH 4MM; 1.75A {Thermus thermophilus} SCOP: d.47.1.1 PDB: 2e34_A 2e35_A 2e36_A 2h8w_A 2hgj_L 2hgq_L 2hgu_L 2j01_K 2j03_K 2jl6_K 2jl8_K 2klm_A 2nxn_B 2wh2_K 2wh4_K 2wrj_K 2wrl_K 3cjt_B* 3f1f_K 3f1h_K ... Length = 146 Back     alignment and structure
>2zkr_i 60S ribosomal protein L12; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} PDB: 1s1i_K Length = 165 Back     alignment and structure
>3cjs_B 50S ribosomal protein L11, ribosomal protein L11 methyltransferase; S-adenosyl-L-methionine dependent methyltransferase; 1.37A {Thermus thermophilus} SCOP: d.47.1.1 PDB: 3cju_B* 2bcw_A Length = 72 Back     alignment and structure
>1wib_A 60S ribosomal protein L12; N-terminal domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, ribosome; NMR {Mus musculus} SCOP: d.47.1.1 Length = 92 Back     alignment and structure
>1hc8_A Ribosomal protein L11; ribosome, ribosomal RNA, tertiary structure, RNA-protein; HET: GTP; 2.8A {Bacillus stearothermophilus} SCOP: a.4.7.1 PDB: 1y39_A* 1aci_A 1fow_A 1fox_A 1foy_A 2fow_A Length = 76 Back     alignment and structure
>1qa6_A Ribosomal protein L11; ribosomal RNA, tertiary structur,E RNA-protein interaction, minor groove binding, antibiotic binding; 2.80A {Geobacillus stearothermophilus} SCOP: a.4.7.1 PDB: 1c04_C Length = 67 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target142 50S ribosomal protein L11 [Candidatus Liberibacter asia
3bbo_K224 Ribosomal protein L11; large ribosomal subunit, spinach 100.0
1mms_A140 Protein (ribosomal protein L11); RNA-protein complex, R 100.0
2ftc_G145 L11MT, MRP-L11, 39S ribosomal protein L11, mitochondria 100.0
3egv_B146 50S ribosomal protein L11, ribosomal protein L11 methyl 100.0
1vq8_I162 50S ribosomal protein L11P; ribosome 50S, protein-prote 100.0
3ofq_I141 50S ribosomal protein L11; protein biosynthesis, riboso 100.0
2zkr_i165 60S ribosomal protein L12; protein-RNA complex, 60S rib 100.0
3cjs_B72 50S ribosomal protein L11, ribosomal protein L11 methyl 99.96
1wib_A92 60S ribosomal protein L12; N-terminal domain, structura 99.95
1hc8_A76 Ribosomal protein L11; ribosome, ribosomal RNA, tertiar 99.94
1qa6_A67 Ribosomal protein L11; ribosomal RNA, tertiary structur 99.89
>3bbo_K Ribosomal protein L11; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} SCOP: i.1.1.1 Back     alignment and structure
Probab=100.00  E-value=0  Score=365.61  Aligned_cols=140  Identities=46%  Similarity=0.795  Sum_probs=138.0

Q ss_pred             CCCCEEEEEEEEEECCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCEEEEEECCCCHHHHH
Q ss_conf             98423689999994455668970446866429998999999999977543797513899983895299998597489999
Q gi|254780147|r    1 MAKVVSRIVKLQIESGSAKPSPPVGPAIGQAGIPIMAFCKAFNAATEGMEKGIPIPTTVTCYKDKSFTFTMSQPPVSFFL   80 (142)
Q Consensus         1 M~k~v~~~ikl~v~aG~A~p~PplGp~LG~~Gini~~f~k~fN~~T~~~~~g~~v~V~i~v~~dksf~~~i~~P~~s~li   80 (142)
                      |+|+++++|||+|+||+|+|+|||||+|||+|||+|+||+|||++|++|+ |++|||+|++|+||+|+|++++||+||||
T Consensus        72 ~aKkvv~~IKL~V~AGkA~PaPPlGPaLGp~GINi~~Fck~fN~~Tk~~k-G~~VpV~ItV~~Dksf~f~iktPptS~Li  150 (224)
T 3bbo_K           72 KAKKVIGVIKLALEAGKATPAPPVGPALGSKGVNIMAFCKDYNARTADKP-GFVIPVEITVFDDKSFTFILKTPPASVLL  150 (224)
T ss_dssp             CCCCCSSEEEECCBTTBCCCSTTTTTTTTTTSSCTTSSHHHHHHHGGGSC-SSBCCEEEEECSSSCEEEEECCCCTTHHH
T ss_pred             CCCEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCC-CCCCCEEEEEECCCCEEEEECCCCHHHHH
T ss_conf             87347899999985474168998751013469899999999999973458-97443699997686279998699678998


Q ss_pred             HHHCCCCCCCCCCCCCEEEEECHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHEEECCEEEE
Q ss_conf             9633766678899963010125999999999988540678789999997743021452893
Q gi|254780147|r   81 KKEVGIKSGSKLPGKESCGSITRENIRKIAQLKMQDMGAIDIEGAMRMVEGSACSMGISVV  141 (142)
Q Consensus        81 kk~~g~~kgs~~p~~~~~g~it~~~i~eIAk~K~~d~~~~~l~~~vk~VlGTa~SmGi~V~  141 (142)
                      ++++|+++||++|+++++|+||++|+||||+.|++|+++.+|+++||+|+|||+||||+||
T Consensus       151 kkaagi~kGS~~p~~~~vG~ITl~qv~eIAk~K~~dlna~~L~aavK~VlGTArSMGI~Vd  211 (224)
T 3bbo_K          151 LKASGAEKGSKDPQMEKVGKITIDQLRGIATEKLPDLNCTTIESAMRIIAGTAANMGIDID  211 (224)
T ss_dssp             HHHHTCSSCCSSTTTSCCEEECHHHHHHHHHHTCTTSCCSSHHHHHHHHHHHHTTTTEEEC
T ss_pred             HHHCCCCCCCCCCCCCEEEEEEHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHEECEEEEE
T ss_conf             8643776678899861645763999999999987763652599999996822625868997



>1mms_A Protein (ribosomal protein L11); RNA-protein complex, RNA, ribosome, translocation, thiostrepton; 2.57A {Thermotoga maritima} SCOP: a.4.7.1 d.47.1.1 PDB: 1mvr_L 1oln_A* 1giy_L 1mj1_L* 1ml5_l* 1yl3_L 2b66_K 2b9n_K 2b9p_K 2jq7_A* 2k3f_A 1eg0_K 1jqm_A 1jqs_A 1jqt_A 1r2w_A 1r2x_A 487d_L 1pn8_L 1pn7_L Back     alignment and structure
>2ftc_G L11MT, MRP-L11, 39S ribosomal protein L11, mitochondrial; mitochondrial ribosome, large ribosomal subunit, ribosomal RNA; 12.10A {Bos taurus} PDB: 3iy9_G Back     alignment and structure
>3egv_B 50S ribosomal protein L11, ribosomal protein L11 methyltransferase; post-translational modification, multiple methyltransferase, cytoplasm; HET: SAH 4MM; 1.75A {Thermus thermophilus} SCOP: d.47.1.1 PDB: 2e34_A 2e35_A 2e36_A 2h8w_A 2hgj_L 2hgq_L 2hgu_L 2j01_K 2j03_K 2jl6_K 2jl8_K 2klm_A 2nxn_B 2wh2_K 2wh4_K 2wrj_K 2wrl_K 2x9s_K 2x9u_K 3cjt_B* ... Back     alignment and structure
>1vq8_I 50S ribosomal protein L11P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: a.4.7.1 PDB: 1vq4_I* 1vq5_I* 1vq6_I* 1vq7_I* 1s72_I* 1vq9_I* 1vqk_I* 1vql_I* 1vqm_I* 1vqn_I* 1vqo_I* 1vqp_I* 1yhq_I* 1yi2_I* 1yij_I* 1yit_I* 1yj9_I* 1yjn_I* 1yjw_I* 2otl_I* ... Back     alignment and structure
>3ofq_I 50S ribosomal protein L11; protein biosynthesis, ribosomes, RNA, tRNA, transfer, antibi EXIT, peptidyl, ribosomal subunit, large; 3.10A {Escherichia coli} PDB: 1p85_G 1p86_G 2awb_I 2aw4_I 2i2v_I 2j28_I 2i2t_I* 2qao_I* 2qba_I* 2qbc_I* 2qbe_I 2qbg_I 2qbi_I* 2qbk_I* 2qov_I 2qox_I 2qoz_I* 2qp1_I* 2rdo_I 2vhm_I ... Back     alignment and structure
>2zkr_i 60S ribosomal protein L12; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} PDB: 3jyw_K 1s1i_K Back     alignment and structure
>3cjs_B 50S ribosomal protein L11, ribosomal protein L11 methyltransferase; S-adenosyl-L-methionine dependent methyltransferase; 1.37A {Thermus thermophilus} SCOP: d.47.1.1 PDB: 3cju_B* 2bcw_A Back     alignment and structure
>1wib_A 60S ribosomal protein L12; N-terminal domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, ribosome; NMR {Mus musculus} SCOP: d.47.1.1 Back     alignment and structure
>1hc8_A Ribosomal protein L11; ribosome, ribosomal RNA, tertiary structure, RNA-protein; HET: GTP; 2.8A {Bacillus stearothermophilus} SCOP: a.4.7.1 PDB: 1y39_A* 1aci_A 1fow_A 1fox_A 1foy_A 2fow_A Back     alignment and structure
>1qa6_A Ribosomal protein L11; ribosomal RNA, tertiary structur,E RNA-protein interaction, minor groove binding, antibiotic binding; 2.80A {Geobacillus stearothermophilus} SCOP: a.4.7.1 PDB: 1c04_C Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 142 50S ribosomal protein L11 [Candidatus Liberibacter asia
d2gycg271 d.47.1.1 (G:2-72) Ribosomal protein L11, N-terminal dom 2e-22
d3cjsb170 d.47.1.1 (B:1-70) Ribosomal protein L11, N-terminal dom 5e-20
d1mmsa263 d.47.1.1 (A:8-70) Ribosomal protein L11, N-terminal dom 6e-20
d1wiba_92 d.47.1.1 (A:) 60S ribosomal protein L12 {Mouse (Mus mus 2e-16
d1hc8a_74 a.4.7.1 (A:) Ribosomal protein L11, C-terminal domain { 5e-22
d1mmsa170 a.4.7.1 (A:71-140) Ribosomal protein L11, C-terminal do 5e-20
d2gycg168 a.4.7.1 (G:73-140) Ribosomal protein L11, C-terminal do 6e-20
d3cjrb167 a.4.7.1 (B:71-137) Ribosomal protein L11, C-terminal do 2e-19
d1vqoi170 a.4.7.1 (I:71-140) Ribosomal protein L11, C-terminal do 2e-19
>d2gycg2 d.47.1.1 (G:2-72) Ribosomal protein L11, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 71 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ribosomal L11/L12e N-terminal domain
superfamily: Ribosomal L11/L12e N-terminal domain
family: Ribosomal L11/L12e N-terminal domain
domain: Ribosomal protein L11, N-terminal domain
species: Escherichia coli [TaxId: 562]
 Score = 98.6 bits (246), Expect = 2e-22
 Identities = 42/69 (60%), Positives = 51/69 (73%)

Query: 3  KVVSRIVKLQIESGSAKPSPPVGPAIGQAGIPIMAFCKAFNAATEGMEKGIPIPTTVTCY 62
          K V   VKLQ+ +G A PSPPVGPA+GQ G+ IM FCKAFNA T+ +EKG+PIP  +T Y
Sbjct: 1  KKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVITVY 60

Query: 63 KDKSFTFTM 71
           D+SFTF  
Sbjct: 61 ADRSFTFVT 69


>d3cjsb1 d.47.1.1 (B:1-70) Ribosomal protein L11, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 70 Back     information, alignment and structure
>d1mmsa2 d.47.1.1 (A:8-70) Ribosomal protein L11, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 63 Back     information, alignment and structure
>d1wiba_ d.47.1.1 (A:) 60S ribosomal protein L12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 92 Back     information, alignment and structure
>d1hc8a_ a.4.7.1 (A:) Ribosomal protein L11, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 74 Back     information, alignment and structure
>d1mmsa1 a.4.7.1 (A:71-140) Ribosomal protein L11, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 70 Back     information, alignment and structure
>d2gycg1 a.4.7.1 (G:73-140) Ribosomal protein L11, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 68 Back     information, alignment and structure
>d3cjrb1 a.4.7.1 (B:71-137) Ribosomal protein L11, C-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 67 Back     information, alignment and structure
>d1vqoi1 a.4.7.1 (I:71-140) Ribosomal protein L11, C-terminal domain {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 70 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target142 50S ribosomal protein L11 [Candidatus Liberibacter asia
d3cjsb170 Ribosomal protein L11, N-terminal domain {Thermus therm 99.95
d1wiba_92 60S ribosomal protein L12 {Mouse (Mus musculus) [TaxId: 99.95
d2gycg271 Ribosomal protein L11, N-terminal domain {Escherichia c 99.93
d1mmsa263 Ribosomal protein L11, N-terminal domain {Thermotoga ma 99.93
d1hc8a_74 Ribosomal protein L11, C-terminal domain {Bacillus stea 99.93
d1mmsa170 Ribosomal protein L11, C-terminal domain {Thermotoga ma 99.92
d1vqoi170 Ribosomal protein L11, C-terminal domain {Archaeon Halo 99.91
d1xbpg172 Ribosomal protein L11, C-terminal domain {Deinococcus r 99.91
d2gycg168 Ribosomal protein L11, C-terminal domain {Escherichia c 99.87
d3cjrb167 Ribosomal protein L11, C-terminal domain {Thermus therm 99.86
>d3cjsb1 d.47.1.1 (B:1-70) Ribosomal protein L11, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ribosomal L11/L12e N-terminal domain
superfamily: Ribosomal L11/L12e N-terminal domain
family: Ribosomal L11/L12e N-terminal domain
domain: Ribosomal protein L11, N-terminal domain
species: Thermus thermophilus [TaxId: 274]
Probab=99.95  E-value=1.4e-28  Score=186.80  Aligned_cols=69  Identities=54%  Similarity=0.870  Sum_probs=65.7

Q ss_pred             CCEEEEEEEEEECCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCEEEEEEC
Q ss_conf             4236899999944556689704468664299989999999999775437975138999838952999985
Q gi|254780147|r    3 KVVSRIVKLQIESGSAKPSPPVGPAIGQAGIPIMAFCKAFNAATEGMEKGIPIPTTVTCYKDKSFTFTMS   72 (142)
Q Consensus         3 k~v~~~ikl~v~aG~A~p~PplGp~LG~~Gini~~f~k~fN~~T~~~~~g~~v~V~i~v~~dksf~~~i~   72 (142)
                      |++.+++||+++||+|+|+|||||+|||+|||||+||++||++|++++ |.+|||+|++|.||||+|+++
T Consensus         2 Kkv~~~ikl~v~aG~A~P~PPvGpaLG~~GiNi~~Fck~fN~~T~~~~-g~~vpv~Itv~~Drsf~f~iK   70 (70)
T d3cjsb1           2 KKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMG-DAIVPVEITIYADRSFTFVTK   70 (70)
T ss_dssp             CCEEEEEEEEEETTCCCSSTTHHHHHHTTTCCHHHHHHHHHHHHGGGC-SCEEEEEEEEETTSCEEEEEC
T ss_pred             CCEEEEEEEEEECCCCCCCCCCCCHHHHCCCCHHHHHHHHHHHHHHCC-CCCEEEEEEEECCCCEEEEEC
T ss_conf             441358999962577789999764254528679999999989887458-995615999967996899959



>d1wiba_ d.47.1.1 (A:) 60S ribosomal protein L12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gycg2 d.47.1.1 (G:2-72) Ribosomal protein L11, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mmsa2 d.47.1.1 (A:8-70) Ribosomal protein L11, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hc8a_ a.4.7.1 (A:) Ribosomal protein L11, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mmsa1 a.4.7.1 (A:71-140) Ribosomal protein L11, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vqoi1 a.4.7.1 (I:71-140) Ribosomal protein L11, C-terminal domain {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1xbpg1 a.4.7.1 (G:72-143) Ribosomal protein L11, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2gycg1 a.4.7.1 (G:73-140) Ribosomal protein L11, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3cjrb1 a.4.7.1 (B:71-137) Ribosomal protein L11, C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 142 50S ribosomal protein L11 [Candidatus Liberibacter
3egv_B_146 (B:) 50S ribosomal protein L11, ribosomal protein 6e-34
1vq8_I_162 (I:) 50S ribosomal protein L11P; ribosome 50S, pro 9e-34
2zkr_i_165 (i:) 60S ribosomal protein L12; protein-RNA comple 3e-30
3i1n_I_1-8484 (I:1-84) 50S ribosomal protein L11; ribosome struc 4e-29
2ftc_G_1-8484 (G:1-84) L11MT, MRP-L11, 39S ribosomal protein L11 5e-28
1mms_A_1-7272 (A:1-72) Protein (ribosomal protein L11); RNA-prot 4e-22
3cjs_B_72 (B:) 50S ribosomal protein L11, ribosomal protein 1e-21
3bbo_K_1-144144 (K:1-144) Ribosomal protein L11; large ribosomal s 1e-20
1wib_A_92 (A:) 60S ribosomal protein L12; N-terminal domain, 3e-17
1hc8_A_76 (A:) Ribosomal protein L11; ribosome, ribosomal RN 2e-21
1mms_A_73-14068 (A:73-140) Protein (ribosomal protein L11); RNA-pr 1e-18
1qa6_A_67 (A:) Ribosomal protein L11; ribosomal RNA, tertiar 2e-18
3bbo_K_145-22480 (K:145-224) Ribosomal protein L11; large ribosomal 4e-18
3i1n_I_85-14258 (I:85-142) 50S ribosomal protein L11; ribosome str 2e-17
2ftc_G_85-14561 (G:85-145) L11MT, MRP-L11, 39S ribosomal protein L 5e-14
>3egv_B (B:) 50S ribosomal protein L11, ribosomal protein L11 methyltransferase; post-translational modification, multiple methyltransferase, cytoplasm; HET: SAH 4MM; 1.75A {Thermus thermophilus}Length = 146 Back     alignment and structure
 Score =  137 bits (346), Expect = 6e-34
 Identities = 68/139 (48%), Positives = 91/139 (65%), Gaps = 1/139 (0%)

Query: 3   KVVSRIVKLQIESGSAKPSPPVGPAIGQAGIPIMAFCKAFNAATEGMEKGIPIPTTVTCY 62
           K V  +VKLQ+ +G+A P+PPVGPA+GQ G  IM F KAFNAAT  M     +P  +T Y
Sbjct: 1   KKVVAVVKLQLPAGAATPAPPVGPALGQHGANIMEFVKAFNAATANM-GDAIVPVEITIY 59

Query: 63  KDKSFTFTMSQPPVSFFLKKEVGIKSGSKLPGKESCGSITRENIRKIAQLKMQDMGAIDI 122
            D+SFTF    PP S+ ++K  G++ G+  PG+E  G IT E + +IA+ KM D+   D+
Sbjct: 60  ADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDL 119

Query: 123 EGAMRMVEGSACSMGISVV 141
           E A RM+ GSA SMG+ VV
Sbjct: 120 EAAARMIAGSARSMGVEVV 138


>1vq8_I (I:) 50S ribosomal protein L11P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui}Length = 162 Back     alignment and structure
>2zkr_i (i:) 60S ribosomal protein L12; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} PDB: 1s1i_KLength = 165 Back     alignment and structure
>3i1n_I (I:1-84) 50S ribosomal protein L11; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1vs8_I 3e1b_5 3e1d_5 1vs6_I 3i1p_I 3i1r_I 3i1t_I 3i20_I 3i22_I 2qam_I* 1p85_G 1p86_G 2awb_I 2aw4_I 2i2v_I 2j28_I 2i2t_I* 2qao_I* 2qba_I* 2qbc_I* ...Length = 84 Back     alignment and structure
>2ftc_G (G:1-84) L11MT, MRP-L11, 39S ribosomal protein L11, mitochondrial; mitochondrial ribosome, large ribosomal subunit, ribosomal RNA; 12.10A {Bos taurus} PDB: 3iy9_GLength = 84 Back     alignment and structure
>1mms_A (A:1-72) Protein (ribosomal protein L11); RNA-protein complex, RNA, ribosome, translocation, thiostrepton; 2.57A {Thermotoga maritima}Length = 72 Back     alignment and structure
>3cjs_B (B:) 50S ribosomal protein L11, ribosomal protein L11 methyltransferase; S-adenosyl-L-methionine dependent methyltransferase; 1.37A {Thermus thermophilus}Length = 72 Back     alignment and structure
>3bbo_K (K:1-144) Ribosomal protein L11; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea}Length = 144 Back     alignment and structure
>1wib_A (A:) 60S ribosomal protein L12; N-terminal domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, ribosome; NMR {Mus musculus}Length = 92 Back     alignment and structure
>1hc8_A (A:) Ribosomal protein L11; ribosome, ribosomal RNA, tertiary structure, RNA-protein; HET: GTP; 2.8A {Bacillus stearothermophilus}Length = 76 Back     alignment and structure
>1mms_A (A:73-140) Protein (ribosomal protein L11); RNA-protein complex, RNA, ribosome, translocation, thiostrepton; 2.57A {Thermotoga maritima}Length = 68 Back     alignment and structure
>1qa6_A (A:) Ribosomal protein L11; ribosomal RNA, tertiary structur,E RNA-protein interaction, minor groove binding, antibiotic binding; 2.80A {Geobacillus stearothermophilus}Length = 67 Back     alignment and structure
>3bbo_K (K:145-224) Ribosomal protein L11; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea}Length = 80 Back     alignment and structure
>3i1n_I (I:85-142) 50S ribosomal protein L11; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1vs8_I 3e1b_5 3e1d_5 1vs6_I 3i1p_I 3i1r_I 3i1t_I 3i20_I 3i22_I 2qam_I* 1p85_G 1p86_G 2awb_I 2aw4_I 2i2v_I 2j28_I 2i2t_I* 2qao_I* 2qba_I* 2qbc_I* ...Length = 58 Back     alignment and structure
>2ftc_G (G:85-145) L11MT, MRP-L11, 39S ribosomal protein L11, mitochondrial; mitochondrial ribosome, large ribosomal subunit, ribosomal RNA; 12.10A {Bos taurus} PDB: 3iy9_GLength = 61 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target142 50S ribosomal protein L11 [Candidatus Liberibacter asia
3egv_B_146 50S ribosomal protein L11, ribosomal protein L11 m 100.0
1vq8_I_162 50S ribosomal protein L11P; ribosome 50S, protein- 100.0
2zkr_i_165 60S ribosomal protein L12; protein-RNA complex, 60 100.0
2ftc_G_1-8484 L11MT, MRP-L11, 39S ribosomal protein L11, mitocho 100.0
3i1n_I_1-8484 50S ribosomal protein L11; ribosome structure, pro 99.98
1wib_A_92 60S ribosomal protein L12; N-terminal domain, stru 99.96
3cjs_B_72 50S ribosomal protein L11, ribosomal protein L11 m 99.96
1mms_A_1-7272 Protein (ribosomal protein L11); RNA-protein compl 99.96
3bbo_K_1-144144 Ribosomal protein L11; large ribosomal subunit, sp 99.95
1hc8_A_76 Ribosomal protein L11; ribosome, ribosomal RNA, te 99.94
1mms_A_73-14068 Protein (ribosomal protein L11); RNA-protein compl 99.9
3bbo_K_145-22480 Ribosomal protein L11; large ribosomal subunit, sp 99.89
1qa6_A_67 Ribosomal protein L11; ribosomal RNA, tertiary str 99.88
3i1n_I_85-14258 50S ribosomal protein L11; ribosome structure, pro 99.75
2ftc_G_85-14561 L11MT, MRP-L11, 39S ribosomal protein L11, mitocho 99.74
>3egv_B (B:) 50S ribosomal protein L11, ribosomal protein L11 methyltransferase; post-translational modification, multiple methyltransferase, cytoplasm; HET: SAH 4MM; 1.75A {Thermus thermophilus} Back     alignment and structure
Probab=100.00  E-value=0  Score=353.27  Aligned_cols=139  Identities=49%  Similarity=0.836  Sum_probs=136.6

Q ss_pred             CCEEEEEEEEEECCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCEEEEEECCCCHHHHHHH
Q ss_conf             42368999999445566897044686642999899999999997754379751389998389529999859748999996
Q gi|254780147|r    3 KVVSRIVKLQIESGSAKPSPPVGPAIGQAGIPIMAFCKAFNAATEGMEKGIPIPTTVTCYKDKSFTFTMSQPPVSFFLKK   82 (142)
Q Consensus         3 k~v~~~ikl~v~aG~A~p~PplGp~LG~~Gini~~f~k~fN~~T~~~~~g~~v~V~i~v~~dksf~~~i~~P~~s~likk   82 (142)
                      |+++++++|+++||+|+|+|||||+|||+|||+|+||++||++|++|+ |++|||+|++|+||+|+|++++||+||||++
T Consensus         1 K~v~~~ikl~v~aG~A~p~Pplgp~LG~~Gini~~f~k~fN~~Tk~~~-g~~ipV~i~v~~drsf~~~i~~pp~s~llk~   79 (146)
T 3egv_B            1 KKVVAVVKLQLPAGAATPAPPVGPALGQHGANIMEFVKAFNAATANMG-DAIVPVEITIYADRSFTFVTKTPPASYLIRK   79 (146)
T ss_dssp             CCEEEEEEEEEETTCCCSSTTHHHHHHTTTCCHHHHHHHHHHHTTTST-TCEEEEEEEEETTSCEEEEECCCCHHHHC--
T ss_pred             CCEEEEEEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHC-CCCCEEEEEECCCCEEEEEECCCCHHHHHHH
T ss_conf             946899999975475379998751003358898999999999999755-9963179997189626999879987999997


Q ss_pred             HCCCCCCCCCCCCCEEEEECHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHEEECCEEEEC
Q ss_conf             337666788999630101259999999999885406787899999977430214528939
Q gi|254780147|r   83 EVGIKSGSKLPGKESCGSITRENIRKIAQLKMQDMGAIDIEGAMRMVEGSACSMGISVVD  142 (142)
Q Consensus        83 ~~g~~kgs~~p~~~~~g~it~~~i~eIAk~K~~d~~~~~l~~~vk~VlGTa~SmGi~V~~  142 (142)
                      ++|+++||++|+++++|+||++|+||||+.|++||++.+|+++||+|+|||+||||+|+.
T Consensus        80 ~~g~~~gs~~~~~~~vg~it~~~v~eIAk~K~~dl~~~~l~~~~k~vlGTa~SmGi~V~g  139 (146)
T 3egv_B           80 AAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVG  139 (146)
T ss_dssp             ------------------------------------------------------------
T ss_pred             HHCCCCCCCCCCCHHHHHCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHEEEEECEEEEEE
T ss_conf             404445655553235554379999999999877655687999999645132668699993



>1vq8_I (I:) 50S ribosomal protein L11P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} Back     alignment and structure
>2zkr_i (i:) 60S ribosomal protein L12; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} PDB: 1s1i_K Back     alignment and structure
>2ftc_G (G:1-84) L11MT, MRP-L11, 39S ribosomal protein L11, mitochondrial; mitochondrial ribosome, large ribosomal subunit, ribosomal RNA; 12.10A {Bos taurus} PDB: 3iy9_G Back     alignment and structure
>3i1n_I (I:1-84) 50S ribosomal protein L11; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1vs8_I 3e1b_5 3e1d_5 1vs6_I 3i1p_I 3i1r_I 3i1t_I 3i20_I 3i22_I 2qam_I* 1p85_G 1p86_G 2awb_I 2aw4_I 2i2v_I 2j28_I 2i2t_I* 2qao_I* 2qba_I* 2qbc_I* ... Back     alignment and structure
>1wib_A (A:) 60S ribosomal protein L12; N-terminal domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, ribosome; NMR {Mus musculus} Back     alignment and structure
>3cjs_B (B:) 50S ribosomal protein L11, ribosomal protein L11 methyltransferase; S-adenosyl-L-methionine dependent methyltransferase; 1.37A {Thermus thermophilus} Back     alignment and structure
>1mms_A (A:1-72) Protein (ribosomal protein L11); RNA-protein complex, RNA, ribosome, translocation, thiostrepton; 2.57A {Thermotoga maritima} Back     alignment and structure
>3bbo_K (K:1-144) Ribosomal protein L11; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>1hc8_A (A:) Ribosomal protein L11; ribosome, ribosomal RNA, tertiary structure, RNA-protein; HET: GTP; 2.8A {Bacillus stearothermophilus} Back     alignment and structure
>1mms_A (A:73-140) Protein (ribosomal protein L11); RNA-protein complex, RNA, ribosome, translocation, thiostrepton; 2.57A {Thermotoga maritima} Back     alignment and structure
>3bbo_K (K:145-224) Ribosomal protein L11; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>1qa6_A (A:) Ribosomal protein L11; ribosomal RNA, tertiary structur,E RNA-protein interaction, minor groove binding, antibiotic binding; 2.80A {Geobacillus stearothermophilus} Back     alignment and structure
>3i1n_I (I:85-142) 50S ribosomal protein L11; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1vs8_I 3e1b_5 3e1d_5 1vs6_I 3i1p_I 3i1r_I 3i1t_I 3i20_I 3i22_I 2qam_I* 1p85_G 1p86_G 2awb_I 2aw4_I 2i2v_I 2j28_I 2i2t_I* 2qao_I* 2qba_I* 2qbc_I* ... Back     alignment and structure
>2ftc_G (G:85-145) L11MT, MRP-L11, 39S ribosomal protein L11, mitochondrial; mitochondrial ribosome, large ribosomal subunit, ribosomal RNA; 12.10A {Bos taurus} PDB: 3iy9_G Back     alignment and structure