254780148

254780148

transcription antitermination protein NusG

GeneID in NCBI database:8209123Locus tag:CLIBASIA_00135
Protein GI in NCBI database:254780148Protein Accession:YP_003064561.1
Gene range:-(30797, 31330)Protein Length:177aa
Gene description:transcription antitermination protein NusG
COG prediction:[K] Transcription antiterminator
KEGG prediction:nusG; transcription antitermination protein NusG; K02601 transcriptional antiterminator NusG
SEED prediction:Transcription antitermination protein NusG
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Transcription factors bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------
MTPRWYIVQVYSNCEKKAVESIGGRLSRSGLDHLVTEITIPSERVVSVRKGRKVNSERRFFPGYVLIKAVMTDKVYHTIKDTPKVIGFLGTGENPSPVTDSEIEHIMNQVEAAVQRPVSSVFFEVGERVCVSDGPFASFNGIVKNVDEEKSRVHVEVVIFGRVTPVELAYNQVEKIV
ccccEEEEEEEcccHHHHHHHHHHHHHHccccccccEEEccccEEEEEEccEEEEEEEEccccEEEEEEEccccEEEEEEccccEEEEEEcccccccccHHHHHHHHHHccccccccccccccccccEEEEEccccccccEEEEEEcccccEEEEEEEEccccEEEEEEHHHHHHcc
ccHHHHHHHHcccHHHHHHHHHHHHHHHccHHHHcccEEcccHHHHHHHcccccccccccccccEEEEEEEccHHHHHHcccccEEEEEccccccccccHHHHHHHHHHHHHcccccccccccccccEEEcccccccccEEEEEEEEccccEEEEEEEEccEEEEEEEEccccEEcc
MTPRWYIVQVYSNCEKKAVESiggrlsrsgldhlvteitipservvsvrkgrkvnserrffpGYVLIKAVMtdkvyhtikdtpkvigflgtgenpspvtdsEIEHIMNQVEAAvqrpvssvffevgervcvsdgpfasfngivknvdeeksrVHVEVVIFGRVTPVELAYNQVEKIV
MTPRWYIVQVYSNCEKKAVEsiggrlsrsgldhlvteitipservvsvrkgrkvnserrffpgyvLIKAVMTDKVYHTIKDTPKVIGFLGTGENPSPVTDSEIEHIMNQVEAAVQRPVSSVFFEVGERVCVSDGPFASFNGivknvdeeksrVHVEVVifgrvtpvelaynqvekiv
MTPRWYIVQVYSNCEKKAVESIGGRLSRSGLDHLVTEITIPSERVVSVRKGRKVNSERRFFPGYVLIKAVMTDKVYHTIKDTPKVIGFLGTGENPSPVTDSEIEHIMNQVEAAVQRPVSSVFFEVGERVCVSDGPFASFNGIVKNVDEEKSRVHVEVVIFGRVTPVELAYNQVEKIV
MTPRWYIVQVYSNCEKKAVESIGGRLSRSGLDHLVTEITIPSERVVSVRKGRKVNSERRFFPGYVLIKAVMTDKVYHTIKDTPKVIGFLGTGENPSPVTDSEIEH****************FFEVGERVCVSDGPFASFNGIVKNVDEEKSRVHVEVVIFGRVTPVELAYNQVEKIV
MTPRWYIVQVYSNCEKKAVESIGGRLSRSGLDHLVTEITIPSERVVSVRKGRKVNSERRFFPGYVLIKAVMTDKVYHTIKDTPKVIGFLGTGENPSPVTDSEIEHIMNQVEAAVQRPVSSVFFEVGERVCVSDGPFASFNGIVKNVDEEKSRVHVEVVIFGRVTPVELAYNQVEKIV
*TPRWYIVQVYSNCEKKAVESIGGRLSRSGLDHLVTEITIPSERVVSVRKGRKVNSERRFFPGYVLIKAVMTDKVYHTIKDTPKVIGFLGTGENPSPVTDSEIEHIMNQVEAAVQRPVSSVFFEVGERVCVSDGPFASFNGIVKNVDEEKSRVHVEVVIFGRVTPVELAYNQVEKIV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTPRWYIVQVYSNCEKKAVESIGGRLSRSGLDHLVTEITIPSERVVSVRKGRKVNSERRFFPGYVLIKAVMTDKVYHTIKDTPKVIGFLGTGENPSPVTDSEIEHIMNQVEAAVQRPVSSVFFEVGERVCVSDGPFASFNGIVKNVDEEKSRVHVEVVIFGRVTPVELAYNQVEKIV
MTPRWYIVQVYSNCEKKAVESIGGRLSRSGLDHLVTEITIPSERVVSVRKGRKVNSERRFFPGYVLIKAVMTDKVYHTIKDTPKVIGFLGTGENPSPVTDSEIEHIMNQVEAAVQRPVSSVFFEVGERVCVSDGPFASFNGIVKNVDEEKSRVHVEVVIFGRVTPVELAYNQVEKIV
MTPRWYIVQVYSNCEKKAVESIGGRLSRSGLDHLVTEITIPSERVVSVRKGRKVNSERRFFPGYVLIKAVMTDKVYHTIKDTPKVIGFLGTGENPSPVTDSEIEHIMNQVEAAVQRPVSSVFFEVGERVCVSDGPFASFNGIVKNVDEEKSRVHVEVVIFGRVTPVELAYNQVEKIV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target177 transcription antitermination protein NusG [Candidatus
315122750177 transcription antitermination protein NusG [Candidatus 1 1e-81
133872295177 transcription antitermination component [Candidatus Lib 1 4e-62
325293351176 Transcription antitermination protein nusG [Agrobacteri 1 3e-60
15889255176 transcription antitermination protein NusG [Agrobacteri 1 7e-60
240850287176 transcription antitermination protein NusG [Bartonella 1 3e-59
222148352176 transcription antitermination protein NusG [Agrobacteri 1 4e-59
227821742176 transcription antitermination protein NusG [Sinorhizobi 1 4e-59
86357292176 transcription antitermination protein NusG [Rhizobium e 1 1e-58
163868084176 transcription antitermination protein NusG [Bartonella 1 1e-58
190891342176 transcription antitermination protein [Rhizobium etli C 1 1e-58
>gi|315122750|ref|YP_004063239.1| transcription antitermination protein NusG [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 177 Back     alignment and organism information
 Score =  305 bits (781), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 167/177 (94%)

Query: 1   MTPRWYIVQVYSNCEKKAVESIGGRLSRSGLDHLVTEITIPSERVVSVRKGRKVNSERRF 60
           MT  WYIVQVYSNCEKK VES+ GRL+R+GLD+LVTEIT+PSE+VVSVR+GRKVNSERRF
Sbjct: 1   MTSHWYIVQVYSNCEKKTVESMLGRLNRAGLDNLVTEITVPSEKVVSVRRGRKVNSERRF 60

Query: 61  FPGYVLIKAVMTDKVYHTIKDTPKVIGFLGTGENPSPVTDSEIEHIMNQVEAAVQRPVSS 120
           FPGYVL+KAVMTD+VYHTI++TPKV+GFLG+G+NPSPV+DSEIEHIM Q+EA+V +PVS+
Sbjct: 61  FPGYVLLKAVMTDEVYHTIRNTPKVMGFLGSGKNPSPVSDSEIEHIMGQIEASVHKPVST 120

Query: 121 VFFEVGERVCVSDGPFASFNGIVKNVDEEKSRVHVEVVIFGRVTPVELAYNQVEKIV 177
           + FE+GER+CVSDGPFASFNGIVK+VDEEKSR+ VEV IFGR TPVELAY+QVEKIV
Sbjct: 121 IIFEIGERICVSDGPFASFNGIVKDVDEEKSRLKVEVSIFGRATPVELAYSQVEKIV 177


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|133872295|gb|ABO40215.1| transcription antitermination component [Candidatus Liberibacter americanus] Length = 177 Back     alignment and organism information
>gi|325293351|ref|YP_004279215.1| Transcription antitermination protein nusG [Agrobacterium sp. H13-3] Length = 176 Back     alignment and organism information
>gi|15889255|ref|NP_354936.1| transcription antitermination protein NusG [Agrobacterium tumefaciens str. C58] Length = 176 Back     alignment and organism information
>gi|240850287|ref|YP_002971680.1| transcription antitermination protein NusG [Bartonella grahamii as4aup] Length = 176 Back     alignment and organism information
>gi|222148352|ref|YP_002549309.1| transcription antitermination protein NusG [Agrobacterium vitis S4] Length = 176 Back     alignment and organism information
>gi|227821742|ref|YP_002825712.1| transcription antitermination protein NusG [Sinorhizobium fredii NGR234] Length = 176 Back     alignment and organism information
>gi|86357292|ref|YP_469184.1| transcription antitermination protein NusG [Rhizobium etli CFN 42] Length = 176 Back     alignment and organism information
>gi|163868084|ref|YP_001609288.1| transcription antitermination protein NusG [Bartonella tribocorum CIP 105476] Length = 176 Back     alignment and organism information
>gi|190891342|ref|YP_001977884.1| transcription antitermination protein [Rhizobium etli CIAT 652] Length = 176 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target177 transcription antitermination protein NusG [Candidatus
PRK05609181 PRK05609, nusG, transcription antitermination protein N 4e-60
TIGR00922172 TIGR00922, nusG, transcription termination/antiterminat 1e-49
TIGR01955159 TIGR01955, RfaH, transcriptional activator RfaH 1e-10
COG0250178 COG0250, NusG, Transcription antiterminator [Transcript 2e-43
smart00738106 smart00738, NGN, In Spt5p, this domain may confer affin 8e-25
pfam0235790 pfam02357, NusG, Transcription termination factor nusG 2e-17
TIGR01956258 TIGR01956, NusG_myco, NusG family protein 4e-08
PRK08559153 PRK08559, nusG, transcription antitermination protein N 0.001
TIGR00405145 TIGR00405, L26e_arch, ribosomal protein L24p/L26e, arch 0.003
TIGR01956258 TIGR01956, NusG_myco, NusG family protein 0.003
>gnl|CDD|180161 PRK05609, nusG, transcription antitermination protein NusG; Validated Back     alignment and domain information
>gnl|CDD|162110 TIGR00922, nusG, transcription termination/antitermination factor NusG Back     alignment and domain information
>gnl|CDD|131010 TIGR01955, RfaH, transcriptional activator RfaH Back     alignment and domain information
>gnl|CDD|30599 COG0250, NusG, Transcription antiterminator [Transcription] Back     alignment and domain information
>gnl|CDD|128977 smart00738, NGN, In Spt5p, this domain may confer affinity for Spt4p Back     alignment and domain information
>gnl|CDD|145481 pfam02357, NusG, Transcription termination factor nusG Back     alignment and domain information
>gnl|CDD|162624 TIGR01956, NusG_myco, NusG family protein Back     alignment and domain information
>gnl|CDD|181467 PRK08559, nusG, transcription antitermination protein NusG; Validated Back     alignment and domain information
>gnl|CDD|129499 TIGR00405, L26e_arch, ribosomal protein L24p/L26e, archaeal Back     alignment and domain information
>gnl|CDD|162624 TIGR01956, NusG_myco, NusG family protein Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 177 transcription antitermination protein NusG [Candidatus
TIGR00922193 nusG transcription termination/antitermination factor N 100.0
PRK05609183 nusG transcription antitermination protein NusG; Valida 100.0
PRK09014162 rfaH transcriptional activator RfaH; Provisional 100.0
COG0250178 NusG Transcription antiterminator [Transcription] 100.0
TIGR01955162 RfaH transcriptional activator RfaH; InterPro: IPR01021 100.0
TIGR01956335 NusG_myco NusG family protein; InterPro: IPR010216 This 99.96
PRK08559153 nusG transcription antitermination protein NusG; Valida 99.93
TIGR00405151 L26e_arch ribosomal protein L24; InterPro: IPR011590 Ri 99.59
KOG1999 1024 consensus 96.12
smart00738106 NGN In Spt5p, this domain may confer affinity for Spt4p 99.96
pfam0235790 NusG Transcription termination factor nusG. 99.85
pfam0343982 Spt5-NGN Early transcription elongation factor of RNA p 97.86
KOG1999 1024 consensus 98.15
TIGR01080116 rplX_A_E ribosomal protein L24; InterPro: IPR005756 Rib 96.65
pfam0046732 KOW KOW motif. This family has been extended to coincid 96.62
PRK01191119 rpl24p 50S ribosomal protein L24P; Validated 96.55
PTZ00194143 60S ribosomal protein L26; Provisional 95.67
PRK00004102 rplX 50S ribosomal protein L24; Reviewed 95.62
PRK1228177 rplX 50S ribosomal protein L24; Reviewed 95.52
CHL0014190 rpl24 ribosomal protein L24; Validated 95.29
COG0198104 RplX Ribosomal protein L24 [Translation, ribosomal stru 94.53
COG5164 607 SPT5 Transcription elongation factor [Transcription] 93.94
TIGR01079109 rplX_bact ribosomal protein L24; InterPro: IPR003256 Ri 91.63
PRK06531120 yajC preprotein translocase subunit YajC; Validated 91.27
pfam1162353 DUF3252 Protein of unknown function (DUF3252). This fam 90.18
smart0073928 KOW KOW (Kyprides, Ouzounis, Woese) motif. Motif in rib 96.56
>TIGR00922 nusG transcription termination/antitermination factor NusG; InterPro: IPR001062 Bacterial transcription antitermination protein, nusG, is a component of the transcription complex and interacts with the termination factor Rho and RNA polymerase , Back     alignment and domain information
>PRK05609 nusG transcription antitermination protein NusG; Validated Back     alignment and domain information
>PRK09014 rfaH transcriptional activator RfaH; Provisional Back     alignment and domain information
>COG0250 NusG Transcription antiterminator [Transcription] Back     alignment and domain information
>TIGR01955 RfaH transcriptional activator RfaH; InterPro: IPR010215 This entry represents the transcriptional activator protein, RfaH Back     alignment and domain information
>TIGR01956 NusG_myco NusG family protein; InterPro: IPR010216 This entry represents a family of Mycoplasma proteins orthologous to the bacterial transcription termination/antitermination factor NusG Back     alignment and domain information
>PRK08559 nusG transcription antitermination protein NusG; Validated Back     alignment and domain information
>TIGR00405 L26e_arch ribosomal protein L24; InterPro: IPR011590 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG1999 consensus Back     alignment and domain information
>smart00738 NGN In Spt5p, this domain may confer affinity for Spt4p Back     alignment and domain information
>pfam02357 NusG Transcription termination factor nusG Back     alignment and domain information
>pfam03439 Spt5-NGN Early transcription elongation factor of RNA pol II, NGN section Back     alignment and domain information
>KOG1999 consensus Back     alignment and domain information
>TIGR01080 rplX_A_E ribosomal protein L24; InterPro: IPR005756 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>pfam00467 KOW KOW motif Back     alignment and domain information
>PRK01191 rpl24p 50S ribosomal protein L24P; Validated Back     alignment and domain information
>PTZ00194 60S ribosomal protein L26; Provisional Back     alignment and domain information
>PRK00004 rplX 50S ribosomal protein L24; Reviewed Back     alignment and domain information
>PRK12281 rplX 50S ribosomal protein L24; Reviewed Back     alignment and domain information
>CHL00141 rpl24 ribosomal protein L24; Validated Back     alignment and domain information
>COG0198 RplX Ribosomal protein L24 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5164 SPT5 Transcription elongation factor [Transcription] Back     alignment and domain information
>TIGR01079 rplX_bact ribosomal protein L24; InterPro: IPR003256 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK06531 yajC preprotein translocase subunit YajC; Validated Back     alignment and domain information
>pfam11623 DUF3252 Protein of unknown function (DUF3252) Back     alignment and domain information
>smart00739 KOW KOW (Kyprides, Ouzounis, Woese) motif Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target177 transcription antitermination protein NusG [Candidatus
2jvv_A181 Solution Structure Of E. Coli Nusg Carboxyterminal 2e-43
2oug_A162 Crystal Structure Of The Rfah Transcription Factor 1e-11
3qqc_D163 Crystal Structure Of Archaeal Spt45 BOUND TO THE RN 0.001
3p8b_B152 X-Ray Crystal Structure Of Pyrococcus Furiosus Tran 0.001
1m1g_A248 Crystal Structure Of Aquifex Aeolicus N-Utilization 3e-23
1m1g_A248 Crystal Structure Of Aquifex Aeolicus N-Utilization 0.001
2kvq_G63 Solution Structure Of Nuse:nusg-Ctd Complex Length 1e-18
1nz9_A58 Solution Structure Of The N-Utilisation Substance G 6e-16
2k06_A123 Solution Structure Of The Aminoterminal Domain Of E 2e-16
1nz8_A119 Solution Structure Of The N-Utilisation Substance G 3e-12
gi|209447284|pdb|2JVV|A Chain A, Solution Structure Of E. Coli Nusg Carboxyterminal Domain Length = 181 Back     alignment and structure
 Score =  179 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 79/174 (45%), Positives = 117/174 (67%), Gaps = 1/174 (0%)

Query: 3   PRWYIVQVYSNCEKKAVESIGGRLSRSGLDHLVTEITIPSERVVSVRKGRKVNSERRFFP 62
            RWY+VQ +S  E +   S+   +    ++ L  E+ +P+E VV +R G++  SER+FFP
Sbjct: 7   KRWYVVQAFSGFEGRVATSLREHIKLHNMEDLFGEVMVPTEEVVEIRGGQRRKSERKFFP 66

Query: 63  GYVLIKAVMTDKVYHTIKDTPKVIGFLGT-GENPSPVTDSEIEHIMNQVEAAVQRPVSSV 121
           GYVL++ VM D  +H ++  P+V+GF+G   + P+P++D E++ IMN+++    +P    
Sbjct: 67  GYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRPAPISDKEVDAIMNRLQQVGDKPRPKT 126

Query: 122 FFEVGERVCVSDGPFASFNGIVKNVDEEKSRVHVEVVIFGRVTPVELAYNQVEK 175
            FE GE V V+DGPFA FNG+V+ VD EKSR+ V V IFGR TPVEL ++QVEK
Sbjct: 127 LFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKVSVSIFGRATPVELDFSQVEK 180


gi|146386655|pdb|2OUG|A Chain A, Crystal Structure Of The Rfah Transcription Factor At 2.1a Resolution Length = 162 Back     alignment and structure
>gi|326634532|pdb|3QQC|D Chain D, Crystal Structure Of Archaeal Spt45 BOUND TO THE RNAP CLAMP DOMAIN Length = 163 Back     alignment and structure
gi|320089854|pdb|3P8B|B Chain B, X-Ray Crystal Structure Of Pyrococcus Furiosus Transcription Elongation Factor Spt45 Length = 152 Back     alignment and structure
gi|28373569|pdb|1M1G|A Chain A, Crystal Structure Of Aquifex Aeolicus N-Utilization Substance G (Nusg), Space Group P2(1) Length = 248 Back     alignment and structure
gi|28373569|pdb|1M1G|A Chain A, Crystal Structure Of Aquifex Aeolicus N-Utilization Substance G (Nusg), Space Group P2(1) Length = 248 Back     alignment and structure
>gi|295789221|pdb|2KVQ|G Chain G, Solution Structure Of Nuse:nusg-Ctd Complex Length = 63 Back     alignment and structure
>gi|47168441|pdb|1NZ9|A Chain A, Solution Structure Of The N-Utilisation Substance G (Nusg) C-Terminal (Ngc) Domain From Thermus Thermophilus Length = 58 Back     alignment and structure
>gi|222446920|pdb|2K06|A Chain A, Solution Structure Of The Aminoterminal Domain Of E. Coli Nusg Length = 123 Back     alignment and structure
>gi|159162766|pdb|1NZ8|A Chain A, Solution Structure Of The N-Utilisation Substance G (Nusg) N-Terminal (Ngn) Domain From Thermus Thermophilus Length = 119 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target177 transcription antitermination protein NusG [Candidatus
2jvv_A181 Transcription antitermination protein NUSG; transcripti 2e-35
2oug_A162 Transcriptional activator RFAH; transcription factor, v 6e-26
1m1h_A248 Transcription antitermination protein NUSG; transcripti 1e-33
1m1h_A248 Transcription antitermination protein NUSG; transcripti 2e-09
1nz8_A119 Transcription antitermination protein NUSG; transcripti 7e-25
1nz9_A58 Transcription antitermination protein NUSG; transcripti 1e-16
>2jvv_A Transcription antitermination protein NUSG; transcription factor, transcription regulation, transcription termination; NMR {Escherichia coli} PDB: 2k06_A Length = 181 Back     alignment and structure
 Score =  143 bits (362), Expect = 2e-35
 Identities = 80/173 (46%), Positives = 118/173 (68%), Gaps = 1/173 (0%)

Query: 4   RWYIVQVYSNCEKKAVESIGGRLSRSGLDHLVTEITIPSERVVSVRKGRKVNSERRFFPG 63
           RWY+VQ +S  E +   S+   +    ++ L  E+ +P+E VV +R G++  SER+FFPG
Sbjct: 8   RWYVVQAFSGFEGRVATSLREHIKLHNMEDLFGEVMVPTEEVVEIRGGQRRKSERKFFPG 67

Query: 64  YVLIKAVMTDKVYHTIKDTPKVIGFL-GTGENPSPVTDSEIEHIMNQVEAAVQRPVSSVF 122
           YVL++ VM D  +H ++  P+V+GF+ GT + P+P++D E++ IMN+++    +P     
Sbjct: 68  YVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRPAPISDKEVDAIMNRLQQVGDKPRPKTL 127

Query: 123 FEVGERVCVSDGPFASFNGIVKNVDEEKSRVHVEVVIFGRVTPVELAYNQVEK 175
           FE GE V V+DGPFA FNG+V+ VD EKSR+ V V IFGR TPVEL ++QVEK
Sbjct: 128 FEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKVSVSIFGRATPVELDFSQVEK 180


>2oug_A Transcriptional activator RFAH; transcription factor, virulence, transcription pausing, transcription elongation; 2.10A {Escherichia coli} Length = 162 Back     alignment and structure
>1m1h_A Transcription antitermination protein NUSG; transcription termination, RNP motif, immunoglobulin fold, nucleic acid interaction; 1.95A {Aquifex aeolicus} SCOP: b.114.1.1 d.58.42.1 PDB: 1m1g_A 1npp_A 1npr_A Length = 248 Back     alignment and structure
>1m1h_A Transcription antitermination protein NUSG; transcription termination, RNP motif, immunoglobulin fold, nucleic acid interaction; 1.95A {Aquifex aeolicus} SCOP: b.114.1.1 d.58.42.1 PDB: 1m1g_A 1npp_A 1npr_A Length = 248 Back     alignment and structure
>1nz8_A Transcription antitermination protein NUSG; transcription elongation, riken structural genomics/proteomics initiative, RSGI; NMR {Thermus thermophilus} SCOP: d.58.42.1 Length = 119 Back     alignment and structure
>1nz9_A Transcription antitermination protein NUSG; transcription elongation, riken structural genomics/proteomics initiative, RSGI; NMR {Thermus thermophilus} SCOP: b.34.5.4 Length = 58 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target177 transcription antitermination protein NusG [Candidatus
1m1h_A248 Transcription antitermination protein NUSG; transcripti 100.0
2jvv_A181 Transcription antitermination protein NUSG; transcripti 100.0
2oug_A162 Transcriptional activator RFAH; transcription factor, v 100.0
1nz8_A119 Transcription antitermination protein NUSG; transcripti 99.97
3lpe_A92 Putative transcription antitermination protein NU; tran 98.33
3h7h_B106 Transcription elongation factor SPT5; helices surroundi 97.78
2exu_A200 Transcription initiation protein SPT4/SPT5; helixs surr 97.54
1nz9_A58 Transcription antitermination protein NUSG; transcripti 99.55
2e6z_A59 Transcription elongation factor SPT5; KOW motif, struct 97.11
1vq8_T120 50S ribosomal protein L24P; ribosome 50S, protein-prote 96.61
2e70_A71 Transcription elongation factor SPT5; KOW motif, struct 96.56
2ckk_A127 KIN17; beta barrel, ribosomal protein, ribonucleoprotei 96.55
2wwb_L127 60S ribosomal protein L26-A; ribosome, protein EXIT tun 96.49
2zkr_t145 60S ribosomal protein L26; protein-RNA complex, 60S rib 96.2
2do3_A69 Transcription elongation factor SPT5; KOW motif, struct 96.04
2ftc_N96 Mitochondrial ribosomal protein L24; mitochondrial ribo 95.29
2zjr_R115 50S ribosomal protein L24; ribosome, large ribosomal su 95.11
3bbo_W191 Ribosomal protein L24; large ribosomal subunit, spinach 94.56
2j01_Y110 50S ribosomal protein L24; ribosome, tRNA, paromomycin, 92.7
2jz2_A66 SSL0352 protein; SH3-like, synechocystis SP. PCC 6803, 92.63
>1m1h_A Transcription antitermination protein NUSG; transcription termination, RNP motif, immunoglobulin fold, nucleic acid interaction; 1.95A {Aquifex aeolicus} SCOP: b.114.1.1 d.58.42.1 PDB: 1m1g_A 1npp_A 1npr_A Back     alignment and structure
Probab=100.00  E-value=0  Score=317.59  Aligned_cols=174  Identities=41%  Similarity=0.716  Sum_probs=161.7

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHHHHCCCHHHCCEEEEECCCCEEE--------------------------------
Q ss_conf             988618999528853899999999999779811143266313101277--------------------------------
Q gi|254780148|r    1 MTPRWYIVQVYSNCEKKAVESIGGRLSRSGLDHLVTEITIPSERVVSV--------------------------------   48 (177)
Q Consensus         1 M~~~Wyvv~t~~~~E~~v~~~L~~~~~~~~~~~~~~~v~~P~~~~~~~--------------------------------   48 (177)
                      |.++||++||.||+|++|+++|++++...++++++.+|.+|++++...                                
T Consensus         9 m~kkWYvv~t~SG~E~kVk~~le~~i~~~~~~~~i~~v~vP~e~v~e~~~~~k~k~~~~~~~~~~~~~~~~~~~~~~~~i   88 (248)
T 1m1h_A            9 LEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRI   88 (248)
T ss_dssp             CCCEEEEEEECTTCHHHHHHHHHHHHHHTTCGGGEEEEECSSEEEEEEEETTEEEEEEESSSSCEEEEEECSSSEEEEEE
T ss_pred             HCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCCEEEEEECCCEEEEEEECCCCEEEECCCCCCCCCCCCCCCCCCCEEEE
T ss_conf             05866999826695899999999999877972344089904279999962763012002332222211012345521453


Q ss_pred             ----------------------------------ECCEEEEEECCEECEEEEEEEECCCCCHHHHHCCCEEEEEECCCCC
Q ss_conf             ----------------------------------2020356641203309999996186522444203303664327886
Q gi|254780148|r   49 ----------------------------------RKGRKVNSERRFFPGYVLIKAVMTDKVYHTIKDTPKVIGFLGTGEN   94 (177)
Q Consensus        49 ----------------------------------~~g~~~~~~~plfpgYiFv~~~~~~~~~~~i~~t~gV~~~l~~~~~   94 (177)
                                                        ++|+++.++++||||||||++++++++|+.|++|+||++||+++++
T Consensus        89 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~gkk~~~er~LFPGYVFV~~~~~~~~~~~Ir~t~GV~~fVg~g~~  168 (248)
T 1m1h_A           89 ENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGK  168 (248)
T ss_dssp             CSSCEEEEECSTTCGGGGSCCBCSTTCEEEETTTTEEEEEEEECSSSTTEEEEEECCCHHHHHHHHTSTTEEEECEETTE
T ss_pred             ECCCEEEECCCCCCCCCCCCCCCCCCCCCCHHHCCCCCEEEEEEECCCCEEEEEEECCCHHHHHHHCCCCEEEEEECCCE
T ss_conf             03310110023443222223334554321101104783699984358848999987272168887367424775206981


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEECCCCCCCEEEEEEECCCCCEEEEEEEECCCEEEEEECHHHHE
Q ss_conf             10025889999997653222100001234789779995187789719999982889889999981687047885678712
Q gi|254780148|r   95 PSPVTDSEIEHIMNQVEAAVQRPVSSVFFEVGERVCVSDGPFASFNGIVKNVDEEKSRVHVEVVIFGRVTPVELAYNQVE  174 (177)
Q Consensus        95 P~~i~~~ei~~l~~~~~~~~~~~~~~~~~~~G~~V~I~~Gpf~g~~g~v~~i~~~~~r~~V~v~i~Gr~~~v~l~~~~ie  174 (177)
                      |+||++++|+.|+..++++..  .....|.+||.|+|++|||+|++|.|.++|.+++|++|+++||||.|+|+|+++||+
T Consensus       169 P~pl~~~EI~~il~~~~~~~~--~~~~~f~~Gd~V~I~~GPF~g~~G~V~eid~ek~rv~Vlv~ifGR~tpVel~~~qVe  246 (248)
T 1m1h_A          169 PVPLKEEEVQNILNQIKRGVK--PSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVE  246 (248)
T ss_dssp             ECEECHHHHHHHHHHTTC--------------------------------------------------------------
T ss_pred             EEECCHHHHHHHHHHHHCCCC--CCCCEECCCCEEEEEECCCCCCEEEEEEECCCCCEEEEEEEECCCCEEEEECHHHEE
T ss_conf             014599999999987654666--654300179889994158999479999981888999999981699637987689978


Q ss_pred             EC
Q ss_conf             33
Q gi|254780148|r  175 KI  176 (177)
Q Consensus       175 ki  176 (177)
                      ||
T Consensus       247 Ki  248 (248)
T 1m1h_A          247 KI  248 (248)
T ss_dssp             --
T ss_pred             EC
T ss_conf             29



>2jvv_A Transcription antitermination protein NUSG; transcription factor, transcription regulation, transcription termination; NMR {Escherichia coli} PDB: 2k06_A 2kvq_G Back     alignment and structure
>2oug_A Transcriptional activator RFAH; transcription factor, virulence, transcription pausing, transcription elongation; 2.10A {Escherichia coli} Back     alignment and structure
>1nz8_A Transcription antitermination protein NUSG; transcription elongation, riken structural genomics/proteomics initiative, RSGI; NMR {Thermus thermophilus} SCOP: d.58.42.1 Back     alignment and structure
>3lpe_A Putative transcription antitermination protein NU; transcription regulation, SPT4, SPT5, NUSG, archaea, evoluti directed RNA polymerase; 1.90A {Methanocaldococcus jannaschii} PDB: 3ewg_A Back     alignment and structure
>3h7h_B Transcription elongation factor SPT5; helices surrounding beta sheet, activator, metal-binding, nucleus, repressor, transcription regulation, zinc; 1.55A {Homo sapiens} Back     alignment and structure
>2exu_A Transcription initiation protein SPT4/SPT5; helixs surrounding beta sheet; 2.23A {Saccharomyces cerevisiae} Back     alignment and structure
>1nz9_A Transcription antitermination protein NUSG; transcription elongation, riken structural genomics/proteomics initiative, RSGI; NMR {Thermus thermophilus} SCOP: b.34.5.4 Back     alignment and structure
>2e6z_A Transcription elongation factor SPT5; KOW motif, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vq8_T 50S ribosomal protein L24P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: b.34.5.1 PDB: 1vq4_T* 1vq5_T* 1vq6_T* 1vq7_T* 1s72_T* 1vq9_T* 1vqk_T* 1vql_T* 1vqm_T* 1vqn_T* 1vqo_T* 1vqp_T* 1yhq_T* 1yi2_T* 1yij_T* 1yit_T* 1yj9_T* 1yjn_T* 1yjw_T* 2otj_T* ... Back     alignment and structure
>2e70_A Transcription elongation factor SPT5; KOW motif, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ckk_A KIN17; beta barrel, ribosomal protein, ribonucleoprotein, nuclear protein; 1.45A {Homo sapiens} Back     alignment and structure
>2wwb_L 60S ribosomal protein L26-A; ribosome, protein EXIT tunnel, cotranslational protein translocation, protein conducting channel; 6.48A {Triticum aestivum} PDB: 2wwa_L 2ww9_L 1s1i_U Back     alignment and structure
>2zkr_t 60S ribosomal protein L26; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>2do3_A Transcription elongation factor SPT5; KOW motif, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.34.5.5 Back     alignment and structure
>2ftc_N Mitochondrial ribosomal protein L24; mitochondrial ribosome, large ribosomal subunit, ribosomal RNA; 12.10A {Bos taurus} PDB: 3iy9_N Back     alignment and structure
>2zjr_R 50S ribosomal protein L24; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: b.34.5.1 PDB: 1nwx_S* 1nwy_S* 1sm1_S* 1xbp_S* 2d3o_S 2zjp_R* 2zjq_R 1nkw_S 3cf5_R* 3dll_R* 1pnu_S 1pny_S 1vor_V 1vou_V 1vow_V 1voy_V 1vp0_V Back     alignment and structure
>3bbo_W Ribosomal protein L24; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>2j01_Y 50S ribosomal protein L24; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} SCOP: b.34.5.1 PDB: 1vsp_S 2hgj_X 2hgq_X 2hgu_X 1vsa_S 2j03_Y 2jl6_Y 2jl8_Y 2v47_Y 2v49_Y 2wdi_Y 2wdj_Y 2wdl_Y 2wdn_Y 2wh2_Y 2wh4_Y 2wrj_Y 2wrl_Y 2wro_Y 2wrr_Y ... Back     alignment and structure
>2jz2_A SSL0352 protein; SH3-like, synechocystis SP. PCC 6803, target SGR42, PSI, protein structure initiative; NMR {Synechocystis SP} PDB: 3c4s_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 177 transcription antitermination protein NusG [Candidatus
d1nz8a_119 d.58.42.1 (A:) N-utilization substance G protein NusG, 4e-24
d1m1ha2101 d.58.42.1 (A:5-50,A:132-186) N-utilization substance G 1e-22
d1nz9a_58 b.34.5.4 (A:) N-utilization substance G protein NusG, C 9e-17
d1nppa258 b.34.5.4 (A:191-248) N-utilization substance G protein 1e-16
>d1nz8a_ d.58.42.1 (A:) N-utilization substance G protein NusG, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 119 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: N-utilization substance G protein NusG, N-terminal domain
family: N-utilization substance G protein NusG, N-terminal domain
domain: N-utilization substance G protein NusG, N-terminal domain
species: Thermus thermophilus [TaxId: 274]
 Score =  104 bits (261), Expect = 4e-24
 Identities = 34/113 (30%), Positives = 59/113 (52%), Gaps = 6/113 (5%)

Query: 4   RWYIVQVYSNCEKKAVESIGGRLSRSGLDHLVTEITIPSERVVSVR-KGRKVNSERRFFP 62
            WY V      E+KA  ++  R+   GL   + ++ IP+E VV +R  G+K    ++ FP
Sbjct: 3   EWYAVHTLVGQEEKAKANLEKRIKAFGLQDKIFQVLIPTEEVVELREGGKKEVVRKKLFP 62

Query: 63  GYVLIKAVMTD-----KVYHTIKDTPKVIGFLGTGENPSPVTDSEIEHIMNQV 110
           GY+ I+  + D     + +  ++ TP + GF+G G  P P++  E+ HI+   
Sbjct: 63  GYLFIQMDLGDEEEPNEAWEVVRGTPGITGFVGAGMRPVPLSPDEVRHILEVS 115


>d1m1ha2 d.58.42.1 (A:5-50,A:132-186) N-utilization substance G protein NusG, N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 101 Back     information, alignment and structure
>d1nz9a_ b.34.5.4 (A:) N-utilization substance G protein NusG, C-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 58 Back     information, alignment and structure
>d1nppa2 b.34.5.4 (A:191-248) N-utilization substance G protein NusG, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 58 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target177 transcription antitermination protein NusG [Candidatus
d1nz8a_119 N-utilization substance G protein NusG, N-terminal doma 99.97
d1m1ha2101 N-utilization substance G protein NusG, N-terminal doma 99.95
d1nppa258 N-utilization substance G protein NusG, C-terminal doma 99.58
d1nz9a_58 N-utilization substance G protein NusG, C-terminal doma 99.56
d1vqot1119 Ribosomal proteins L24 (L24p) {Archaeon Haloarcula mari 96.44
d2do3a162 Transcription elongation factor SPT5 {Human (Homo sapie 95.88
d2zjrr1110 Ribosomal proteins L24 (L24p) {Deinococcus radiodurans 95.61
d2gycs199 Ribosomal proteins L24 (L24p) {Escherichia coli [TaxId: 92.71
d2j01y1101 Ribosomal proteins L24 (L24p) {Thermus thermophilus [Ta 92.34
>d1nz8a_ d.58.42.1 (A:) N-utilization substance G protein NusG, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: N-utilization substance G protein NusG, N-terminal domain
family: N-utilization substance G protein NusG, N-terminal domain
domain: N-utilization substance G protein NusG, N-terminal domain
species: Thermus thermophilus [TaxId: 274]
Probab=99.97  E-value=1.5e-30  Score=200.17  Aligned_cols=110  Identities=31%  Similarity=0.674  Sum_probs=101.7

Q ss_pred             CCCEEEEEECCCCHHHHHHHHHHHHHHCCCHHHCCEEEEECCCCEEEE-CCEEEEEECCEECEEEEEEEECCC-----CC
Q ss_conf             886189995288538999999999997798111432663131012772-020356641203309999996186-----52
Q gi|254780148|r    2 TPRWYIVQVYSNCEKKAVESIGGRLSRSGLDHLVTEITIPSERVVSVR-KGRKVNSERRFFPGYVLIKAVMTD-----KV   75 (177)
Q Consensus         2 ~~~Wyvv~t~~~~E~~v~~~L~~~~~~~~~~~~~~~v~~P~~~~~~~~-~g~~~~~~~plfpgYiFv~~~~~~-----~~   75 (177)
                      +++||||+|+||+|++|+++|+++++..+++++++++++|++++...+ +|+++.+.+|+|||||||++++++     ++
T Consensus         1 ~mkWYvl~t~sg~E~~v~~~L~~~i~~~~l~~~~~~v~vP~e~~~~~k~~gkk~~~~~~lFPGYvfV~~~~~d~~~~~~~   80 (119)
T d1nz8a_           1 SIEWYAVHTLVGQEEKAKANLEKRIKAFGLQDKIFQVLIPTEEVVELREGGKKEVVRKKLFPGYLFIQMDLGDEEEPNEA   80 (119)
T ss_dssp             CCEEEEEECCTTTHHHHHHHHHHHHHHHTCTTTCCEEECSEEEEEEECSSSCEEEEEEESSTTEEEEEECCCSSSSCCHH
T ss_pred             CCEEEEEEEECCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCEEEEEEECCCCEEEEEEECCCCCCCHHH
T ss_conf             96599999578938999999999998846432244232374568999925632773024588389999864765443026


Q ss_pred             HHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             244420330366432788610025889999997653
Q gi|254780148|r   76 YHTIKDTPKVIGFLGTGENPSPVTDSEIEHIMNQVE  111 (177)
Q Consensus        76 ~~~i~~t~gV~~~l~~~~~P~~i~~~ei~~l~~~~~  111 (177)
                      |+.|++|+||++||+++++|.||+++||++|+...+
T Consensus        81 ~~~Ir~t~gV~~fvg~~~~P~pv~~~Ei~~il~~~g  116 (119)
T d1nz8a_          81 WEVVRGTPGITGFVGAGMRPVPLSPDEVRHILEVSG  116 (119)
T ss_dssp             HHHHHHSTTCCCCCCSSSSSCBCCHHHHHHHHHHHT
T ss_pred             HHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHHC
T ss_conf             789853898069868998606489999999999857



>d1m1ha2 d.58.42.1 (A:5-50,A:132-186) N-utilization substance G protein NusG, N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1nppa2 b.34.5.4 (A:191-248) N-utilization substance G protein NusG, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1nz9a_ b.34.5.4 (A:) N-utilization substance G protein NusG, C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vqot1 b.34.5.1 (T:1-119) Ribosomal proteins L24 (L24p) {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d2do3a1 b.34.5.5 (A:462-523) Transcription elongation factor SPT5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zjrr1 b.34.5.1 (R:4-113) Ribosomal proteins L24 (L24p) {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2gycs1 b.34.5.1 (S:3-101) Ribosomal proteins L24 (L24p) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j01y1 b.34.5.1 (Y:2-102) Ribosomal proteins L24 (L24p) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 177 transcription antitermination protein NusG [Candid
2jvv_A_181 (A:) Transcription antitermination protein NUSG; t 2e-37
1nz8_A_119 (A:) Transcription antitermination protein NUSG; t 6e-24
2oug_A_1-9898 (A:1-98) Transcriptional activator RFAH; transcrip 1e-21
1m1h_A_1-49_135-16883 (A:1-49,A:135-168) Transcription antitermination p 1e-16
1nz9_A_58 (A:) Transcription antitermination protein NUSG; t 5e-16
>2jvv_A (A:) Transcription antitermination protein NUSG; transcription factor, transcription regulation, transcription termination; NMR {Escherichia coli} PDB: 2k06_ALength = 181 Back     alignment and structure
 Score =  149 bits (377), Expect = 2e-37
 Identities = 80/174 (45%), Positives = 118/174 (67%), Gaps = 1/174 (0%)

Query: 3   PRWYIVQVYSNCEKKAVESIGGRLSRSGLDHLVTEITIPSERVVSVRKGRKVNSERRFFP 62
            RWY+VQ +S  E +   S+   +    ++ L  E+ +P+E VV +R G++  SER+FFP
Sbjct: 7   KRWYVVQAFSGFEGRVATSLREHIKLHNMEDLFGEVMVPTEEVVEIRGGQRRKSERKFFP 66

Query: 63  GYVLIKAVMTDKVYHTIKDTPKVIGFLG-TGENPSPVTDSEIEHIMNQVEAAVQRPVSSV 121
           GYVL++ VM D  +H ++  P+V+GF+G T + P+P++D E++ IMN+++    +P    
Sbjct: 67  GYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRPAPISDKEVDAIMNRLQQVGDKPRPKT 126

Query: 122 FFEVGERVCVSDGPFASFNGIVKNVDEEKSRVHVEVVIFGRVTPVELAYNQVEK 175
            FE GE V V+DGPFA FNG+V+ VD EKSR+ V V IFGR TPVEL ++QVEK
Sbjct: 127 LFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKVSVSIFGRATPVELDFSQVEK 180


>1nz8_A (A:) Transcription antitermination protein NUSG; transcription elongation, riken structural genomics/proteomics initiative, RSGI; NMR {Thermus thermophilus}Length = 119 Back     alignment and structure
>2oug_A (A:1-98) Transcriptional activator RFAH; transcription factor, virulence, transcription pausing, transcription elongation; 2.10A {Escherichia coli}Length = 98 Back     alignment and structure
>1m1h_A (A:1-49,A:135-168) Transcription antitermination protein NUSG; transcription termination, RNP motif, immunoglobulin fold, nucleic acid interaction; 1.95A {Aquifex aeolicus}Length = 83 Back     alignment and structure
>1nz9_A (A:) Transcription antitermination protein NUSG; transcription elongation, riken structural genomics/proteomics initiative, RSGI; NMR {Thermus thermophilus}Length = 58 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target177 transcription antitermination protein NusG [Candidatus
2jvv_A_181 Transcription antitermination protein NUSG; transc 100.0
1nz8_A_119 Transcription antitermination protein NUSG; transc 99.96
2oug_A_1-9898 Transcriptional activator RFAH; transcription fact 99.91
1m1h_A_1-49_135-16883 Transcription antitermination protein NUSG; transc 99.85
3ewg_A_91 NUSG, NGN, putative transcription antitermination 97.96
2exu_A_92-200109 Transcription initiation protein SPT4/SPT5; helixs 97.82
3h7h_B_106 Transcription elongation factor SPT5; helices surr 97.63
1nz9_A_58 Transcription antitermination protein NUSG; transc 99.56
2e6z_A_59 Transcription elongation factor SPT5; KOW motif, s 97.07
2e70_A_71 Transcription elongation factor SPT5; KOW motif, s 96.62
1vq8_T_20-120101 50S ribosomal protein L24P; ribosome 50S, protein- 96.59
2zjr_R_1-8787 50S ribosomal protein L24; ribosome, large ribosom 96.34
2do3_A_69 Transcription elongation factor SPT5; KOW motif, s 96.06
2ckk_A_73-12755 KIN17; beta barrel, ribosomal protein, ribonucleop 96.05
3bbo_W_1-140140 Ribosomal protein L24; large ribosomal subunit, sp 95.83
2j01_Y_1-7878 50S ribosomal protein L24; ribosome, tRNA, paromom 93.46
2jz2_A_66 SSL0352 protein; SH3-like, synechocystis SP. PCC 6 91.99
>2jvv_A (A:) Transcription antitermination protein NUSG; transcription factor, transcription regulation, transcription termination; NMR {Escherichia coli} PDB: 2k06_A Back     alignment and structure
Probab=100.00  E-value=7.5e-42  Score=270.20  Aligned_cols=174  Identities=45%  Similarity=0.884  Sum_probs=165.7

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHHHHCCCHHHCCEEEEECCCCEEEECCEEEEEECCEECEEEEEEEECCCCCHHHHHCC
Q ss_conf             86189995288538999999999997798111432663131012772020356641203309999996186522444203
Q gi|254780148|r    3 PRWYIVQVYSNCEKKAVESIGGRLSRSGLDHLVTEITIPSERVVSVRKGRKVNSERRFFPGYVLIKAVMTDKVYHTIKDT   82 (177)
Q Consensus         3 ~~Wyvv~t~~~~E~~v~~~L~~~~~~~~~~~~~~~v~~P~~~~~~~~~g~~~~~~~plfpgYiFv~~~~~~~~~~~i~~t   82 (177)
                      ++||+++|+||+|.+|+++|++++...++++.++++|+|++..++.++|+++.+.+|+|||||||+++.+++.|..++++
T Consensus         7 ~~WYvl~~~~~~E~~v~~~L~~~~~~~~~~~~g~~~f~P~~~~~~~~~g~~~~~~~plfpgYvFv~~~~~~~~~~~i~~~   86 (181)
T 2jvv_A            7 KRWYVVQAFSGFEGRVATSLREHIKLHNMEDLFGEVMVPTEEVVEIRGGQRRKSERKFFPGYVLVQMVMNDASWHLVRSV   86 (181)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             CEEEEEEEECCCHHHHHHHHHHHHHHHCHHHCCEEEEEEEEEEEEEECCCEEEEEEEEEEEEEEEEEECCCCCEEEEEEC
T ss_conf             74999993689369999999999987060120208886454799990783279888975008999997278735899705


Q ss_pred             CEEEEEECC-CCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEECCCCCCCEEEEEEECCCCCEEEEEEEECC
Q ss_conf             303664327-8861002588999999765322210000123478977999518778971999998288988999998168
Q gi|254780148|r   83 PKVIGFLGT-GENPSPVTDSEIEHIMNQVEAAVQRPVSSVFFEVGERVCVSDGPFASFNGIVKNVDEEKSRVHVEVVIFG  161 (177)
Q Consensus        83 ~gV~~~l~~-~~~P~~i~~~ei~~l~~~~~~~~~~~~~~~~~~~G~~V~I~~Gpf~g~~g~v~~i~~~~~r~~V~v~i~G  161 (177)
                      +|+++++++ +++|++||+++|+.|+..++...........+.+|+.|+|++|||+|++|.|.++|++++++.|.+++||
T Consensus        87 ~gv~~~v~~~~~~p~~i~~~~~~~l~~~~~~~~~~~~~~~~~~~G~~VrI~~Gpf~G~~g~i~~v~~~~~r~~v~i~~~g  166 (181)
T 2jvv_A           87 PRVMGFIGGTSDRPAPISDKEVDAIMNRLQQVGDKPRPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKVSVSIFG  166 (181)
T ss_dssp             ------------------------------------CCCCCCCTTEEEEECSSTTTTEEEEEEEEETTTTEEEEEEEETT
T ss_pred             CCEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCEEECCCEEEEECCCCCCCEEEEEEECCCCCEEEEEEEECC
T ss_conf             63688347876688876878964222223431345663210247868999047899957999998388899999999779


Q ss_pred             CEEEEEECHHHHEEC
Q ss_conf             704788567871233
Q gi|254780148|r  162 RVTPVELAYNQVEKI  176 (177)
Q Consensus       162 r~~~v~l~~~~ieki  176 (177)
                      +.++|+++.++|||+
T Consensus       167 ~~~~v~v~~~~ie~v  181 (181)
T 2jvv_A          167 RATPVELDFSQVEKA  181 (181)
T ss_dssp             EEEEEEECTTTEEEC
T ss_pred             CCEEEEECHHHEECC
T ss_conf             956899878998819



>1nz8_A (A:) Transcription antitermination protein NUSG; transcription elongation, riken structural genomics/proteomics initiative, RSGI; NMR {Thermus thermophilus} Back     alignment and structure
>2oug_A (A:1-98) Transcriptional activator RFAH; transcription factor, virulence, transcription pausing, transcription elongation; 2.10A {Escherichia coli} Back     alignment and structure
>1m1h_A (A:1-49,A:135-168) Transcription antitermination protein NUSG; transcription termination, RNP motif, immunoglobulin fold, nucleic acid interaction; 1.95A {Aquifex aeolicus} Back     alignment and structure
>3ewg_A (A:) NUSG, NGN, putative transcription antitermination protein NUSG; alpha/beta structure, antiparallel beta sheet; 2.04A {Methanocaldococcus jannaschii} Back     alignment and structure
>2exu_A (A:92-200) Transcription initiation protein SPT4/SPT5; helixs surrounding beta sheet; 2.23A {Saccharomyces cerevisiae} Back     alignment and structure
>3h7h_B (B:) Transcription elongation factor SPT5; helices surrounding beta sheet, activator, metal-binding, nucleus, repressor, transcription regulation, zinc; 1.55A {Homo sapiens} Back     alignment and structure
>1nz9_A (A:) Transcription antitermination protein NUSG; transcription elongation, riken structural genomics/proteomics initiative, RSGI; NMR {Thermus thermophilus} Back     alignment and structure
>2e6z_A (A:) Transcription elongation factor SPT5; KOW motif, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e70_A (A:) Transcription elongation factor SPT5; KOW motif, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vq8_T (T:20-120) 50S ribosomal protein L24P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} Back     alignment and structure
>2zjr_R (R:1-87) 50S ribosomal protein L24; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} Back     alignment and structure
>2do3_A (A:) Transcription elongation factor SPT5; KOW motif, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ckk_A (A:73-127) KIN17; beta barrel, ribosomal protein, ribonucleoprotein, nuclear protein; 1.45A {Homo sapiens} Back     alignment and structure
>3bbo_W (W:1-140) Ribosomal protein L24; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>2j01_Y (Y:1-78) 50S ribosomal protein L24; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} Back     alignment and structure
>2jz2_A (A:) SSL0352 protein; SH3-like, synechocystis SP. PCC 6803, target SGR42, PSI, protein structure initiative; NMR {Synechocystis SP} PDB: 3c4s_A Back     alignment and structure