254780152

254780152

D-3-phosphoglycerate dehydrogenase

GeneID in NCBI database:8209129Locus tag:CLIBASIA_00175
Protein GI in NCBI database:254780152Protein Accession:YP_003064565.1
Gene range:-(35674, 35922)Protein Length:82aa
Gene description:D-3-phosphoglycerate dehydrogenase
COG prediction:[H] [E] Phosphoglycerate dehydrogenase and related dehydrogenases
KEGG prediction:D-3-phosphoglycerate dehydrogenase; K00058 D-3-phosphoglycerate dehydrogenase [EC:1.1.1.95]
SEED prediction:D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95)
Pathway involved in KEGG:Methane metabolism [PATH:las00680]
Glycine, serine and threonine metabolism [PATH:las00260]
Subsystem involved in SEED:Glycine and Serine Utilization;
Serine Biosynthesis;
Pyridoxin (Vitamin B6) Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--
MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTHKGKWEKFNFMGVEAG
cHHHcccccEEEEcccccccccHHHHHHcccEEEEccccccHHHHHHHHHHHHHHHHcHHHHHHHHHccccccccccccccc
cccHccccEEEEEcccccccccHHHHHcccEEEEEccccccHHHHHHHHHHHHHHHHHccHHcHHHccccccHHcccEEEcc
MLSHAKKMKVvgragigtdnVDLVVASRAGivvmntpfgnsiTTAEHAISLMLAIARQipvanesthkgkwekfnfmgveag
mlshakkmkvvgragigtdnvDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVAnesthkgkwekfnFMGVEAG
MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTHKGKWEKFNFMGVEAG
M*S*AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTHKGKWEKFNFMGVEAG
MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTHKGKWEKFNFMGVEAG
MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTHKGKWEKFNFMGVEAG
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTHKGKWEKFNFMGVEAG
MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTHKGKWEKFNFMGVEAG
MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTHKGKWEKFNFMGVEAG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target82 D-3-phosphoglycerate dehydrogenase [Candidatus Liberiba
154252585 525 D-3-phosphoglycerate dehydrogenase [Parvibaculum lavame 1 7e-28
159045858 531 D-3-phosphoglycerate dehydrogenase [Dinoroseobacter shi 1 7e-28
84514603 530 D-3-phosphoglycerate dehydrogenase [Loktanella vestfold 1 1e-27
126733884 530 D-3-phosphoglycerate dehydrogenase [Roseobacter sp. CCS 1 1e-27
304394494 533 phosphoglycerate dehydrogenase [Ahrensia sp. R2A130] Le 1 2e-27
254700347 533 D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 5 1 2e-27
256160401 533 D-3-phosphoglycerate dehydrogenase [Brucella ceti M490/ 1 2e-27
254708700 533 D-3-phosphoglycerate dehydrogenase [Brucella pinnipedia 1 2e-27
23502543 533 D-3-phosphoglycerate dehydrogenase [Brucella suis 1330] 1 2e-27
294850937 533 phosphoglycerate dehydrogenase [Brucella sp. NVSL 07-00 1 2e-27
>gi|154252585|ref|YP_001413409.1| D-3-phosphoglycerate dehydrogenase [Parvibaculum lavamentivorans DS-1] Length = 525 Back     alignment and organism information
 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 59/80 (73%), Positives = 68/80 (85%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ AKK+KVVGRAGIG DNVDL  A+ AG++VMNTPFGNSITTAEHAI++M A+AR IP
Sbjct: 58  VLAAAKKLKVVGRAGIGVDNVDLPAATAAGVIVMNTPFGNSITTAEHAIAMMFALARDIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN STH GKWEK  FMGVE
Sbjct: 118 QANASTHAGKWEKSKFMGVE 137


Species: Parvibaculum lavamentivorans
Genus: Parvibaculum
Family: Phyllobacteriaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|159045858|ref|YP_001534652.1| D-3-phosphoglycerate dehydrogenase [Dinoroseobacter shibae DFL 12] Length = 531 Back     alignment and organism information
>gi|84514603|ref|ZP_01001967.1| D-3-phosphoglycerate dehydrogenase [Loktanella vestfoldensis SKA53] Length = 530 Back     alignment and organism information
>gi|126733884|ref|ZP_01749631.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. CCS2] Length = 530 Back     alignment and organism information
>gi|304394494|ref|ZP_07376415.1| phosphoglycerate dehydrogenase [Ahrensia sp. R2A130] Length = 533 Back     alignment and organism information
>gi|254700347|ref|ZP_05162175.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 5 str. 513] Length = 533 Back     alignment and organism information
>gi|256160401|ref|ZP_05458090.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M490/95/1] Length = 533 Back     alignment and organism information
>gi|254708700|ref|ZP_05170511.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis B2/94] Length = 533 Back     alignment and organism information
>gi|23502543|ref|NP_698670.1| D-3-phosphoglycerate dehydrogenase [Brucella suis 1330] Length = 533 Back     alignment and organism information
>gi|294850937|ref|ZP_06791613.1| phosphoglycerate dehydrogenase [Brucella sp. NVSL 07-0026] Length = 533 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target82 D-3-phosphoglycerate dehydrogenase [Candidatus Liberiba
PRK13581 526 PRK13581, PRK13581, D-3-phosphoglycerate dehydrogenase; 3e-35
TIGR01327 525 TIGR01327, PGDH, D-3-phosphoglycerate dehydrogenase 7e-27
KOG0068 406 KOG0068, KOG0068, KOG0068, D-3-phosphoglycerate dehydro 1e-20
COG0111 324 COG0111, SerA, Phosphoglycerate dehydrogenase and relat 6e-20
COG1052 324 COG1052, LdhA, Lactate dehydrogenase and related dehydr 2e-14
PRK11790 409 PRK11790, PRK11790, D-3-phosphoglycerate dehydrogenase; 7e-13
PRK13243 333 PRK13243, PRK13243, glyoxylate reductase; Reviewed 2e-10
PRK07574 385 PRK07574, PRK07574, formate dehydrogenase; Provisional 2e-10
KOG0069 336 KOG0069, KOG0069, KOG0069, Glyoxylate/hydroxypyruvate r 2e-08
PRK06487 317 PRK06487, PRK06487, glycerate dehydrogenase; Provisiona 3e-08
PLN02928 347 PLN02928, PLN02928, oxidoreductase family protein 1e-07
PLN02306 386 PLN02306, PLN02306, hydroxypyruvate reductase 2e-06
PRK06932 314 PRK06932, PRK06932, glycerate dehydrogenase; Provisiona 2e-06
PRK15409 323 PRK15409, PRK15409, bifunctional glyoxylate/hydroxypyru 2e-06
PRK08410 311 PRK08410, PRK08410, 2-hydroxyacid dehydrogenase; Provis 1e-05
PRK06436 303 PRK06436, PRK06436, glycerate dehydrogenase; Provisiona 2e-04
PLN03139 386 PLN03139, PLN03139, formate dehydrogenase; Provisional 2e-04
PRK15438 378 PRK15438, PRK15438, erythronate-4-phosphate dehydrogena 0.004
pfam00389 313 pfam00389, 2-Hacid_dh, D-isomer specific 2-hydroxyacid 2e-22
>gnl|CDD|184162 PRK13581, PRK13581, D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|162302 TIGR01327, PGDH, D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>gnl|CDD|35291 KOG0068, KOG0068, KOG0068, D-3-phosphoglycerate dehydrogenase, D-isomer-specific 2-hydroxy acid dehydrogenase superfamily [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|30460 COG0111, SerA, Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|31252 COG1052, LdhA, Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|183316 PRK11790, PRK11790, D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183914 PRK13243, PRK13243, glyoxylate reductase; Reviewed Back     alignment and domain information
>gnl|CDD|181041 PRK07574, PRK07574, formate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|35292 KOG0069, KOG0069, KOG0069, Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|180588 PRK06487, PRK06487, glycerate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|178516 PLN02928, PLN02928, oxidoreductase family protein Back     alignment and domain information
>gnl|CDD|177941 PLN02306, PLN02306, hydroxypyruvate reductase Back     alignment and domain information
>gnl|CDD|168735 PRK06932, PRK06932, glycerate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|185307 PRK15409, PRK15409, bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>gnl|CDD|181414 PRK08410, PRK08410, 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|102375 PRK06436, PRK06436, glycerate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|178684 PLN03139, PLN03139, formate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|185335 PRK15438, PRK15438, erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>gnl|CDD|144107 pfam00389, 2-Hacid_dh, D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 82 D-3-phosphoglycerate dehydrogenase [Candidatus Liberiba
PRK13581 524 D-3-phosphoglycerate dehydrogenase; Provisional 99.93
PRK11790 409 D-3-phosphoglycerate dehydrogenase; Provisional 99.93
PRK07574 385 formate dehydrogenase; Provisional 99.92
pfam00389 313 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenas 99.91
PRK13243 333 glyoxylate reductase; Reviewed 99.91
PRK06932 314 glycerate dehydrogenase; Provisional 99.89
COG1052 324 LdhA Lactate dehydrogenase and related dehydrogenases [ 99.89
PRK08605 332 D-lactate dehydrogenase; Validated 99.89
PRK06487 317 glycerate dehydrogenase; Provisional 99.88
PRK08410 311 2-hydroxyacid dehydrogenase; Provisional 99.88
PRK12480 330 D-lactate dehydrogenase; Provisional 99.88
COG0111 324 SerA Phosphoglycerate dehydrogenase and related dehydro 99.85
KOG0068 406 consensus 99.84
PRK06436 303 glycerate dehydrogenase; Provisional 99.83
KOG0069 336 consensus 99.75
PRK00257 379 erythronate-4-phosphate dehydrogenase; Validated 99.6
TIGR01327 535 PGDH D-3-phosphoglycerate dehydrogenase; InterPro: IPR0 99.54
KOG0067 435 consensus 98.61
pfam02826 176 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogen 96.66
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>pfam00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0068 consensus Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>KOG0069 consensus Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase; InterPro: IPR006236 This group of sequences represent the long form of D-3-phosphoglycerate dehydrogenase, they include the serA gene of one pathway of serine biosynthesis Back     alignment and domain information
>KOG0067 consensus Back     alignment and domain information
>pfam02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target82 D-3-phosphoglycerate dehydrogenase [Candidatus Liberiba
2g76_A 335 Crystal Structure Of Human 3-Phosphoglycerate Dehyd 2e-18
1wwk_A 307 Crystal Structure Of Phosphoglycerate Dehydrogenase 6e-18
1ygy_A 529 Crystal Structure Of D-3-Phosphoglycerate Dehydroge 1e-14
3ddn_A 528 Crystal Structure Of Hydroxypyruvic Acid Phosphate 1e-14
2d0i_A 333 Crystal Structure Ph0520 Protein From Pyrococcus Ho 1e-11
2dbq_A 334 Crystal Structure Of Glyoxylate Reductase (Ph0597) 3e-10
2dbr_A 334 Crystal Structure Of Glyoxylate Reductase (Ph0597) 3e-10
3fn4_A 401 Apo-Form Of Nad-Dependent Formate Dehydrogenase Fro 5e-10
2gsd_A 402 Nad-Dependent Formate Dehydrogenase From Bacterium 5e-10
3ba1_A 333 Structure Of Hydroxyphenylpyruvate Reductase From C 1e-09
2ekl_A 313 Structure Of St1218 Protein From Sulfolobus Tokodai 1e-09
2gug_A 401 Nad-Dependent Formate Dehydrogenase From Pseudomona 3e-09
2nac_A 393 High Resolution Structures Of Holo And Apo Formate 3e-09
2go1_A 401 Nad-Dependent Formate Dehydrogenase From Pseudomona 3e-09
1psd_B 406 The Allosteric Ligand Site In The Vmax-Type Coopera 2e-08
1yba_A 410 The Active Form Of Phosphoglycerate Dehydrogenase L 2e-08
2gcg_A 330 Ternary Crystal Structure Of Human Glyoxylate Reduc 2e-08
2pi1_B 334 Crystal Structure Of D-Lactate Dehydrogenase From A 3e-08
2h1s_A 328 Crystal Structure Of A GlyoxylateHYDROXYPYRUVATE RE 3e-08
2fss_A 365 Candida Boidinii Formate Dehydrogenase (Fdh) K47e M 5e-08
2j6i_A 364 Candida Boidinii Formate Dehydrogenase (Fdh) C-Term 5e-08
2p9c_A 410 Crystal Structure Of Serine Bound G336v Mutant Of E 1e-07
2p9g_A 410 Crystal Structure Of Serine Bound G336v,G337v Doubl 1e-07
3k5p_A 416 Crystal Structure Of Amino Acid-Binding Act: D-Isom 2e-07
3gg9_A 352 Crystal Structure Of Putative D-3-Phosphoglycerate 3e-07
1gdh_A 320 Crystal Structure Of A Nad-Dependent D-Glycerate De 1e-06
2cuk_A 311 Crystal Structure Of Tt0316 Protein From Thermus Th 8e-06
3ga0_A 358 Ctbp1BARS GLY172->glu Mutant Structure: Impairing N 2e-05
1hku_A 358 CtbpBARS: A DUAL-Function Protein Involved In Trans 2e-05
1hl3_A 358 CtbpBARS IN TERNARY COMPLEX WITH NAD(H) AND PIDLSKK 2e-05
1sc6_A 404 Crystal Structure Of W139g D-3-Phosphoglycerate Deh 2e-05
2ome_A 336 Crystal Structure Of Human Ctbp2 Dehydrogenase Comp 3e-05
1mx3_A 347 Crystal Structure Of Ctbp Dehydrogenase Core Holo F 3e-05
1dxy_A 333 Structure Of D-2-Hydroxyisocaproate Dehydrogenase L 4e-04
2w2l_D 348 Crystal Structure Of The Holo Forms Of Rhodotorula 0.004
2w2k_B 348 Crystal Structure Of The Apo Forms Of Rhodotorula G 0.004
2w2k_A 348 Crystal Structure Of The Apo Forms Of Rhodotorula G 0.004
>gi|93279902|pdb|2G76|A Chain A, Crystal Structure Of Human 3-Phosphoglycerate Dehydrogenase Length = 335 Back     alignment and structure
 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 83  VINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIP 142

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWE+  FMG E 
Sbjct: 143 QATASMKDGKWERKKFMGTEL 163


gi|88191759|pdb|1WWK|A Chain A, Crystal Structure Of Phosphoglycerate Dehydrogenase From Pyrococcus Horikoshii Ot3 Length = 307 Back     alignment and structure
>gi|60594357|pdb|1YGY|A Chain A, Crystal Structure Of D-3-Phosphoglycerate Dehydrogenase From Mycobacterium Tuberculosis Length = 529 Back     alignment and structure
>gi|194368789|pdb|3DDN|A Chain A, Crystal Structure Of Hydroxypyruvic Acid Phosphate Bound D- 3-Phosphoglycerate Dehydrogenase In Mycobacterium Tuberculosis Length = 528 Back     alignment and structure
gi|90109156|pdb|2D0I|A Chain A, Crystal Structure Ph0520 Protein From Pyrococcus Horikoshii Ot3 Length = 333 Back     alignment and structure
>gi|110591181|pdb|2DBQ|A Chain A, Crystal Structure Of Glyoxylate Reductase (Ph0597) From Pyrococcus Horikoshii Ot3, Complexed With Nadp (I41) Length = 334 Back     alignment and structure
gi|110591182|pdb|2DBR|A Chain A, Crystal Structure Of Glyoxylate Reductase (Ph0597) From Pyrococcus Horikoshii Ot3, Complexed With Nadp (P1) Length = 334 Back     alignment and structure
>gi|270047600|pdb|3FN4|A Chain A, Apo-Form Of Nad-Dependent Formate Dehydrogenase From Bacterium Moraxella Sp.C-1 In Closed Conformation Length = 401 Back     alignment and structure
>gi|109158019|pdb|2GSD|A Chain A, Nad-Dependent Formate Dehydrogenase From Bacterium Moraxella Sp.C2 In Complex With Nad And Azide Length = 402 Back     alignment and structure
>gi|212374928|pdb|3BA1|A Chain A, Structure Of Hydroxyphenylpyruvate Reductase From Coleus Blu Length = 333 Back     alignment and structure
gi|170784951|pdb|2EKL|A Chain A, Structure Of St1218 Protein From Sulfolobus Tokodaii Length = 313 Back     alignment and structure
>gi|109158073|pdb|2GUG|A Chain A, Nad-Dependent Formate Dehydrogenase From Pseudomonas Sp.101 In Complex With Formate Length = 401 Back     alignment and structure
>gi|999845|pdb|2NAC|A Chain A, High Resolution Structures Of Holo And Apo Formate Dehydrogenase Length = 393 Back     alignment and structure
gi|99032655|pdb|2GO1|A Chain A, Nad-Dependent Formate Dehydrogenase From Pseudomonas Sp.101 Length = 401 Back     alignment and structure
>gi|66360690|pdb|1YBA|A Chain A, The Active Form Of Phosphoglycerate Dehydrogenase Length = 410 Back     alignment and structure
>gi|112490731|pdb|2GCG|A Chain A, Ternary Crystal Structure Of Human Glyoxylate ReductaseHYDROXYPYRUVATE REDUCTASE Length = 330 Back     alignment and structure
>gi|110590506|pdb|2H1S|A Chain A, Crystal Structure Of A GlyoxylateHYDROXYPYRUVATE REDUCTASE From Homo Sapiens Length = 328 Back     alignment and structure
>gi|134104288|pdb|2FSS|A Chain A, Candida Boidinii Formate Dehydrogenase (Fdh) K47e Mutant Length = 365 Back     alignment and structure
>gi|149242255|pdb|2J6I|A Chain A, Candida Boidinii Formate Dehydrogenase (Fdh) C-Terminal Mutant Length = 364 Back     alignment and structure
>gi|146387102|pdb|2P9C|A Chain A, Crystal Structure Of Serine Bound G336v Mutant Of E.Coli Phosphoglycerate Dehydrogenase Length = 410 Back     alignment and structure
>gi|146387108|pdb|2P9G|A Chain A, Crystal Structure Of Serine Bound G336v,G337v Double Mutant Of E.Coli Phosphoglycerate Dehydrogenase Length = 410 Back     alignment and structure
>gi|262368138|pdb|3K5P|A Chain A, Crystal Structure Of Amino Acid-Binding Act: D-Isomer Specific 2-Hydroxyacid Dehydrogenase Catalytic Domain From Brucella Melitensis Length = 416 Back     alignment and structure
>gi|225734260|pdb|3GG9|A Chain A, Crystal Structure Of Putative D-3-Phosphoglycerate Dehydrogenase Oxidoreductase From Ralstonia Solanacearum Length = 352 Back     alignment and structure
>gi|494035|pdb|1GDH|A Chain A, Crystal Structure Of A Nad-Dependent D-Glycerate Dehydrogenase At 2.4 Angstroms Resolution Length = 320 Back     alignment and structure
gi|114793632|pdb|2CUK|A Chain A, Crystal Structure Of Tt0316 Protein From Thermus Thermophilus Hb8 Length = 311 Back     alignment and structure
>gi|227343811|pdb|3GA0|A Chain A, Ctbp1BARS GLY172->glu Mutant Structure: Impairing Nad(H) Binding And Dimerization Length = 358 Back     alignment and structure
>gi|33356997|pdb|1HKU|A Chain A, CtbpBARS: A DUAL-Function Protein Involved In Transcription Corepression And Golgi Membrane Fission Length = 358 Back     alignment and structure
>gi|33357012|pdb|1HL3|A Chain A, CtbpBARS IN TERNARY COMPLEX WITH NAD(H) AND PIDLSKK PEPTIDE Length = 358 Back     alignment and structure
>gi|61679883|pdb|1SC6|A Chain A, Crystal Structure Of W139g D-3-Phosphoglycerate Dehydrogenase Complexed With Nad+ Length = 404 Back     alignment and structure
>gi|126031658|pdb|2OME|A Chain A, Crystal Structure Of Human Ctbp2 Dehydrogenase Complexed With Nad(H) Length = 336 Back     alignment and structure
>gi|27574013|pdb|1MX3|A Chain A, Crystal Structure Of Ctbp Dehydrogenase Core Holo Form Length = 347 Back     alignment and structure
gi|157830898|pdb|1DXY|A Chain A, Structure Of D-2-Hydroxyisocaproate Dehydrogenase Length = 333 Back     alignment and structure
>gi|268612124|pdb|2W2L|D Chain D, Crystal Structure Of The Holo Forms Of Rhodotorula Graminis D-Mandelate Dehydrogenase At 2.5a Length = 348 Back     alignment and structure
>gi|268612120|pdb|2W2K|B Chain B, Crystal Structure Of The Apo Forms Of Rhodotorula Graminis D-Mandelate Dehydrogenase At 1.8a Length = 348 Back     alignment and structure
>gi|268612119|pdb|2W2K|A Chain A, Crystal Structure Of The Apo Forms Of Rhodotorula Graminis D-Mandelate Dehydrogenase At 1.8a. Length = 348 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target82 D-3-phosphoglycerate dehydrogenase [Candidatus Liberiba
1dxy_A 333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarbox 1e-17
1mx3_A 347 CTBP1, C-terminal binding protein 1; nuclear protein, p 2e-16
3jtm_A 351 Formate dehydrogenase, mitochondrial; mitochondrion, NA 1e-14
1j4a_A 333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehydroge 5e-14
1qp8_A 303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A 2e-13
1gdh_A 320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD( 3e-12
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductas 1e-11
2nac_A 393 NAD-dependent formate dehydrogenase; oxidoreductase(ald 2e-11
3oet_A 381 Erythronate-4-phosphate dehydrogenase; structural genom 1e-09
3gvx_A 290 Glycerate dehydrogenase related protein; NYSGXRC, PSI-I 1e-09
2j6i_A 364 Formate dehydrogenase; oxidoreductase, D-specific-2- hy 3e-08
2w2k_A 348 D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, 2e-07
3hg7_A 324 D-isomer specific 2-hydroxyacid dehydrogenase family pr 1e-06
3kbo_A 315 Glyoxylate/hydroxypyruvate reductase A; NADP, cytoplasm 2e-06
2pi1_A 334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, 3D 6e-06
2g76_A 335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreduct 9e-06
3evt_A 324 Phosphoglycerate dehydrogenase; structural genomics, PS 2e-05
2o4c_A 380 Erythronate-4-phosphate dehydrogenase; erythronate-4-ph 2e-05
3ba1_A 333 HPPR, hydroxyphenylpyruvate reductase; two domain prote 2e-04
3k5p_A 416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seat 0.002
1sc6_A 404 PGDH, D-3-phosphoglycerate dehydrogenase; allosteric re 0.003
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenase, oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Length = 333 Back     alignment and structure
 Score = 83.2 bits (205), Expect = 1e-17
 Identities = 24/80 (30%), Positives = 38/80 (47%), Gaps = 1/80 (1%)

Query: 4   HAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVAN 63
           HA  +K +    +GTDN+D+    + GI + N P  +    AE A++  L + R +    
Sbjct: 65  HAYGIKFLTIRNVGTDNIDMTAMKQYGIRLSNVPAYSPAAIAEFALTDTLYLLRNMGKVQ 124

Query: 64  ESTHKGKWEKFN-FMGVEAG 82
                G +EK   F+G E G
Sbjct: 125 AQLQAGDYEKAGTFIGKELG 144


>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepressor, transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Length = 347 Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Length = 351 Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Length = 333 Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Length = 303 Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Length = 320 Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosynthesis, structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Length = 529 Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* Length = 393 Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Length = 381 Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Length = 290 Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Length = 364 Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Length = 348 Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase family protein; structural genomics, protein structure initiative; 1.80A {Aeromonas salmonicida subsp} Length = 324 Back     alignment and structure
>3kbo_A Glyoxylate/hydroxypyruvate reductase A; NADP, cytoplasm, NAD, structural genomics; HET: NDP NDB EPE; 2.14A {Salmonella enterica subsp} Length = 315 Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, serine metabolism; HET: NAD; 1.70A {Homo sapiens} Length = 335 Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Length = 324 Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosphate ION, oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Length = 380 Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor binding domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Length = 333 Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infectious disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Length = 416 Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Length = 404 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target82 D-3-phosphoglycerate dehydrogenase [Candidatus Liberiba
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductas 99.88
2g76_A 335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreduct 99.88
1sc6_A 404 PGDH, D-3-phosphoglycerate dehydrogenase; allosteric re 99.86
3k5p_A 416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seat 99.86
1mx3_A 347 CTBP1, C-terminal binding protein 1; nuclear protein, p 99.86
2nac_A 393 NAD-dependent formate dehydrogenase; oxidoreductase(ald 99.86
3ba1_A 333 HPPR, hydroxyphenylpyruvate reductase; two domain prote 99.85
3jtm_A 351 Formate dehydrogenase, mitochondrial; mitochondrion, NA 99.82
2w2k_A 348 D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, 99.82
2d0i_A 333 Dehydrogenase; structural genomics, NPPSFA, national pr 99.8
2j6i_A 364 Formate dehydrogenase; oxidoreductase, D-specific-2- hy 99.8
1dxy_A 333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarbox 99.8
1j4a_A 333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehydroge 99.79
2dbq_A 334 Glyoxylate reductase; D-3-phosphoglycerate dehydrogenas 99.79
3evt_A 324 Phosphoglycerate dehydrogenase; structural genomics, PS 99.78
2pi1_A 334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, 3D 99.78
1xdw_A 331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; st 99.77
2cuk_A 311 Glycerate dehydrogenase/glyoxylate reductase; structura 99.75
1wwk_A 307 Phosphoglycerate dehydrogenase; riken structural genomi 99.75
1gdh_A 320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD( 99.75
2gcg_A 330 Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) 99.74
1qp8_A 303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A 99.74
3hg7_A 324 D-isomer specific 2-hydroxyacid dehydrogenase family pr 99.73
2ekl_A 313 D-3-phosphoglycerate dehydrogenase; structural genomics 99.73
3gg9_A 352 D-3-phosphoglycerate dehydrogenase oxidoreductase prote 99.72
3gvx_A 290 Glycerate dehydrogenase related protein; NYSGXRC, PSI-I 99.71
3kbo_A 315 Glyoxylate/hydroxypyruvate reductase A; NADP, cytoplasm 99.62
2o4c_A 380 Erythronate-4-phosphate dehydrogenase; erythronate-4-ph 99.5
3oet_A 381 Erythronate-4-phosphate dehydrogenase; structural genom 99.49
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosynthesis, structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
Probab=99.88  E-value=4.4e-23  Score=147.44  Aligned_cols=81  Identities=44%  Similarity=0.745  Sum_probs=78.1

Q ss_pred             CHHHCCCCCEEEECCCCCCCCCHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCCCCEEEE
Q ss_conf             80238898599981656088333674124413643143243552899999999997277999999985998611214001
Q gi|254780152|r    1 MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTHKGKWEKFNFMGVE   80 (82)
Q Consensus         1 il~~~~~Lk~I~~~g~G~d~ID~~~~~~~gI~v~n~~~~~~~sVAE~~i~l~L~l~R~~~~~~~~~~~g~W~~~~~~G~E   80 (82)
                      +|+++|+||+|+++|+|+||||+++|+++||.|+|+|++++.+||||++++||++.|+++.+++.+++|.|.+..+.|.|
T Consensus        60 ~l~~~p~LK~I~~~g~G~D~iD~~~a~~~gI~V~n~p~~~~~~vAE~~i~l~L~l~R~i~~~~~~~~~g~w~~~~~~~~~  139 (529)
T 1ygy_A           60 VLAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLAASRQIPAADASLREHTWKRSSFSGTE  139 (529)
T ss_dssp             HHHTCTTCCEEEESSSCCTTBCHHHHHHTTCEEECCTTSSHHHHHHHHHHHHHHHHTTHHHHHHHHHTTCCCGGGCCBCC
T ss_pred             HHHCCCCCCEEEECCCCCCCCCHHHHHHCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             98159998099999832341168879868999998898787999999999999987636899888861872002556631


Q ss_pred             C
Q ss_conf             7
Q gi|254780152|r   81 A   81 (82)
Q Consensus        81 l   81 (82)
                      |
T Consensus       140 L  140 (529)
T 1ygy_A          140 I  140 (529)
T ss_dssp             C
T ss_pred             C
T ss_conf             3



>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, serine metabolism; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infectious disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepressor, transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.95A {Pyrococcus horikoshii OT3} Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenase, oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, structural genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus HB8} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii OT3} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substrate-binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase family protein; structural genomics, protein structure initiative; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase protein; structural genomics, PSI-2, protein structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>3kbo_A Glyoxylate/hydroxypyruvate reductase A; NADP, cytoplasm, NAD, structural genomics; HET: NDP NDB EPE; 2.14A {Salmonella enterica subsp} Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosphate ION, oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 82 D-3-phosphoglycerate dehydrogenase [Candidatus Liberiba
d2naca2186 c.23.12.1 (A:1-147,A:336-374) Formate dehydrogenase {Ps 5e-12
d1j4aa2134 c.23.12.1 (A:2-103,A:301-332) D-lactate dehydrogenase { 9e-11
d1mx3a2133 c.23.12.1 (A:27-125,A:319-352) Transcription corepresso 4e-10
d1dxya2131 c.23.12.1 (A:1-100,A:300-330) D-2-hydroxyisocaproate de 1e-09
d1gdha2129 c.23.12.1 (A:2-100,A:292-321) D-glycerate dehydrogenase 3e-09
d1ygya2130 c.23.12.1 (A:3-98,A:283-316) Phosphoglycerate dehydroge 4e-09
d1qp8a2121 c.23.12.1 (A:1-82,A:264-302) Putative formate dehydroge 8e-07
d1sc6a2132 c.23.12.1 (A:7-107,A:296-326) Phosphoglycerate dehydrog 1e-06
d1ygya1 184 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Myco 1e-07
d1j4aa1 197 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacil 2e-07
d1sc6a1 188 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Esc 2e-07
d2naca1 188 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas 3e-07
d1gdha1 191 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomic 6e-07
d1qp8a1 181 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Arch 1e-06
d1dxya1 199 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenas 2e-06
d1mx3a1 193 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Hum 2e-06
>d2naca2 c.23.12.1 (A:1-147,A:336-374) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Length = 186 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Formate/glycerate dehydrogenase catalytic domain-like
family: Formate/glycerate dehydrogenases, substrate-binding domain
domain: Formate dehydrogenase
species: Pseudomonas sp., strain 101 [TaxId: 306]
 Score = 63.4 bits (154), Expect = 5e-12
 Identities = 21/79 (26%), Positives = 29/79 (36%), Gaps = 8/79 (10%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHA--------ISLM 52
            ++ AK +K+   AGIG+D+VDL  A    + V    + NS T    A        I   
Sbjct: 107 RIAKAKNLKLALTAGIGSDHVDLQSAIDRNVTVAEVTYCNSTTLTAQARYAAGTREILEC 166

Query: 53  LAIARQIPVANESTHKGKW 71
               R I         G  
Sbjct: 167 FFEGRPIRDEYLIVQGGAL 185


>d1j4aa2 c.23.12.1 (A:2-103,A:301-332) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Length = 134 Back     information, alignment and structure
>d1mx3a2 c.23.12.1 (A:27-125,A:319-352) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d1dxya2 c.23.12.1 (A:1-100,A:300-330) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Length = 131 Back     information, alignment and structure
>d1gdha2 c.23.12.1 (A:2-100,A:292-321) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Length = 129 Back     information, alignment and structure
>d1ygya2 c.23.12.1 (A:3-98,A:283-316) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 130 Back     information, alignment and structure
>d1qp8a2 c.23.12.1 (A:1-82,A:264-302) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 121 Back     information, alignment and structure
>d1sc6a2 c.23.12.1 (A:7-107,A:296-326) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 184 Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Length = 197 Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Length = 188 Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Length = 188 Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Length = 191 Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 181 Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Length = 199 Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Length = 193 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target82 D-3-phosphoglycerate dehydrogenase [Candidatus Liberiba
d1ygya2130 Phosphoglycerate dehydrogenase {Mycobacterium tuberculo 99.87
d2naca2186 Formate dehydrogenase {Pseudomonas sp., strain 101 [Tax 99.79
d1mx3a2133 Transcription corepressor CtbP {Human (Homo sapiens), C 99.78
d1dxya2131 D-2-hydroxyisocaproate dehydrogenase {Lactobacillus cas 99.76
d1sc6a2132 Phosphoglycerate dehydrogenase {Escherichia coli [TaxId 99.71
d1j4aa2134 D-lactate dehydrogenase {Lactobacillus helveticus [TaxI 99.66
d1gdha2129 D-glycerate dehydrogenase {Hyphomicrobium methylovorum 99.65
d1qp8a2121 Putative formate dehydrogenase {Archaeon Pyrobaculum ae 99.5
d1ygya1 184 Phosphoglycerate dehydrogenase {Mycobacterium tuberculo 98.59
d1sc6a1 188 Phosphoglycerate dehydrogenase {Escherichia coli [TaxId 98.41
d1gdha1 191 D-glycerate dehydrogenase {Hyphomicrobium methylovorum 98.22
d1dxya1 199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillus cas 98.2
d1j4aa1 197 D-lactate dehydrogenase {Lactobacillus helveticus [TaxI 98.2
d1mx3a1 193 Transcription corepressor CtbP {Human (Homo sapiens), C 98.15
d1qp8a1 181 Putative formate dehydrogenase {Archaeon Pyrobaculum ae 98.04
d2naca1 188 Formate dehydrogenase {Pseudomonas sp., strain 101 [Tax 97.98
>d1ygya2 c.23.12.1 (A:3-98,A:283-316) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Formate/glycerate dehydrogenase catalytic domain-like
family: Formate/glycerate dehydrogenases, substrate-binding domain
domain: Phosphoglycerate dehydrogenase
species: Mycobacterium tuberculosis [TaxId: 1773]
Probab=99.87  E-value=1.5e-23  Score=148.73  Aligned_cols=72  Identities=32%  Similarity=0.442  Sum_probs=69.3

Q ss_pred             CHHHCCCCCEEEECCCCCCCCCHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHCCCCC
Q ss_conf             802388985999816560883336741244136431432435528999999999972779999999859986
Q gi|254780152|r    1 MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTHKGKWE   72 (82)
Q Consensus         1 il~~~~~Lk~I~~~g~G~d~ID~~~~~~~gI~v~n~~~~~~~sVAE~~i~l~L~l~R~~~~~~~~~~~g~W~   72 (82)
                      +|+++|+||+|+++|+||||||+++|+++||.|+|+|++++.+|||++++|||+++|++..+++.+|+|.|.
T Consensus        58 ~l~~~p~Lk~I~~~g~G~d~IDl~~~~~~gI~V~n~p~~~~~~VAE~~~~l~L~l~R~i~~a~~~vr~g~~~  129 (130)
T d1ygya2          58 VLAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSASTAEAQDRAGTDVAESVRLALAGEFVPDAVNV  129 (130)
T ss_dssp             HHHTCTTCCEEEESSSCCTTBCHHHHHHTTCEEECCTTSSCBHHHHHHHHHHHHHHHHHHHTTCCCTTBCSC
T ss_pred             HHHHCCCCEEEEEECCCCCCHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             986302353886623446403499998779169946998708999999999999981278875544167418



>d2naca2 c.23.12.1 (A:1-147,A:336-374) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1mx3a2 c.23.12.1 (A:27-125,A:319-352) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1dxya2 c.23.12.1 (A:1-100,A:300-330) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1sc6a2 c.23.12.1 (A:7-107,A:296-326) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j4aa2 c.23.12.1 (A:2-103,A:301-332) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1gdha2 c.23.12.1 (A:2-100,A:292-321) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1qp8a2 c.23.12.1 (A:1-82,A:264-302) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 82 D-3-phosphoglycerate dehydrogenase [Candidatus Lib
1sc6_A_1-100_289-321133 (A:1-100,A:289-321) PGDH, D-3-phosphoglycerate deh 7e-09
3k5p_A_1-111_300-332144 (A:1-111,A:300-332) D-3-phosphoglycerate dehydroge 3e-08
2j6i_A_1-117_314-364168 (A:1-117,A:314-364) Formate dehydrogenase; oxidore 5e-08
2dbq_A_1-98_291-334142 (A:1-98,A:291-334) Glyoxylate reductase; D-3-phosp 6e-08
2nac_A_1-144_335-393203 (A:1-144,A:335-393) NAD-dependent formate dehydrog 6e-08
2g76_A_1-120_306-335150 (A:1-120,A:306-335) 3-PGDH, D-3-phosphoglycerate d 2e-07
1ygy_A_1-97_283-322137 (A:1-97,A:283-322) PGDH, D-3-phosphoglycerate dehy 2e-07
1qp8_A_1-80_264-303120 (A:1-80,A:264-303) Formate dehydrogenase; oxidored 2e-07
3evt_A_1-91_282-324134 (A:1-91,A:282-324) Phosphoglycerate dehydrogenase; 3e-07
1gdh_A_1-98_289-320130 (A:1-98,A:289-320) D-glycerate dehydrogenase; oxid 3e-07
2w2k_A_1-111_307-348153 (A:1-111,A:307-348) D-mandelate dehydrogenase; 2-h 3e-07
1wwk_A_1-97_284-307121 (A:1-97,A:284-307) Phosphoglycerate dehydrogenase; 4e-07
2o4c_A_1-90_258-287120 (A:1-90,A:258-287) Erythronate-4-phosphate dehydro 5e-07
2cuk_A_1-96_280-311128 (A:1-96,A:280-311) Glycerate dehydrogenase/glyoxyl 6e-07
2gcg_A_1-107_298-330140 (A:1-107,A:298-330) Glyoxylate reductase/hydroxypy 6e-07
3hg7_A_1-97_282-324140 (A:1-97,A:282-324) D-isomer specific 2-hydroxyacid 6e-07
2pi1_A_ 334 (A:) D-lactate dehydrogenase; oxidoreductase, D-LD 7e-07
1mx3_A_1-116_312-347152 (A:1-116,A:312-347) CTBP1, C-terminal binding prot 1e-06
1dxy_A_1-100_298-333136 (A:1-100,A:298-333) D-2-hydroxyisocaproate dehydro 1e-06
2d0i_A_1-94_287-333141 (A:1-94,A:287-333) Dehydrogenase; structural genom 2e-06
2ekl_A_1-99_286-313127 (A:1-99,A:286-313) D-3-phosphoglycerate dehydrogen 2e-06
3ba1_A_1-118_302-333150 (A:1-118,A:302-333) HPPR, hydroxyphenylpyruvate re 2e-06
1xdw_A_1-101_300-331133 (A:1-101,A:300-331) NAD+-dependent (R)-2-hydroxygl 4e-06
1j4a_A_1-102_300-333136 (A:1-102,A:300-333) D-LDH, D-lactate dehydrogenase 1e-05
3gg9_A_1-107_303-352157 (A:1-107,A:303-352) D-3-phosphoglycerate dehydroge 5e-05
1j4a_A_103-299 197 (A:103-299) D-LDH, D-lactate dehydrogenase; NAD-de 6e-07
1gdh_A_99-288 190 (A:99-288) D-glycerate dehydrogenase; oxidoreducta 6e-07
3k5p_A_112-299 188 (A:112-299) D-3-phosphoglycerate dehydrogenase; ni 1e-06
2ekl_A_100-285 186 (A:100-285) D-3-phosphoglycerate dehydrogenase; st 2e-06
3evt_A_92-281 190 (A:92-281) Phosphoglycerate dehydrogenase; structu 2e-06
2g76_A_121-305 185 (A:121-305) 3-PGDH, D-3-phosphoglycerate dehydroge 2e-06
2j6i_A_118-313 196 (A:118-313) Formate dehydrogenase; oxidoreductase, 3e-06
1sc6_A_101-288 188 (A:101-288) PGDH, D-3-phosphoglycerate dehydrogena 3e-06
3hg7_A_98-281 184 (A:98-281) D-isomer specific 2-hydroxyacid dehydro 4e-06
1xdw_A_102-299 198 (A:102-299) NAD+-dependent (R)-2-hydroxyglutarate 5e-06
3kbo_A_96-280 185 (A:96-280) Glyoxylate/hydroxypyruvate reductase A; 5e-06
1ygy_A_98-282 185 (A:98-282) PGDH, D-3-phosphoglycerate dehydrogenas 5e-06
2cuk_A_97-279 183 (A:97-279) Glycerate dehydrogenase/glyoxylate redu 5e-06
2nac_A_145-334 190 (A:145-334) NAD-dependent formate dehydrogenase; o 5e-06
2gcg_A_108-297 190 (A:108-297) Glyoxylate reductase/hydroxypyruvate r 5e-06
1wwk_A_98-283 186 (A:98-283) Phosphoglycerate dehydrogenase; riken s 6e-06
2w2k_A_112-306 195 (A:112-306) D-mandelate dehydrogenase; 2-hydroxyac 7e-06
3ba1_A_119-301 183 (A:119-301) HPPR, hydroxyphenylpyruvate reductase; 8e-06
2dbq_A_99-290 192 (A:99-290) Glyoxylate reductase; D-3-phosphoglycer 8e-06
1qp8_A_81-263 183 (A:81-263) Formate dehydrogenase; oxidoreductase; 1e-05
3gvx_A_79-259 181 (A:79-259) Glycerate dehydrogenase related protein 2e-05
1mx3_A_117-311 195 (A:117-311) CTBP1, C-terminal binding protein 1; n 2e-05
2d0i_A_95-286 192 (A:95-286) Dehydrogenase; structural genomics, NPP 3e-05
3gg9_A_108-302 195 (A:108-302) D-3-phosphoglycerate dehydrogenase oxi 3e-05
1dxy_A_101-297 197 (A:101-297) D-2-hydroxyisocaproate dehydrogenase; 8e-05
2o4c_A_91-257 167 (A:91-257) Erythronate-4-phosphate dehydrogenase; 0.001
>1sc6_A (A:1-100,A:289-321) PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli}Length = 133 Back     alignment and structure
 Score = 54.0 bits (130), Expect = 7e-09
 Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 3/59 (5%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +++ A+K+  +G   IGT+ VDL  A++ GI V N PFG S   A+  I L   +A ++
Sbjct: 63  VINAAEKLVAIGAFAIGTNQVDLDAAAKRGIPVFNAPFG-STQEAQENIGLE--VAGKL 118


>3k5p_A (A:1-111,A:300-332) D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infectious disease, brucellosis; 2.15A {Brucella melitensis biovar abortus}Length = 144 Back     alignment and structure
>2j6i_A (A:1-117,A:314-364) Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_ALength = 168 Back     alignment and structure
>2dbq_A (A:1-98,A:291-334) Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, structural genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A*Length = 142 Back     alignment and structure
>2nac_A (A:1-144,A:335-393) NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP}Length = 203 Back     alignment and structure
>2g76_A (A:1-120,A:306-335) 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, serine metabolism; HET: NAD; 1.70A {Homo sapiens}Length = 150 Back     alignment and structure
>1ygy_A (A:1-97,A:283-322) PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosynthesis, structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis}Length = 137 Back     alignment and structure
>1qp8_A (A:1-80,A:264-303) Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum}Length = 120 Back     alignment and structure
>3evt_A (A:1-91,A:282-324) Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum}Length = 134 Back     alignment and structure
>1gdh_A (A:1-98,A:289-320) D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum}Length = 130 Back     alignment and structure
>2w2k_A (A:1-111,A:307-348) D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_BLength = 153 Back     alignment and structure
>1wwk_A (A:1-97,A:284-307) Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii OT3}Length = 121 Back     alignment and structure
>2o4c_A (A:1-90,A:258-287) Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosphate ION, oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa}Length = 120 Back     alignment and structure
>2cuk_A (A:1-96,A:280-311) Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus HB8}Length = 128 Back     alignment and structure
>2gcg_A (A:1-107,A:298-330) Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substrate-binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2h1s_A 2q50_ALength = 140 Back     alignment and structure
>3hg7_A (A:1-97,A:282-324) D-isomer specific 2-hydroxyacid dehydrogenase family protein; structural genomics, protein structure initiative; 1.80A {Aeromonas salmonicida subsp}Length = 140 Back     alignment and structure
>1mx3_A (A:1-116,A:312-347) CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepressor, transcription repressor; HET: NAD; 1.95A {Homo sapiens}Length = 152 Back     alignment and structure
>1dxy_A (A:1-100,A:298-333) D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenase, oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei}Length = 136 Back     alignment and structure
>2d0i_A (A:1-94,A:287-333) Dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.95A {Pyrococcus horikoshii OT3}Length = 141 Back     alignment and structure
>2ekl_A (A:1-99,A:286-313) D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii}Length = 127 Back     alignment and structure
>3ba1_A (A:1-118,A:302-333) HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor binding domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A*Length = 150 Back     alignment and structure
>1xdw_A (A:1-101,A:300-331) NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans}Length = 133 Back     alignment and structure
>1j4a_A (A:1-102,A:300-333) D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp}Length = 136 Back     alignment and structure
>3gg9_A (A:1-107,A:303-352) D-3-phosphoglycerate dehydrogenase oxidoreductase protein; structural genomics, PSI-2, protein structure initiative; 1.90A {Ralstonia solanacearum}Length = 157 Back     alignment and structure
>1j4a_A (A:103-299) D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp}Length = 197 Back     alignment and structure
>1gdh_A (A:99-288) D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum}Length = 190 Back     alignment and structure
>3k5p_A (A:112-299) D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infectious disease, brucellosis; 2.15A {Brucella melitensis biovar abortus}Length = 188 Back     alignment and structure
>2ekl_A (A:100-285) D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii}Length = 186 Back     alignment and structure
>3evt_A (A:92-281) Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum}Length = 190 Back     alignment and structure
>2g76_A (A:121-305) 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, serine metabolism; HET: NAD; 1.70A {Homo sapiens}Length = 185 Back     alignment and structure
>2j6i_A (A:118-313) Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_ALength = 196 Back     alignment and structure
>1sc6_A (A:101-288) PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli}Length = 188 Back     alignment and structure
>3hg7_A (A:98-281) D-isomer specific 2-hydroxyacid dehydrogenase family protein; structural genomics, protein structure initiative; 1.80A {Aeromonas salmonicida subsp}Length = 184 Back     alignment and structure
>1xdw_A (A:102-299) NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans}Length = 198 Back     alignment and structure
>3kbo_A (A:96-280) Glyoxylate/hydroxypyruvate reductase A; NADP, cytoplasm, NAD, structural genomics; HET: NDP NDB EPE; 2.14A {Salmonella enterica subsp}Length = 185 Back     alignment and structure
>1ygy_A (A:98-282) PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosynthesis, structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis}Length = 185 Back     alignment and structure
>2cuk_A (A:97-279) Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus HB8}Length = 183 Back     alignment and structure
>2nac_A (A:145-334) NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP}Length = 190 Back     alignment and structure
>2gcg_A (A:108-297) Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substrate-binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2h1s_A 2q50_ALength = 190 Back     alignment and structure
>1wwk_A (A:98-283) Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii OT3}Length = 186 Back     alignment and structure
>2w2k_A (A:112-306) D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_BLength = 195 Back     alignment and structure
>3ba1_A (A:119-301) HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor binding domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A*Length = 183 Back     alignment and structure
>2dbq_A (A:99-290) Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, structural genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A*Length = 192 Back     alignment and structure
>1qp8_A (A:81-263) Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum}Length = 183 Back     alignment and structure
>3gvx_A (A:79-259) Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum}Length = 181 Back     alignment and structure
>1mx3_A (A:117-311) CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepressor, transcription repressor; HET: NAD; 1.95A {Homo sapiens}Length = 195 Back     alignment and structure
>2d0i_A (A:95-286) Dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.95A {Pyrococcus horikoshii OT3}Length = 192 Back     alignment and structure
>3gg9_A (A:108-302) D-3-phosphoglycerate dehydrogenase oxidoreductase protein; structural genomics, PSI-2, protein structure initiative; 1.90A {Ralstonia solanacearum}Length = 195 Back     alignment and structure
>1dxy_A (A:101-297) D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenase, oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei}Length = 197 Back     alignment and structure
>2o4c_A (A:91-257) Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosphate ION, oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa}Length = 167 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target82 D-3-phosphoglycerate dehydrogenase [Candidatus Liberiba
2pi1_A_ 334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 99.76
3ba1_A_1-118_302-333150 HPPR, hydroxyphenylpyruvate reductase; two domain 99.34
2ekl_A_1-99_286-313127 D-3-phosphoglycerate dehydrogenase; structural gen 99.32
2cuk_A_1-96_280-311128 Glycerate dehydrogenase/glyoxylate reductase; stru 99.32
2dbq_A_1-98_291-334142 Glyoxylate reductase; D-3-phosphoglycerate dehydro 99.31
3k5p_A_1-111_300-332144 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 99.21
2w2k_A_1-111_307-348153 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 99.17
2d0i_A_1-94_287-333141 Dehydrogenase; structural genomics, NPPSFA, nation 99.15
1qp8_A_1-80_264-303120 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 99.1
3evt_A_1-91_282-324134 Phosphoglycerate dehydrogenase; structural genomic 99.03
3gvx_A_1-78_260-290109 Glycerate dehydrogenase related protein; NYSGXRC, 97.89
2j6i_A_1-117_314-364168 Formate dehydrogenase; oxidoreductase, D-specific- 99.21
1mx3_A_1-116_312-347152 CTBP1, C-terminal binding protein 1; nuclear prote 99.18
1sc6_A_1-100_289-321133 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 99.18
2g76_A_1-120_306-335150 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 99.17
2o4c_A_1-90_258-287120 Erythronate-4-phosphate dehydrogenase; erythronate 99.17
2nac_A_1-144_335-393203 NAD-dependent formate dehydrogenase; oxidoreductas 99.17
1ygy_A_1-97_283-322137 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 99.14
1wwk_A_1-97_284-307121 Phosphoglycerate dehydrogenase; riken structural g 99.12
1dxy_A_1-100_298-333136 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 99.08
3gg9_A_1-107_303-352157 D-3-phosphoglycerate dehydrogenase oxidoreductase 99.07
1gdh_A_1-98_289-320130 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 99.07
1j4a_A_1-102_300-333136 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 99.05
2gcg_A_1-107_298-330140 Glyoxylate reductase/hydroxypyruvate reductase; NA 99.05
1xdw_A_1-101_300-331133 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 98.97
3hg7_A_1-97_282-324140 D-isomer specific 2-hydroxyacid dehydrogenase fami 98.95
3kbo_A_1-95_281-315130 Glyoxylate/hydroxypyruvate reductase A; NADP, cyto 93.42
1ygy_A_98-282 185 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 98.37
2g76_A_121-305 185 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 98.35
3k5p_A_112-299 188 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 98.31
1sc6_A_101-288 188 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 98.3
1j4a_A_103-299 197 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 98.28
1wwk_A_98-283 186 Phosphoglycerate dehydrogenase; riken structural g 98.22
3evt_A_92-281 190 Phosphoglycerate dehydrogenase; structural genomic 98.22
2cuk_A_97-279 183 Glycerate dehydrogenase/glyoxylate reductase; stru 98.05
1xdw_A_102-299 198 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 98.05
2j6i_A_118-313 196 Formate dehydrogenase; oxidoreductase, D-specific- 98.05
3kbo_A_96-280 185 Glyoxylate/hydroxypyruvate reductase A; NADP, cyto 98.04
3gvx_A_79-259 181 Glycerate dehydrogenase related protein; NYSGXRC, 98.02
3hg7_A_98-281 184 D-isomer specific 2-hydroxyacid dehydrogenase fami 98.0
2gcg_A_108-297 190 Glyoxylate reductase/hydroxypyruvate reductase; NA 97.99
1qp8_A_81-263 183 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 97.96
2ekl_A_100-285 186 D-3-phosphoglycerate dehydrogenase; structural gen 97.95
2d0i_A_95-286 192 Dehydrogenase; structural genomics, NPPSFA, nation 97.94
1dxy_A_101-297 197 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 97.93
3gg9_A_108-302 195 D-3-phosphoglycerate dehydrogenase oxidoreductase 97.93
2nac_A_145-334 190 NAD-dependent formate dehydrogenase; oxidoreductas 97.93
1mx3_A_117-311 195 CTBP1, C-terminal binding protein 1; nuclear prote 97.9
3ba1_A_119-301 183 HPPR, hydroxyphenylpyruvate reductase; two domain 97.89
1gdh_A_99-288 190 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 97.87
2w2k_A_112-306 195 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 97.8
2dbq_A_99-290 192 Glyoxylate reductase; D-3-phosphoglycerate dehydro 97.65
2o4c_A_91-257 167 Erythronate-4-phosphate dehydrogenase; erythronate 94.57
>3ba1_A (A:1-118,A:302-333) HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor binding domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>2ekl_A (A:1-99,A:286-313) D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>2cuk_A (A:1-96,A:280-311) Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus HB8} Back     alignment and structure
>2dbq_A (A:1-98,A:291-334) Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, structural genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3k5p_A (A:1-111,A:300-332) D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infectious disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>2w2k_A (A:1-111,A:307-348) D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>2d0i_A (A:1-94,A:287-333) Dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.95A {Pyrococcus horikoshii OT3} Back     alignment and structure
>1qp8_A (A:1-80,A:264-303) Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} Back     alignment and structure
>3evt_A (A:1-91,A:282-324) Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3gvx_A (A:1-78,A:260-290) Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>2j6i_A (A:1-117,A:314-364) Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>1mx3_A (A:1-116,A:312-347) CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepressor, transcription repressor; HET: NAD; 1.95A {Homo sapiens} Back     alignment and structure
>1sc6_A (A:1-100,A:289-321) PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} Back     alignment and structure
>2g76_A (A:1-120,A:306-335) 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, serine metabolism; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>2o4c_A (A:1-90,A:258-287) Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosphate ION, oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2nac_A (A:1-144,A:335-393) NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} Back     alignment and structure
>1ygy_A (A:1-97,A:283-322) PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosynthesis, structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>1wwk_A (A:1-97,A:284-307) Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii OT3} Back     alignment and structure
>1dxy_A (A:1-100,A:298-333) D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenase, oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} Back     alignment and structure
>3gg9_A (A:1-107,A:303-352) D-3-phosphoglycerate dehydrogenase oxidoreductase protein; structural genomics, PSI-2, protein structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>1gdh_A (A:1-98,A:289-320) D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} Back     alignment and structure
>1j4a_A (A:1-102,A:300-333) D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>2gcg_A (A:1-107,A:298-330) Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substrate-binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2h1s_A 2q50_A Back     alignment and structure
>1xdw_A (A:1-101,A:300-331) NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure