peg_34

peg_34

GeneID in NCBI database:Locus tag:
Protein GI in NCBI database:not defined in NCBI databaseProtein Accession:
Gene range:-(34899, 35525)Protein Length:208aa
Gene description:
COG prediction:none
KEGG prediction:not defined in KEGG
SEED prediction:D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Glycine and Serine Utilization;
Serine Biosynthesis;
Pyridoxin (Vitamin B6) Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEVEPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRVGANIISAPIIIKENAIILSTIKRDKSGV
ccccccHHHHccccHHHHHHccccEEEEEccccccccHHHHHHHHHcccEEEEEEEccccccccccHHHHcccEEEccccccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHcHHHccccccEEEEccccHHHHHHHHccccEEEEEEEEEEHHccccHHHHHHHHHHHHHHHccccEEEEHHHHHHHHcEEEEEEEEccccc
EcccccccccccEcHHHHccccccEEEEEcccHHHEcHHHHHHHHHHccEEEEEEccccccccccHHHcccccEEEcccccccEHHHHHHHHHHHHHHHHHHHHccccccEEccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccHcccccHHHHHHHHHHHHHHccccccEEcHHHHHHHccEEEEEEEcccccc
lhvpltnktknilnkenlsktksgvciincargglvdeNALAELLQsghvaeagfdvfevepalqnplfglpnvfcapylgastveSQEKVAIQLAHQMSDYLIDGVVSNALNMAIISfeeaplvkpfmtLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRVGaniisapiiiKENAIILSTIKRDKSGV
lhvpltnktknilnkenlsktksgVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEVEPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRVGAniisapiiikenaiilstikrdksgv
LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEVEPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFEEAPLVKPFMTLADHLGCFIGQLisesiqeiqiiYDGSTAVMNTMVLNSAVLAGIVRVWRVGANIISAPIIIKENAIILSTIKRDKSGV
LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEVEPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRVGANIISAPIIIKENAII***********
LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEVEPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRVGANIISAPIIIKENAIILSTIKRDKSGV
LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEVEPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRVGANIISAPIIIKENAIILSTIKR*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEVEPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRVGANIISAPIIIKENAIILSTIKRDKSGV
LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEVEPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRVGANIISAPIIIKENAIILSTIKRDKSGV
LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEVEPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRVGANIISAPIIIKENAIILSTIKRDKSGV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target208
222149645 531 D-3-phosphoglycerate dehydrogenase [Agrobacterium vitis 1 2e-78
327193458 531 D-3-phosphoglycerate dehydrogenase protein [Rhizobium e 1 3e-77
86359045 531 D-3-phosphoglycerate dehydrogenase [Rhizobium etli CFN 1 3e-77
227823299 531 D-3-phosphoglycerate dehydrogenase [Sinorhizobium fredi 1 4e-77
218675485 531 D-3-phosphoglycerate dehydrogenase [Rhizobium etli GR56 1 7e-77
190893267 531 D-3-phosphoglycerate dehydrogenase protein [Rhizobium e 1 1e-76
15891242 531 D-3-phosphoglycerate dehydrogenase [Agrobacterium tumef 1 1e-76
218663595 535 D-3-phosphoglycerate dehydrogenase [Rhizobium etli IE47 1 2e-76
116253700 531 D-3-phosphoglycerate dehydrogenase [Rhizobium leguminos 1 2e-76
307300480 531 D-3-phosphoglycerate dehydrogenase [Sinorhizobium melil 1 2e-76
>gi|222149645|ref|YP_002550602.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium vitis S4] Length = 531 Back     alignment and organism information
 Score =  295 bits (755), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 171/208 (82%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP+T+KT+ IL KENL+KTK GV IINCARGGLVDE ALAE ++SGHVA AGFDVFEV
Sbjct: 203 LHVPMTDKTRGILGKENLAKTKPGVRIINCARGGLVDEAALAEAIKSGHVAGAGFDVFEV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLFGLPNV C P+LGAST E+QE VA+Q+A QMSDYL++G VSNA+NM  I+ E
Sbjct: 263 EPAKESPLFGLPNVVCTPHLGASTTEAQENVALQVAEQMSDYLVNGAVSNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAPL+KPF+ LAD LG F+GQ+   +I+EI+I+YDG TA MNT  L SA+LAG++R    
Sbjct: 323 EAPLLKPFIRLADVLGAFVGQVTDGAIKEIEILYDGQTATMNTKALTSALLAGLIRAQVS 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI+IKE  I+LS +KRDK+GV
Sbjct: 383 DVNMVSAPIMIKEKGIVLSEVKRDKTGV 410


Species: Agrobacterium vitis
Genus: Agrobacterium
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|327193458|gb|EGE60354.1| D-3-phosphoglycerate dehydrogenase protein [Rhizobium etli CNPAF512] Length = 531 Back     alignment and organism information
>gi|86359045|ref|YP_470937.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli CFN 42] Length = 531 Back     alignment and organism information
>gi|227823299|ref|YP_002827271.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium fredii NGR234] Length = 531 Back     alignment and organism information
>gi|218675485|ref|ZP_03525154.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli GR56] Length = 531 Back     alignment and organism information
>gi|190893267|ref|YP_001979809.1| D-3-phosphoglycerate dehydrogenase protein [Rhizobium etli CIAT 652] Length = 531 Back     alignment and organism information
>gi|15891242|ref|NP_356914.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium tumefaciens str. C58] Length = 531 Back     alignment and organism information
>gi|218663595|ref|ZP_03519525.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli IE4771] Length = 535 Back     alignment and organism information
>gi|116253700|ref|YP_769538.1| D-3-phosphoglycerate dehydrogenase [Rhizobium leguminosarum bv. viciae 3841] Length = 531 Back     alignment and organism information
>gi|307300480|ref|ZP_07580260.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti BL225C] Length = 531 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target208
PRK13581 526 PRK13581, PRK13581, D-3-phosphoglycerate dehydrogenase; 1e-71
TIGR01327 525 TIGR01327, PGDH, D-3-phosphoglycerate dehydrogenase 3e-58
KOG0068406 KOG0068, KOG0068, KOG0068, D-3-phosphoglycerate dehydro 6e-30
pfam02826176 pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydroxyaci 3e-25
KOG0069336 KOG0069, KOG0069, KOG0069, Glyoxylate/hydroxypyruvate r 2e-21
PRK06487317 PRK06487, PRK06487, glycerate dehydrogenase; Provisiona 4e-19
PRK15409323 PRK15409, PRK15409, bifunctional glyoxylate/hydroxypyru 1e-17
PRK06932314 PRK06932, PRK06932, glycerate dehydrogenase; Provisiona 4e-16
PLN03139386 PLN03139, PLN03139, formate dehydrogenase; Provisional 3e-15
PRK07574385 PRK07574, PRK07574, formate dehydrogenase; Provisional 2e-13
PRK08410311 PRK08410, PRK08410, 2-hydroxyacid dehydrogenase; Provis 2e-13
PLN02306386 PLN02306, PLN02306, hydroxypyruvate reductase 2e-11
PLN02928347 PLN02928, PLN02928, oxidoreductase family protein 2e-10
PRK00257381 PRK00257, PRK00257, erythronate-4-phosphate dehydrogena 1e-08
PRK08605332 PRK08605, PRK08605, D-lactate dehydrogenase; Validated 3e-08
KOG0067435 KOG0067, KOG0067, KOG0067, Transcription factor CtBP [T 1e-07
PRK15469312 PRK15469, ghrA, bifunctional glyoxylate/hydroxypyruvate 6e-07
PRK12480330 PRK12480, PRK12480, D-lactate dehydrogenase; Provisiona 3e-06
PRK06436303 PRK06436, PRK06436, glycerate dehydrogenase; Provisiona 2e-05
PRK15438378 PRK15438, PRK15438, erythronate-4-phosphate dehydrogena 4e-05
COG0111324 COG0111, SerA, Phosphoglycerate dehydrogenase and relat 1e-30
PRK11790409 PRK11790, PRK11790, D-3-phosphoglycerate dehydrogenase; 1e-22
COG1052324 COG1052, LdhA, Lactate dehydrogenase and related dehydr 5e-22
PRK13243333 PRK13243, PRK13243, glyoxylate reductase; Reviewed 2e-19
pfam00389313 pfam00389, 2-Hacid_dh, D-isomer specific 2-hydroxyacid 7e-19
>gnl|CDD|184162 PRK13581, PRK13581, D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|162302 TIGR01327, PGDH, D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>gnl|CDD|35291 KOG0068, KOG0068, KOG0068, D-3-phosphoglycerate dehydrogenase, D-isomer-specific 2-hydroxy acid dehydrogenase superfamily [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|145796 pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|35292 KOG0069, KOG0069, KOG0069, Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|180588 PRK06487, PRK06487, glycerate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|185307 PRK15409, PRK15409, bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>gnl|CDD|168735 PRK06932, PRK06932, glycerate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|178684 PLN03139, PLN03139, formate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181041 PRK07574, PRK07574, formate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181414 PRK08410, PRK08410, 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|177941 PLN02306, PLN02306, hydroxypyruvate reductase Back     alignment and domain information
>gnl|CDD|178516 PLN02928, PLN02928, oxidoreductase family protein Back     alignment and domain information
>gnl|CDD|166874 PRK00257, PRK00257, erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181499 PRK08605, PRK08605, D-lactate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|35290 KOG0067, KOG0067, KOG0067, Transcription factor CtBP [Transcription] Back     alignment and domain information
>gnl|CDD|185366 PRK15469, ghrA, bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>gnl|CDD|183550 PRK12480, PRK12480, D-lactate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|102375 PRK06436, PRK06436, glycerate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|185335 PRK15438, PRK15438, erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>gnl|CDD|30460 COG0111, SerA, Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|183316 PRK11790, PRK11790, D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|31252 COG1052, LdhA, Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|183914 PRK13243, PRK13243, glyoxylate reductase; Reviewed Back     alignment and domain information
>gnl|CDD|144107 pfam00389, 2-Hacid_dh, D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 208
PRK13581 524 D-3-phosphoglycerate dehydrogenase; Provisional 100.0
KOG0068406 consensus 100.0
TIGR01327 535 PGDH D-3-phosphoglycerate dehydrogenase; InterPro: IPR0 100.0
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 100.0
COG0111324 SerA Phosphoglycerate dehydrogenase and related dehydro 100.0
PRK13243333 glyoxylate reductase; Reviewed 100.0
PRK08605332 D-lactate dehydrogenase; Validated 100.0
PRK12480330 D-lactate dehydrogenase; Provisional 100.0
PRK07574385 formate dehydrogenase; Provisional 100.0
PRK06487317 glycerate dehydrogenase; Provisional 100.0
PRK06932314 glycerate dehydrogenase; Provisional 100.0
COG1052324 LdhA Lactate dehydrogenase and related dehydrogenases [ 100.0
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 100.0
PRK06436303 glycerate dehydrogenase; Provisional 100.0
KOG0069336 consensus 100.0
PRK00257379 erythronate-4-phosphate dehydrogenase; Validated 99.97
pfam00389313 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenas 99.95
KOG0067435 consensus 99.36
PTZ00311543 phosphoenolpyruvate carboxykinase; Provisional 93.6
pfam02826176 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogen 99.96
TIGR00719 208 sda_beta L-serine dehydratase, iron-sulfur-dependent, b 92.9
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>KOG0068 consensus Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase; InterPro: IPR006236 This group of sequences represent the long form of D-3-phosphoglycerate dehydrogenase, they include the serA gene of one pathway of serine biosynthesis Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>KOG0069 consensus Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>pfam00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain Back     alignment and domain information
>KOG0067 consensus Back     alignment and domain information
>PTZ00311 phosphoenolpyruvate carboxykinase; Provisional Back     alignment and domain information
>pfam02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain Back     alignment and domain information
>TIGR00719 sda_beta L-serine dehydratase, iron-sulfur-dependent, beta subunit; InterPro: IPR004643 L-serine dehydratase, also called serine deaminase, catalyses the conversion of L-serine and water to pyruvate and ammonia during gluconeogenesis from serine Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target208
3ddn_A 528 Crystal Structure Of Hydroxypyruvic Acid Phosphate 3e-41
1ygy_A 529 Crystal Structure Of D-3-Phosphoglycerate Dehydroge 3e-41
1wwk_A307 Crystal Structure Of Phosphoglycerate Dehydrogenase 3e-21
2dbr_A334 Crystal Structure Of Glyoxylate Reductase (Ph0597) 5e-21
2dbq_A334 Crystal Structure Of Glyoxylate Reductase (Ph0597) 7e-19
2g76_A335 Crystal Structure Of Human 3-Phosphoglycerate Dehyd 2e-18
2cuk_A311 Crystal Structure Of Tt0316 Protein From Thermus Th 2e-18
2gcg_A330 Ternary Crystal Structure Of Human Glyoxylate Reduc 5e-16
2go1_A401 Nad-Dependent Formate Dehydrogenase From Pseudomona 3e-15
2nac_A393 High Resolution Structures Of Holo And Apo Formate 3e-15
2pi1_B334 Crystal Structure Of D-Lactate Dehydrogenase From A 3e-15
2ome_A336 Crystal Structure Of Human Ctbp2 Dehydrogenase Comp 3e-15
2gug_A401 Nad-Dependent Formate Dehydrogenase From Pseudomona 5e-15
3fn4_A401 Apo-Form Of Nad-Dependent Formate Dehydrogenase Fro 6e-15
2gsd_A402 Nad-Dependent Formate Dehydrogenase From Bacterium 6e-15
1mx3_A347 Crystal Structure Of Ctbp Dehydrogenase Core Holo F 1e-14
1hl3_A358 CtbpBARS IN TERNARY COMPLEX WITH NAD(H) AND PIDLSKK 2e-14
1hku_A358 CtbpBARS: A DUAL-Function Protein Involved In Trans 2e-14
3ga0_A358 Ctbp1BARS GLY172->glu Mutant Structure: Impairing N 2e-14
2dld_A337 D-Lactate Dehydrogenase Complexed With Nadh And Oxa 5e-14
2w2l_D348 Crystal Structure Of The Holo Forms Of Rhodotorula 7e-14
2w2k_A348 Crystal Structure Of The Apo Forms Of Rhodotorula G 7e-14
2w2k_B348 Crystal Structure Of The Apo Forms Of Rhodotorula G 7e-14
3ba1_A333 Structure Of Hydroxyphenylpyruvate Reductase From C 8e-14
2h1s_A328 Crystal Structure Of A GlyoxylateHYDROXYPYRUVATE RE 9e-14
1j49_A333 Insights Into Domain Closure, Substrate Specificity 9e-14
1j4a_A333 Insights Into Domain Closure, Substrate Specificity 1e-13
3naq_A357 Apo-Form Of Nad-Dependent Formate Dehydrogenase Fro 1e-13
3n7u_A351 Nad-Dependent Formate Dehydrogenase From Higher-Pla 2e-13
1dxy_A333 Structure Of D-2-Hydroxyisocaproate Dehydrogenase L 4e-13
2d0i_A333 Crystal Structure Ph0520 Protein From Pyrococcus Ho 6e-13
3hg7_A324 Crystal Structure Of D-Isomer Specific 2-Hydroxyaci 2e-12
3evt_A324 Crystal Structure Of Phosphoglycerate Dehydrogenase 5e-12
1gdh_A320 Crystal Structure Of A Nad-Dependent D-Glycerate De 1e-11
1psd_B406 The Allosteric Ligand Site In The Vmax-Type Coopera 1e-18
2p9g_A410 Crystal Structure Of Serine Bound G336v,G337v Doubl 6e-18
2p9c_A410 Crystal Structure Of Serine Bound G336v Mutant Of E 9e-18
3k5p_A416 Crystal Structure Of Amino Acid-Binding Act: D-Isom 1e-15
1yba_A410 The Active Form Of Phosphoglycerate Dehydrogenase L 1e-15
1sc6_A404 Crystal Structure Of W139g D-3-Phosphoglycerate Deh 9e-15
>gi|194368789|pdb|3DDN|A Chain A, Crystal Structure Of Hydroxypyruvic Acid Phosphate Bound D- 3-Phosphoglycerate Dehydrogenase In Mycobacterium Tuberculosis Length = 528 Back     alignment and structure
 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 72/207 (34%), Positives = 103/207 (49%), Gaps = 3/207 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +++KE L+KTK GV I+N ARGGLVDE ALA+ +  GHV  AG DVF  
Sbjct: 201 VHLPKTPETAGLIDKEALAKTKPGVIIVNAARGGLVDEAALADAITGGHVRAAGLDVFAT 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF L  V   P+LGAST E+Q++    +A  +   L    V +A+N+      
Sbjct: 261 EPCTDSPLFELAQVVVTPHLGASTAEAQDRAGTDVAESVRLALAGEFVPDAVNVGGGV-- 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
               V P++ L   LG   G L  E    + +   G  A     VL  + L G+      
Sbjct: 319 VNEEVAPWLDLVRKLGVLAGVLSDELPVSLSVQVRGELAAEEVEVLRLSALRGLFSAVIE 378

Query: 181 G-ANIISAPIIIKENAIILSTIKRDKS 206
                ++AP +  E  +     K  +S
Sbjct: 379 DAVTFVNAPALAAERGVTAEICKASES 405


>gi|60594357|pdb|1YGY|A Chain A, Crystal Structure Of D-3-Phosphoglycerate Dehydrogenase From Mycobacterium Tuberculosis Length = 529 Back     alignment and structure
gi|88191759|pdb|1WWK|A Chain A, Crystal Structure Of Phosphoglycerate Dehydrogenase From Pyrococcus Horikoshii Ot3 Length = 307 Back     alignment and structure
gi|110591182|pdb|2DBR|A Chain A, Crystal Structure Of Glyoxylate Reductase (Ph0597) From Pyrococcus Horikoshii Ot3, Complexed With Nadp (P1) Length = 334 Back     alignment and structure
>gi|110591181|pdb|2DBQ|A Chain A, Crystal Structure Of Glyoxylate Reductase (Ph0597) From Pyrococcus Horikoshii Ot3, Complexed With Nadp (I41) Length = 334 Back     alignment and structure
>gi|93279902|pdb|2G76|A Chain A, Crystal Structure Of Human 3-Phosphoglycerate Dehydrogenase Length = 335 Back     alignment and structure
gi|114793632|pdb|2CUK|A Chain A, Crystal Structure Of Tt0316 Protein From Thermus Thermophilus Hb8 Length = 311 Back     alignment and structure
>gi|112490731|pdb|2GCG|A Chain A, Ternary Crystal Structure Of Human Glyoxylate ReductaseHYDROXYPYRUVATE REDUCTASE Length = 330 Back     alignment and structure
gi|99032655|pdb|2GO1|A Chain A, Nad-Dependent Formate Dehydrogenase From Pseudomonas Sp.101 Length = 401 Back     alignment and structure
>gi|999845|pdb|2NAC|A Chain A, High Resolution Structures Of Holo And Apo Formate Dehydrogenase Length = 393 Back     alignment and structure
>gi|126031658|pdb|2OME|A Chain A, Crystal Structure Of Human Ctbp2 Dehydrogenase Complexed With Nad(H) Length = 336 Back     alignment and structure
>gi|109158073|pdb|2GUG|A Chain A, Nad-Dependent Formate Dehydrogenase From Pseudomonas Sp.101 In Complex With Formate Length = 401 Back     alignment and structure
>gi|270047600|pdb|3FN4|A Chain A, Apo-Form Of Nad-Dependent Formate Dehydrogenase From Bacterium Moraxella Sp.C-1 In Closed Conformation Length = 401 Back     alignment and structure
>gi|109158019|pdb|2GSD|A Chain A, Nad-Dependent Formate Dehydrogenase From Bacterium Moraxella Sp.C2 In Complex With Nad And Azide Length = 402 Back     alignment and structure
>gi|27574013|pdb|1MX3|A Chain A, Crystal Structure Of Ctbp Dehydrogenase Core Holo Form Length = 347 Back     alignment and structure
>gi|33357012|pdb|1HL3|A Chain A, CtbpBARS IN TERNARY COMPLEX WITH NAD(H) AND PIDLSKK PEPTIDE Length = 358 Back     alignment and structure
>gi|33356997|pdb|1HKU|A Chain A, CtbpBARS: A DUAL-Function Protein Involved In Transcription Corepression And Golgi Membrane Fission Length = 358 Back     alignment and structure
>gi|227343811|pdb|3GA0|A Chain A, Ctbp1BARS GLY172->glu Mutant Structure: Impairing Nad(H) Binding And Dimerization Length = 358 Back     alignment and structure
gi|1431687|pdb|2DLD|A Chain A, D-Lactate Dehydrogenase Complexed With Nadh And Oxamate Length = 337 Back     alignment and structure
>gi|268612124|pdb|2W2L|D Chain D, Crystal Structure Of The Holo Forms Of Rhodotorula Graminis D-Mandelate Dehydrogenase At 2.5a Length = 348 Back     alignment and structure
>gi|268612119|pdb|2W2K|A Chain A, Crystal Structure Of The Apo Forms Of Rhodotorula Graminis D-Mandelate Dehydrogenase At 1.8a. Length = 348 Back     alignment and structure
>gi|268612120|pdb|2W2K|B Chain B, Crystal Structure Of The Apo Forms Of Rhodotorula Graminis D-Mandelate Dehydrogenase At 1.8a Length = 348 Back     alignment and structure
>gi|212374928|pdb|3BA1|A Chain A, Structure Of Hydroxyphenylpyruvate Reductase From Coleus Blu Length = 333 Back     alignment and structure
>gi|110590506|pdb|2H1S|A Chain A, Crystal Structure Of A GlyoxylateHYDROXYPYRUVATE REDUCTASE From Homo Sapiens Length = 328 Back     alignment and structure
>gi|21465681|pdb|1J49|A Chain A, Insights Into Domain Closure, Substrate Specificity And Catalysis Of D-Lactate Dehydrogenase From Lactobacillus Bulgaricus Length = 333 Back     alignment and structure
>gi|21465683|pdb|1J4A|A Chain A, Insights Into Domain Closure, Substrate Specificity And Catalysis Of D-Lactate Dehydrogenase From Lactobacillus Bulgaricus Length = 333 Back     alignment and structure
>gi|300193276|pdb|3NAQ|A Chain A, Apo-Form Of Nad-Dependent Formate Dehydrogenase From Higher-Plant Arabidopsis Thaliana Length = 357 Back     alignment and structure
>gi|297787831|pdb|3N7U|A Chain A, Nad-Dependent Formate Dehydrogenase From Higher-Plant Arabid Thaliana In Complex With Nad And Azide Length = 351 Back     alignment and structure
gi|157830898|pdb|1DXY|A Chain A, Structure Of D-2-Hydroxyisocaproate Dehydrogenase Length = 333 Back     alignment and structure
gi|90109156|pdb|2D0I|A Chain A, Crystal Structure Ph0520 Protein From Pyrococcus Horikoshii Ot3 Length = 333 Back     alignment and structure
>gi|238538024|pdb|3HG7|A Chain A, Crystal Structure Of D-Isomer Specific 2-Hydroxyacid Dehydrogenase Family Protein From Aeromonas Salmonicida Subsp. Salmonicida A449 Length = 324 Back     alignment and structure
>gi|209870633|pdb|3EVT|A Chain A, Crystal Structure Of Phosphoglycerate Dehydrogenase From Lactobacillus Plantarum Length = 324 Back     alignment and structure
>gi|494035|pdb|1GDH|A Chain A, Crystal Structure Of A Nad-Dependent D-Glycerate Dehydrogenase At 2.4 Angstroms Resolution Length = 320 Back     alignment and structure
>gi|146387108|pdb|2P9G|A Chain A, Crystal Structure Of Serine Bound G336v,G337v Double Mutant Of E.Coli Phosphoglycerate Dehydrogenase Length = 410 Back     alignment and structure
>gi|146387102|pdb|2P9C|A Chain A, Crystal Structure Of Serine Bound G336v Mutant Of E.Coli Phosphoglycerate Dehydrogenase Length = 410 Back     alignment and structure
>gi|262368138|pdb|3K5P|A Chain A, Crystal Structure Of Amino Acid-Binding Act: D-Isomer Specific 2-Hydroxyacid Dehydrogenase Catalytic Domain From Brucella Melitensis Length = 416 Back     alignment and structure
>gi|66360690|pdb|1YBA|A Chain A, The Active Form Of Phosphoglycerate Dehydrogenase Length = 410 Back     alignment and structure
>gi|61679883|pdb|1SC6|A Chain A, Crystal Structure Of W139g D-3-Phosphoglycerate Dehydrogenase Complexed With Nad+ Length = 404 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target208
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductas 8e-28
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; allosteric re 8e-20
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrion, NA 2e-26
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural genomi 3e-25
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarbox 4e-25
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydrogenas 7e-24
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural genom 3e-23
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; structura 2e-21
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductase(ald 7e-21
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreduct 1e-20
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehydroge 2e-20
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) 2e-20
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD( 5e-20
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear protein, p 1e-19
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, 8e-19
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, 3D 2e-18
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain prote 2e-17
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A 3e-17
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase prote 5e-17
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific-2- hy 6e-16
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, national pr 8e-16
3kbo_A315 Glyoxylate/hydroxypyruvate reductase A; NADP, cytoplasm 4e-14
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; st 6e-13
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural genomics 3e-12
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase family pr 4e-12
3evt_A324 Phosphoglycerate dehydrogenase; structural genomics, PS 1e-11
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, PSI-I 3e-10
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seat 2e-24
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate-4-ph 7e-16
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgcid, S- 1e-09
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosynthesis, structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Length = 529 Back     alignment and structure
 Score =  118 bits (297), Expect = 8e-28
 Identities = 72/208 (34%), Positives = 103/208 (49%), Gaps = 3/208 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +++KE L+KTK GV I+N ARGGLVDE ALA+ +  GHV  AG DVF  
Sbjct: 202 VHLPKTPETAGLIDKEALAKTKPGVIIVNAARGGLVDEAALADAITGGHVRAAGLDVFAT 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF L  V   P+LGAST E+Q++    +A  +   L    V +A+N+      
Sbjct: 262 EPCTDSPLFELAQVVVTPHLGASTAEAQDRAGTDVAESVRLALAGEFVPDAVNVGGGVVN 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVW-R 179
           E     P++ L   LG   G L  E    + +   G  A     VL  + L G+      
Sbjct: 322 EEV--APWLDLVRKLGVLAGVLSDELPVSLSVQVRGELAAEEVEVLRLSALRGLFSAVIE 379

Query: 180 VGANIISAPIIIKENAIILSTIKRDKSG 207
                ++AP +  E  +     K  +S 
Sbjct: 380 DAVTFVNAPALAAERGVTAEICKASESP 407


>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Length = 404 Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Length = 351 Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii OT3} Length = 307 Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenase, oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Length = 333 Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, structural genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Length = 334 Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Length = 381 Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus HB8} Length = 311 Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* Length = 393 Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, serine metabolism; HET: NAD; 1.70A {Homo sapiens} Length = 335 Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Length = 333 Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substrate-binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2h1s_A 2q50_A Length = 330 Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Length = 320 Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepressor, transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Length = 347 Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Length = 348 Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor binding domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Length = 333 Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Length = 303 Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase protein; structural genomics, PSI-2, protein structure initiative; 1.90A {Ralstonia solanacearum} Length = 352 Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Length = 364 Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.95A {Pyrococcus horikoshii OT3} Length = 333 Back     alignment and structure
>3kbo_A Glyoxylate/hydroxypyruvate reductase A; NADP, cytoplasm, NAD, structural genomics; HET: NDP NDB EPE; 2.14A {Salmonella enterica subsp} Length = 315 Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Length = 331 Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Length = 313 Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase family protein; structural genomics, protein structure initiative; 1.80A {Aeromonas salmonicida subsp} Length = 324 Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Length = 324 Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Length = 290 Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infectious disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Length = 416 Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosphate ION, oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Length = 380 Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydrolase, cytoplasm, NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei 1710B} PDB: 3glq_A* Length = 494 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target208
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductas 100.0
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seat 100.0
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; allosteric re 100.0
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate-4-ph 100.0
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) 100.0
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductase(ald 100.0
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain prote 100.0
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreduct 100.0
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydrogenas 100.0
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrion, NA 100.0
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD( 100.0
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, 100.0
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear protein, p 100.0
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarbox 100.0
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehydroge 100.0
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase prote 100.0
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, national pr 100.0
3evt_A324 Phosphoglycerate dehydrogenase; structural genomics, PS 100.0
3kbo_A315 Glyoxylate/hydroxypyruvate reductase A; NADP, cytoplasm 100.0
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific-2- hy 100.0
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; st 100.0
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, 3D 100.0
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; structura 100.0
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural genomi 100.0
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase family pr 100.0
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A 100.0
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural genomics 100.0
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural genom 99.98
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, PSI-I 99.96
1j3b_A529 ATP-dependent phosphoenolpyruvate carboxykinase; adenos 91.21
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosynthesis, structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=449.94  Aligned_cols=205  Identities=36%  Similarity=0.541  Sum_probs=198.5

Q ss_pred             CCCCCCHHHHCCCCHHHHHHCCCCEEEEECCCCHHCCHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHCCCCCHHHCCC
Q ss_conf             95779845707558799983899809998485022148897632213564014323753113233201045420021020
Q 537021.9.peg.3    1 LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEVEPALQNPLFGLPNVFCAPYL   80 (208)
Q Consensus         1 lH~Plt~~T~~li~~~~l~~mk~g~~lIN~aRG~ivde~aL~~aL~~g~i~~aalDV~~~EP~~~~~l~~~~nvi~TPHi   80 (208)
                      +|+|||++|+||||++.|++||+|++|||||||++|||+||++||++|+++||+||||++||++++||+++|||++|||+
T Consensus       202 lh~Plt~~T~~li~~~~~~~mK~ga~lIN~aRG~iVde~aL~~AL~~g~i~gAalDV~~~EP~~~~pl~~~~nvi~TPHi  281 (529)
T 1ygy_A          202 VHLPKTPETAGLIDKEALAKTKPGVIIVNAARGGLVDEAALADAITGGHVRAAGLDVFATEPCTDSPLFELAQVVVTPHL  281 (529)
T ss_dssp             ECCCCSTTTTTCBCHHHHTTSCTTEEEEECSCTTSBCHHHHHHHHHTSSEEEEEESSCSSSSCSCCGGGGCTTEEECSSC
T ss_pred             EECCCCCCCCCCCCHHHHHHCCCCCEEEECCCCCEECHHHHHHHHHCCCCCEEEEECCCCCCCCCCHHHCCCCEEECCCC
T ss_conf             90799853315107999952589986874146655759999999984997168980215789999446469999999826


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCC
Q ss_conf             10139999999999999999986038862001000134445466536999999999999997258851489998143011
Q 537021.9.peg.3   81 GASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAV  160 (208)
Q Consensus        81 ga~T~ea~~~~a~~~a~~i~~~l~~~~~~~~vN~p~~~~~~~~~~~pyl~LaekLG~l~~ql~~~~~~~I~i~~~G~la~  160 (208)
                      ||+|.|+|++++..+++|+.+||+|++++|+||+|+.+.  .+.++||++|+||||+|++|+.++++++|+++|+|+++.
T Consensus       282 ~~~T~ea~~~~~~~~~~ni~~~l~g~~~~n~VN~p~~~~--~~~~~p~~~laeklG~~~~ql~~~~~~~i~i~~~G~~~~  359 (529)
T 1ygy_A          282 GASTAEAQDRAGTDVAESVRLALAGEFVPDAVNVGGGVV--NEEVAPWLDLVRKLGVLAGVLSDELPVSLSVQVRGELAA  359 (529)
T ss_dssp             SSCBHHHHHHHHHHHHHHHHHHHTTCCCTTBCSCCSTTS--CTTTTTHHHHHHHHHHHHHHTSSSCCSEEEEEEEEGGGG
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC--CCCCCCHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCC
T ss_conf             448499999999999999999986999997362898655--434440435999887789877047863799999354344


Q ss_pred             CCCHHHHHHHHHHHHH-HCCCCCCEEEHHHHHHHCCEEEEEEEECCCC
Q ss_conf             1434789999999886-4067861677889999559089999603568
Q 537021.9.peg.3  161 MNTMVLNSAVLAGIVR-VWRVGANIISAPIIIKENAIILSTIKRDKSG  207 (208)
Q Consensus       161 ~~t~~l~~a~lkGlL~-~~~~~VN~VNA~~iA~erGI~v~e~~~~~sG  207 (208)
                      .++++++.+++||+|+ ...++||||||+.+||||||+++++++++++
T Consensus       360 ~~~~~lt~a~lkG~L~~~~~~~vN~vNA~~iA~e~Gi~v~~~~~~~~~  407 (529)
T 1ygy_A          360 EEVEVLRLSALRGLFSAVIEDAVTFVNAPALAAERGVTAEICKASESP  407 (529)
T ss_dssp             SCCHHHHHHHHHHHTGGGSCTTCCCCCHHHHHHHHSCEEEEEEESCCS
T ss_pred             CCCCHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHCCCEEEEEECCCCC
T ss_conf             566456899999877652456554035578998649559996426676



>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infectious disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosphate ION, oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substrate-binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, serine metabolism; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, structural genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepressor, transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenase, oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase protein; structural genomics, PSI-2, protein structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.95A {Pyrococcus horikoshii OT3} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3kbo_A Glyoxylate/hydroxypyruvate reductase A; NADP, cytoplasm, NAD, structural genomics; HET: NDP NDB EPE; 2.14A {Salmonella enterica subsp} Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus HB8} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii OT3} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase family protein; structural genomics, protein structure initiative; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>1j3b_A ATP-dependent phosphoenolpyruvate carboxykinase; adenosine triphosphate, riken structural genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus HB8} SCOP: c.91.1.1 c.109.1.1 PDB: 1xkv_A* 2pc9_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 208
d1gdha1191 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomic 1e-16
d1sc6a1188 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Esc 1e-14
d1ygya1184 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Myco 2e-13
d2naca1188 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas 4e-13
d1mx3a1193 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Hum 2e-11
d1dxya1199 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenas 2e-06
d1j4aa1197 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacil 3e-06
d1qp8a1181 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Arch 1e-05
d1ygya4135 d.81.2.2 (A:317-451) D-3-phosphoglycerate dehydrogenase 5e-10
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Length = 191 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Formate/glycerate dehydrogenases, NAD-domain
domain: D-glycerate dehydrogenase
species: Hyphomicrobium methylovorum [TaxId: 84]
 Score = 80.0 bits (196), Expect = 1e-16
 Identities = 31/83 (37%), Positives = 47/83 (56%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           L+ P T +T+   NK  +     G  ++N ARG LVD   +   L++G +A AGFDVF  
Sbjct: 109 LNAPSTPETRYFFNKATIKSLPQGAIVVNTARGDLVDNELVVAALEAGRLAYAGFDVFAG 168

Query: 61  EPALQNPLFGLPNVFCAPYLGAS 83
           EP +    + LPN F  P++G++
Sbjct: 169 EPNINEGYYDLPNTFLFPHIGSA 191


>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Length = 188 Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 184 Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Length = 188 Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Length = 193 Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Length = 199 Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Length = 197 Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 181 Back     information, alignment and structure
>d1ygya4 d.81.2.2 (A:317-451) D-3-phosphoglycerate dehydrogenase SerA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 135 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target208
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylovorum 99.97
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tuberculo 99.97
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 [Tax 99.96
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillus cas 99.95
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapiens), C 99.95
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [TaxId 99.95
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobaculum ae 99.94
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus [TaxI 99.94
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapiens) [ 96.62
d1j3ba1318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloaceta 93.23
d1ii2a1323 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloaceta 91.29
d1ygya4135 D-3-phosphoglycerate dehydrogenase SerA {Mycobacterium 99.88
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Formate/glycerate dehydrogenases, NAD-domain
domain: D-glycerate dehydrogenase
species: Hyphomicrobium methylovorum [TaxId: 84]
Probab=99.97  E-value=1e-31  Score=215.99  Aligned_cols=83  Identities=37%  Similarity=0.680  Sum_probs=81.4

Q ss_pred             CCCCCCHHHHCCCCHHHHHHCCCCEEEEECCCCHHCCHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHCCCCCHHHCCC
Q ss_conf             95779845707558799983899809998485022148897632213564014323753113233201045420021020
Q 537021.9.peg.3    1 LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEVEPALQNPLFGLPNVFCAPYL   80 (208)
Q Consensus         1 lH~Plt~~T~~li~~~~l~~mk~g~~lIN~aRG~ivde~aL~~aL~~g~i~~aalDV~~~EP~~~~~l~~~~nvi~TPHi   80 (208)
                      +|+|+|++|++|||++.|++||+|++|||+|||++|||+||+++|++|+|+||++|||+.||++++||+++|||++|||+
T Consensus       109 l~~plt~~T~~li~~~~l~~mk~~a~lIN~sRG~ivde~aL~~aL~~g~i~~a~lDV~~~EP~~~~~l~~~~nvi~TPHi  188 (191)
T d1gdha1         109 LNAPSTPETRYFFNKATIKSLPQGAIVVNTARGDLVDNELVVAALEAGRLAYAGFDVFAGEPNINEGYYDLPNTFLFPHI  188 (191)
T ss_dssp             ECCCCCTTTTTCBSHHHHTTSCTTEEEEECSCGGGBCHHHHHHHHHHTSEEEEEESCCTTTTSCCTTGGGCTTEEECSSC
T ss_pred             ECCCCCCHHHHEECHHHHHCCCCCCEEEECCCCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCHHHCCCCEEECCCC
T ss_conf             41799905753526888628487607996578630103899999983994489997899999998157749999989810


Q ss_pred             CCC
Q ss_conf             101
Q 537021.9.peg.3   81 GAS   83 (208)
Q Consensus        81 ga~   83 (208)
                      |++
T Consensus       189 asa  191 (191)
T d1gdha1         189 GSA  191 (191)
T ss_dssp             TTC
T ss_pred             CCC
T ss_conf             038



>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ygya4 d.81.2.2 (A:317-451) D-3-phosphoglycerate dehydrogenase SerA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 208
1ygy_A_98-282185 (A:98-282) PGDH, D-3-phosphoglycerate dehydrogenas 3e-18
1gdh_A_99-288190 (A:99-288) D-glycerate dehydrogenase; oxidoreducta 6e-17
2dbq_A_99-290192 (A:99-290) Glyoxylate reductase; D-3-phosphoglycer 8e-17
2ekl_A_100-285186 (A:100-285) D-3-phosphoglycerate dehydrogenase; st 3e-16
3gg9_A_108-302195 (A:108-302) D-3-phosphoglycerate dehydrogenase oxi 9e-16
2g76_A_121-305185 (A:121-305) 3-PGDH, D-3-phosphoglycerate dehydroge 1e-15
2nac_A_145-334190 (A:145-334) NAD-dependent formate dehydrogenase; o 1e-15
1qp8_A_81-263183 (A:81-263) Formate dehydrogenase; oxidoreductase; 2e-15
3k5p_A_112-299188 (A:112-299) D-3-phosphoglycerate dehydrogenase; ni 2e-15
3ba1_A_119-301183 (A:119-301) HPPR, hydroxyphenylpyruvate reductase; 4e-15
1wwk_A_98-283186 (A:98-283) Phosphoglycerate dehydrogenase; riken s 1e-14
1dxy_A_101-297197 (A:101-297) D-2-hydroxyisocaproate dehydrogenase; 1e-14
2gcg_A_108-297190 (A:108-297) Glyoxylate reductase/hydroxypyruvate r 1e-14
3gvx_A_79-259181 (A:79-259) Glycerate dehydrogenase related protein 3e-14
3kbo_A_96-280185 (A:96-280) Glyoxylate/hydroxypyruvate reductase A; 5e-14
3hg7_A_98-281184 (A:98-281) D-isomer specific 2-hydroxyacid dehydro 5e-14
1xdw_A_102-299198 (A:102-299) NAD+-dependent (R)-2-hydroxyglutarate 5e-14
3evt_A_92-281190 (A:92-281) Phosphoglycerate dehydrogenase; structu 6e-14
2cuk_A_97-279183 (A:97-279) Glycerate dehydrogenase/glyoxylate redu 1e-13
2o4c_A_91-257167 (A:91-257) Erythronate-4-phosphate dehydrogenase; 1e-13
2w2k_A_112-306195 (A:112-306) D-mandelate dehydrogenase; 2-hydroxyac 1e-13
2j6i_A_118-313196 (A:118-313) Formate dehydrogenase; oxidoreductase, 2e-13
1mx3_A_117-311195 (A:117-311) CTBP1, C-terminal binding protein 1; n 4e-13
1leh_A_138-364227 (A:138-364) Leucine dehydrogenase; oxidoreductase; 6e-13
1j4a_A_103-299197 (A:103-299) D-LDH, D-lactate dehydrogenase; NAD-de 7e-13
3h9u_A_190-346157 (A:190-346) Adenosylhomocysteinase; NAD CO-factor 9e-13
1sc6_A_101-288188 (A:101-288) PGDH, D-3-phosphoglycerate dehydrogena 2e-12
2d0i_A_95-286192 (A:95-286) Dehydrogenase; structural genomics, NPP 2e-12
3d64_A_247-409163 (A:247-409) Adenosylhomocysteinase; structural gen 4e-12
3gvp_A_200-354155 (A:200-354) Adenosylhomocysteinase 3; protein CO-f 1e-11
3ce6_A_253-410158 (A:253-410) Adenosylhomocysteinase; protein-substr 2e-10
3ggo_A_1-204204 (A:1-204) Prephenate dehydrogenase; TYRA, HPP, NAD 5e-10
1pjc_A_124-315192 (A:124-315) Protein (L-alanine dehydrogenase); oxi 1e-09
2g5c_A_1-172172 (A:1-172) Prephenate dehydrogenase; TYRA, oxidored 2e-09
2eez_A_123-315193 (A:123-315) Alanine dehydrogenase; TTHA0216, struc 2e-09
2vhw_A_125-318194 (A:125-318) Alanine dehydrogenase; NAD, secreted, 4e-09
1c1d_A_145-355211 (A:145-355) L-phenylalanine dehydrogenase; amino a 6e-08
3k5i_A_1-135135 (A:1-135) Phosphoribosyl-aminoimidazole carboxylas 1e-07
1v8b_A_227-394168 (A:227-394) Adenosylhomocysteinase; hydrolase; HET 1e-07
3dzb_A_1-179_292-317205 (A:1-179,A:292-317) Prephenate dehydrogenase; doma 1e-06
2uyy_A_1-193193 (A:1-193) N-PAC protein; long-chain dehydrogenase, 4e-06
2rir_A_128-271144 (A:128-271) Dipicolinate synthase, A chain; struct 6e-06
2f1k_A_1-166166 (A:1-166) Prephenate dehydrogenase; tyrosine synth 1e-05
3d4o_A_126-269144 (A:126-269) Dipicolinate synthase subunit A; NP_24 1e-05
1np3_A_1-182182 (A:1-182) Ketol-acid reductoisomerase; A DEEP figu 6e-05
2cvz_A_1-157157 (A:1-157) Dehydrogenase, 3-hydroxyisobutyrate dehy 0.004
2pi1_A_334 (A:) D-lactate dehydrogenase; oxidoreductase, D-LD 9e-17
1sc6_A_1-100_289-321133 (A:1-100,A:289-321) PGDH, D-3-phosphoglycerate deh 2e-07
3k5p_A_1-111_300-332144 (A:1-111,A:300-332) D-3-phosphoglycerate dehydroge 4e-07
3c24_A_1-195195 (A:1-195) Putative oxidoreductase; YP_511008.1, st 5e-07
3ktd_A_1-186_304-341224 (A:1-186,A:304-341) Prephenate dehydrogenase; stru 4e-06
1ygy_A_323-452130 (A:323-452) PGDH, D-3-phosphoglycerate dehydrogena 3e-12
1ygy_A_1-97_283-322137 (A:1-97,A:283-322) PGDH, D-3-phosphoglycerate dehy 5e-10
2g76_A_1-120_306-335150 (A:1-120,A:306-335) 3-PGDH, D-3-phosphoglycerate d 2e-06
>1ygy_A (A:98-282) PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosynthesis, structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis}Length = 185 Back     alignment and structure
 Score = 86.1 bits (212), Expect = 3e-18
 Identities = 43/81 (53%), Positives = 55/81 (67%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +++KE L+KTK GV I+N ARGGLVDE ALA+ +  GHV  AG DVF  
Sbjct: 105 VHLPKTPETAGLIDKEALAKTKPGVIIVNAARGGLVDEAALADAITGGHVRAAGLDVFAT 164

Query: 61  EPALQNPLFGLPNVFCAPYLG 81
           EP   +PLF L  V   P+LG
Sbjct: 165 EPCTDSPLFELAQVVVTPHLG 185


>1gdh_A (A:99-288) D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum}Length = 190 Back     alignment and structure
>2dbq_A (A:99-290) Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, structural genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A*Length = 192 Back     alignment and structure
>2ekl_A (A:100-285) D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii}Length = 186 Back     alignment and structure
>3gg9_A (A:108-302) D-3-phosphoglycerate dehydrogenase oxidoreductase protein; structural genomics, PSI-2, protein structure initiative; 1.90A {Ralstonia solanacearum}Length = 195 Back     alignment and structure
>2g76_A (A:121-305) 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, serine metabolism; HET: NAD; 1.70A {Homo sapiens}Length = 185 Back     alignment and structure
>2nac_A (A:145-334) NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP}Length = 190 Back     alignment and structure
>1qp8_A (A:81-263) Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum}Length = 183 Back     alignment and structure
>3k5p_A (A:112-299) D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infectious disease, brucellosis; 2.15A {Brucella melitensis biovar abortus}Length = 188 Back     alignment and structure
>3ba1_A (A:119-301) HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor binding domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A*Length = 183 Back     alignment and structure
>1wwk_A (A:98-283) Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii OT3}Length = 186 Back     alignment and structure
>1dxy_A (A:101-297) D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenase, oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei}Length = 197 Back     alignment and structure
>2gcg_A (A:108-297) Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substrate-binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2h1s_A 2q50_ALength = 190 Back     alignment and structure
>3gvx_A (A:79-259) Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum}Length = 181 Back     alignment and structure
>3kbo_A (A:96-280) Glyoxylate/hydroxypyruvate reductase A; NADP, cytoplasm, NAD, structural genomics; HET: NDP NDB EPE; 2.14A {Salmonella enterica subsp}Length = 185 Back     alignment and structure
>3hg7_A (A:98-281) D-isomer specific 2-hydroxyacid dehydrogenase family protein; structural genomics, protein structure initiative; 1.80A {Aeromonas salmonicida subsp}Length = 184 Back     alignment and structure
>1xdw_A (A:102-299) NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans}Length = 198 Back     alignment and structure
>3evt_A (A:92-281) Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum}Length = 190 Back     alignment and structure
>2cuk_A (A:97-279) Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus HB8}Length = 183 Back     alignment and structure
>2o4c_A (A:91-257) Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosphate ION, oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa}Length = 167 Back     alignment and structure
>2w2k_A (A:112-306) D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_BLength = 195 Back     alignment and structure
>2j6i_A (A:118-313) Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_ALength = 196 Back     alignment and structure
>1mx3_A (A:117-311) CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepressor, transcription repressor; HET: NAD; 1.95A {Homo sapiens}Length = 195 Back     alignment and structure
>1leh_A (A:138-364) Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus}Length = 227 Back     alignment and structure
>1j4a_A (A:103-299) D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp}Length = 197 Back     alignment and structure
>3h9u_A (A:190-346) Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, structural genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 1li4_A* 1a7a_A*Length = 157 Back     alignment and structure
>1sc6_A (A:101-288) PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli}Length = 188 Back     alignment and structure
>2d0i_A (A:95-286) Dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.95A {Pyrococcus horikoshii OT3}Length = 192 Back     alignment and structure
>3d64_A (A:247-409) Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydrolase, cytoplasm, NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei 1710B} PDB: 3glq_A*Length = 163 Back     alignment and structure
>3gvp_A (A:200-354) Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens}Length = 155 Back     alignment and structure
>3ce6_A (A:253-410) Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding domain, 37 amino acid insertional region; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis H37RV} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A*Length = 158 Back     alignment and structure
>3ggo_A (A:1-204) Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A*Length = 204 Back     alignment and structure
>1pjc_A (A:124-315) Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum}Length = 192 Back     alignment and structure
>2g5c_A (A:1-172) Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus VF5}Length = 172 Back     alignment and structure
>2eez_A (A:123-315) Alanine dehydrogenase; TTHA0216, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.71A {Thermus thermophilus HB8}Length = 193 Back     alignment and structure
>2vhw_A (A:125-318) Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A*Length = 194 Back     alignment and structure
>1c1d_A (A:145-355) L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP}Length = 211 Back     alignment and structure
>3k5i_A (A:1-135) Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A*Length = 135 Back     alignment and structure
>1v8b_A (A:227-394) Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum 3D7}Length = 168 Back     alignment and structure
>3dzb_A (A:1-179,A:292-317) Prephenate dehydrogenase; domain SWAP, PSI2, NYSGXRC, tyrosine biosynthesis, EC:1.3.12.-, structural genomics; 2.46A {Streptococcus thermophilus lmg 18311}Length = 205 Back     alignment and structure