254780156

254780156

putative inositol-1-monophosphatase

GeneID in NCBI database:8209133Locus tag:CLIBASIA_00195
Protein GI in NCBI database:254780156Protein Accession:YP_003064569.1
Gene range:-(38210, 38980)Protein Length:256aa
Gene description:putative inositol-1-monophosphatase
COG prediction:[G] Archaeal fructose-1,6-bisphosphatase and related enzymes of inositol monophosphatase family
KEGG prediction:putative inositol-1-monophosphatase; K01092 myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
SEED prediction:Inositol-1-monophosphatase (EC 3.1.3.25)
Pathway involved in KEGG:Inositol phosphate metabolism [PATH:las00562]
Streptomycin biosynthesis [PATH:las00521]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250------
MSRSALLNVMVSAALKAGKFLSRDFGEVQDLQVSRKGPSDFVMKSHSKCQEIIYQELLGARPKYGFYSGGKAYVGQDSITRWIVDPLNGITNFFYAIPHFCISIALERDQEIIASVIFNPITDELYTAERGIGSFLNDRRIRVSSRRILSNSIICYATFKRNSRFLMQLCRIMDEAVGVRSFGSEALDLAYIAAGRFDGFLGKGLSIWCVAAGLLIICEAGGFATDFLGKNMGAETKSIISGNMPIHEQLLAIIND
ccHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEcccccHHHHHHHHHHHHHHHHHHHHcccccEEEcccccccccccEEEEEEcccHHHHHHcccccEEEEEEEEEccEEEEEEEEEcccccEEEEEcccccEEccEEccccccccccccEEEEEEcccccHHHHHHHHHHHHcccEEEccHHHHHHHHHHcccccEEEEccccHHHHHHHHHHHHHcccEEEccccccccccccEEEEccHHHHHHHHHHHcc
ccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccccHHcHHHHHHHHHHHHHHccccEEEEEccccccccccEEEEEEcccccccccccccccEEEEEEEEcccEEEEEEEcccccHcEEEEccccccccccEEEEcccHHHcccEEEcccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHccccHHHHHHHHHHHHHccccEccccccccccccccEEEccHHHHHHHHHHHHc
MSRSALLNVMVSAALKAGKflsrdfgevqdlqvsrkgpsdfvmksHSKCQEIIYQELLgarpkygfysggkayvgqdsitRWIVdplngitnffyaIPHFCISIALERDQEIIASVifnpitdelytAERGIGSFLNDRRIRVSSRRILSNSIICYATFKRNSRFLMQLCRIMDeavgvrsfgseALDLAYIAAGrfdgflgkGLSIWCVAAGLLIICEaggfatdflgknmgaetksiisgnmpIHEQLLAIIND
MSRSALLNVMVSAALKAGKFLSRDFGEvqdlqvsrkgpsdfvmksHSKCQEIIYQELLGARPKYGFYSGGKAYVGQDSITRWIVDPLNGITNFFYAIPHFCISIALERDQEIIASVIFNPITDELYTAErgigsflndrrirvssrrilsnsiicyaTFKRNSRFLMQLCRIMDEAVGVRSFGSEALDLAYIAAGRFDGFLGKGLSIWCVAAGLLIICEAGGFATDFLGKNMGAETksiisgnmpiHEQLLAIIND
MSRSALLNVMVSAALKAGKFLSRDFGEVQDLQVSRKGPSDFVMKSHSKCQEIIYQELLGARPKYGFYSGGKAYVGQDSITRWIVDPLNGITNFFYAIPHFCISIALERDQEIIASVIFNPITDELYTAERGIGSFLNDrrirvssrrilsnsiiCYATFKRNSRFLMQLCRIMDEAVGVRSFGSEALDLAYIAAGRFDGFLGKGLSIWCVAAGLLIICEAGGFATDFLGKNMGAETKSIISGNMPIHEQLLAIIND
***SALLNVMVSAALKAGKFLSRDFGEVQ***VSRKGPSDFVMKSHSKCQEIIYQELLGARPKYGFYSGGKAYVGQDSITRWIVDPLNGITNFFYAIPHFCISIALERDQEIIASVIFNPITDELYTAERGIGSFLNDRRIRVSSRRILSNSIICYATFKRNSRFLMQLCRIMDEAVGVRSFGSEALDLAYIAAGRFDGFLGKGLSIWCVAAGLLIICEAGGFATDFLGKNMGAETKSIISGNMPIHEQLLAIIN*
MSRSALLNVMVSAALKAGKFLSRDFGEVQDLQVSRKGPSDFVMKSHSKCQEIIYQELLGARPKYGFYSGGKAYVGQDSITRWIVDPLNGITNFFYAIPHFCISIALERDQEIIASVIFNPITDELYTAERGIGSFLNDRRIRVSSRRILSNSIICYATFKRNSRFLMQLCRIMDEAVGVRSFGSEALDLAYIAAGRFDGFLGKGLSIWCVAAGLLIICEAGGFATDFLGKNMGAETKSIISGNMPIHEQLLAIIND
*SRSALLNVMVSAALKAGKFLSRDFGEVQDLQVSRKGPSDFVMKSHSKCQEIIYQELLGARPKYGFYSGGKAYVGQDSITRWIVDPLNGITNFFYAIPHFCISIALERDQEIIASVIFNPITDELYTAERGIGSFLNDRRIRVSSRRILSNSIICYATFKRNSRFLMQLCRIMDEAVGVRSFGSEALDLAYIAAGRFDGFLGKGLSIWCVAAGLLIICEAGGFATDFLGKNMGAETKSIISGNMPIHEQLLAIIND
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRSALLNVMVSAALKAGKFLSRDFGEVQDLQVSRKGPSDFVMKSHSKCQEIIYQELLGARPKYGFYSGGKAYVGQDSITRWIVDPLNGITNFFYAIPHFCISIALERDQEIIASVIFNPITDELYTAERGIGSFLNDRRIRVSSRRILSNSIICYATFKRNSRFLMQLCRIMDEAVGVRSFGSEALDLAYIAAGRFDGFLGKGLSIWCVAAGLLIICEAGGFATDFLGKNMGAETKSIISGNMPIHEQLLAIIND
MSRSALLNVMVSAALKAGKFLSRDFGEVQDLQVSRKGPSDFVMKSHSKCQEIIYQELLGARPKYGFYSGGKAYVGQDSITRWIVDPLNGITNFFYAIPHFCISIALERDQEIIASVIFNPITDELYTAERGIGSFLNDRRIRVSSRRILSNSIICYATFKRNSRFLMQLCRIMDEAVGVRSFGSEALDLAYIAAGRFDGFLGKGLSIWCVAAGLLIICEAGGFATDFLGKNMGAETKSIISGNMPIHEQLLAIIND
MSRSALLNVMVSAALKAGKFLSRDFGEVQDLQVSRKGPSDFVMKSHSKCQEIIYQELLGARPKYGFYSGGKAYVGQDSITRWIVDPLNGITNFFYAIPHFCISIALERDQEIIASVIFNPITDELYTAERGIGSFLNDRRIRVSSRRILSNSIICYATFKRNSRFLMQLCRIMDEAVGVRSFGSEALDLAYIAAGRFDGFLGKGLSIWCVAAGLLIICEAGGFATDFLGKNMGAETKSIISGNMPIHEQLLAIIND

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target256 putative inositol-1-monophosphatase [Candidatus Liberib
254780404286 inositol monophosphatase family protein [Candidatu 3e-04
>gi|254780404|ref|YP_003064817.1| inositol monophosphatase family protein [Candidatus Liberibacter asiaticus str. psy62] Length = 286 Back     alignment
 Score = 37.4 bits (85), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 75/176 (42%), Gaps = 23/176 (13%)

Query: 61  RPKYGFYSGGKAYVGQDSITR------WIVDPLNGITNFFYAIPHFCISIALERDQEIIA 114
           RP YG+ S        D + R      ++VDP++G   F      +CIS+A+      + 
Sbjct: 88  RPAYGWLSEET----DDDLQRLNYETLFVVDPIDGTRAFIEGRNEWCISVAVVHHGRPVI 143

Query: 115 SVIFNPITDELYTAERGIGSFLNDRRIRVSSRRILSNSIICYATFKRNSRFLMQLCRIMD 174
            V+      + +    G+ S  N + I VSS + +S+S+   A+            + +D
Sbjct: 144 GVVHASALGKEFFVSVGMKSTCNGKNISVSSNQ-MSDSLAIMASDVS--------LKGLD 194

Query: 175 EAVGVR---SFGSEALDLAYIAAGRFDGFL-GKGLSIWCVAAGLLIICEAGGFATD 226
             V  R   S  S  L +  IA+G  D  +  +  + W +AA  L++  +GG   D
Sbjct: 195 SYVRFRRQSSISSLCLRILMIASGEVDVLIVDRNANDWDLAAADLLLECSGGALVD 250

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target256 putative inositol-1-monophosphatase [Candidatus Liberib
315122756260 putative inositol-1-monophosphatase [Candidatus Liberib 1 1e-100
222087028267 myo-inositol-1(or 4)-monophosphatase protein [Agrobacte 1 1e-77
227823350266 inositol-1-monophosphatase [Sinorhizobium fredii NGR234 1 3e-76
15966531266 putative inositol monophosphatase protein [Sinorhizobiu 1 9e-75
15891201266 extragenic suppressor protein SuhB [Agrobacterium tumef 1 3e-74
150397863266 inositol-phosphate phosphatase [Sinorhizobium medicae W 1 3e-74
222149696266 extragenic suppressor protein SuhB [Agrobacterium vitis 1 2e-73
325063166266 putative myo-inositol-1 or 4-monophosphatase [Agrobacte 1 2e-72
116253764266 inositol-1-monophosphatase [Rhizobium leguminosarum bv. 1 8e-72
241206242266 inositol monophosphatase [Rhizobium leguminosarum bv. t 1 2e-71
>gi|315122756|ref|YP_004063245.1| putative inositol-1-monophosphatase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 260 Back     alignment and organism information
 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 188/259 (72%), Positives = 210/259 (81%), Gaps = 4/259 (1%)

Query: 1   MSRSALLNVMVSAALKAGKFLSRDFGEVQDLQVSRKGPSDFVMKSHSKCQEIIYQELLGA 60
           M RSALLNVMVSAALKAGK LSRDF EVQ+LQVSRK PSD V + H K QEIIYQELL A
Sbjct: 1   MPRSALLNVMVSAALKAGKLLSRDFDEVQNLQVSRKDPSDSVAQYHLKYQEIIYQELLYA 60

Query: 61  RPKYGFYSGGKAYVGQDSITRWIVDPLNGITNFFYAIPHFCISIALERDQEIIASVIFNP 120
           RPKYGFY  GK+ VGQDS+TRWIVDPLNG TNF +AIPHFCISIALER QEIIASVIFNP
Sbjct: 61  RPKYGFYGEGKSCVGQDSLTRWIVDPLNGSTNFLHAIPHFCISIALERAQEIIASVIFNP 120

Query: 121 ITDELYTAERGIGSFLNDRRIRVSSRRILSNSIIC----YATFKRNSRFLMQLCRIMDEA 176
           ITDELYTAERG G+FLNDRRIRVSSRR+LS S+I       T ++N+ FL     I+D  
Sbjct: 121 ITDELYTAERGAGAFLNDRRIRVSSRRLLSKSLISCGIPRVTCQQNNHFLAHFNGIIDSI 180

Query: 177 VGVRSFGSEALDLAYIAAGRFDGFLGKGLSIWCVAAGLLIICEAGGFATDFLGKNMGAET 236
            GVRSFG+ ALDLAYIA+GRFDGF  KG S W +A GLL++ EAGGFATDFLGK    E+
Sbjct: 181 AGVRSFGAIALDLAYIASGRFDGFWEKGFSPWSIAGGLLLVREAGGFATDFLGKATIVES 240

Query: 237 KSIISGNMPIHEQLLAIIN 255
           KSIISGN+ IH+QLL ++N
Sbjct: 241 KSIISGNIHIHKQLLTVMN 259


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222087028|ref|YP_002545563.1| myo-inositol-1(or 4)-monophosphatase protein [Agrobacterium radiobacter K84] Length = 267 Back     alignment and organism information
>gi|227823350|ref|YP_002827322.1| inositol-1-monophosphatase [Sinorhizobium fredii NGR234] Length = 266 Back     alignment and organism information
>gi|15966531|ref|NP_386884.1| putative inositol monophosphatase protein [Sinorhizobium meliloti 1021] Length = 266 Back     alignment and organism information
>gi|15891201|ref|NP_356873.1| extragenic suppressor protein SuhB [Agrobacterium tumefaciens str. C58] Length = 266 Back     alignment and organism information
>gi|150397863|ref|YP_001328330.1| inositol-phosphate phosphatase [Sinorhizobium medicae WSM419] Length = 266 Back     alignment and organism information
>gi|222149696|ref|YP_002550653.1| extragenic suppressor protein SuhB [Agrobacterium vitis S4] Length = 266 Back     alignment and organism information
>gi|325063166|gb|ADY66856.1| putative myo-inositol-1 or 4-monophosphatase [Agrobacterium sp. H13-3] Length = 266 Back     alignment and organism information
>gi|116253764|ref|YP_769602.1| inositol-1-monophosphatase [Rhizobium leguminosarum bv. viciae 3841] Length = 266 Back     alignment and organism information
>gi|241206242|ref|YP_002977338.1| inositol monophosphatase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 266 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target256 putative inositol-1-monophosphatase [Candidatus Liberib
COG0483260 COG0483, SuhB, Archaeal fructose-1,6-bisphosphatase and 2e-53
cd01637238 cd01637, IMPase_like, Inositol-monophosphatase-like dom 3e-41
PRK10757267 PRK10757, PRK10757, inositol monophosphatase; Provision 4e-40
KOG2951279 KOG2951, KOG2951, KOG2951, Inositol monophosphatase [Ca 2e-39
pfam00459269 pfam00459, Inositol_P, Inositol monophosphatase family 2e-38
PLN02553270 PLN02553, PLN02553, inositol-phosphate phosphatase 4e-34
cd01638242 cd01638, CysQ, CysQ, a 3'-Phosphoadenosine-5'-phosphosu 2e-24
cd01641248 cd01641, Bacterial_IMPase_like_1, Predominantly bacteri 4e-24
PLN02737363 PLN02737, PLN02737, inositol monophosphatase family pro 3e-19
TIGR02067251 TIGR02067, his_9_proposed, histidinol-phosphate phospha 8e-19
COG1218276 COG1218, CysQ, 3'-Phosphoadenosine 5'-phosphosulfate (P 9e-15
cd01517274 cd01517, PAP_phosphatase, PAP-phosphatase_like domains 5e-14
cd01636184 cd01636, FIG, FIG, FBPase/IMPase/glpX-like domain 9e-10
TIGR01330353 TIGR01330, bisphos_HAL2, 3'(2'),5'-bisphosphate nucleot 0.002
cd01639244 cd01639, IMPase, IMPase, inositol monophosphatase and r 3e-61
cd01643242 cd01643, Bacterial_IMPase_like_2, Bacterial family of M 2e-30
cd01642244 cd01642, Arch_FBPase_2, Putative fructose-1,6-bisphosph 2e-13
PRK12676263 PRK12676, PRK12676, bifunctional inositol-1 monophospha 3e-30
cd01515257 cd01515, Arch_FBPase_1, Archaeal fructose-1,6-bisphosph 7e-26
PLN02911296 PLN02911, PLN02911, inositol-phosphate phosphatase 2e-06
PRK14076 569 PRK14076, pnk, inorganic polyphosphate/ATP-NAD kinase; 4e-15
TIGR01331249 TIGR01331, bisphos_cysQ, 3'(2'),5'-bisphosphate nucleot 5e-07
KOG1528351 KOG1528, KOG1528, KOG1528, Salt-sensitive 3'-phosphoade 1e-06
PRK10931246 PRK10931, PRK10931, adenosine-3'(2'),5'-bisphosphate nu 5e-04
>gnl|CDD|30831 COG0483, SuhB, Archaeal fructose-1,6-bisphosphatase and related enzymes of inositol monophosphatase family [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|30135 cd01637, IMPase_like, Inositol-monophosphatase-like domains Back     alignment and domain information
>gnl|CDD|182704 PRK10757, PRK10757, inositol monophosphatase; Provisional Back     alignment and domain information
>gnl|CDD|38162 KOG2951, KOG2951, KOG2951, Inositol monophosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|144160 pfam00459, Inositol_P, Inositol monophosphatase family Back     alignment and domain information
>gnl|CDD|178168 PLN02553, PLN02553, inositol-phosphate phosphatase Back     alignment and domain information
>gnl|CDD|30136 cd01638, CysQ, CysQ, a 3'-Phosphoadenosine-5'-phosphosulfate (PAPS) 3'-phosphatase, is a bacterial member of the inositol monophosphatase family Back     alignment and domain information
>gnl|CDD|30139 cd01641, Bacterial_IMPase_like_1, Predominantly bacterial family of Mg++ dependend phosphatases, related to inositol monophosphatases Back     alignment and domain information
>gnl|CDD|178338 PLN02737, PLN02737, inositol monophosphatase family protein Back     alignment and domain information
>gnl|CDD|162680 TIGR02067, his_9_proposed, histidinol-phosphate phosphatase HisN, inositol monophosphatase family Back     alignment and domain information
>gnl|CDD|31411 COG1218, CysQ, 3'-Phosphoadenosine 5'-phosphosulfate (PAPS) 3'-phosphatase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|73273 cd01517, PAP_phosphatase, PAP-phosphatase_like domains Back     alignment and domain information
>gnl|CDD|73280 cd01636, FIG, FIG, FBPase/IMPase/glpX-like domain Back     alignment and domain information
>gnl|CDD|162304 TIGR01330, bisphos_HAL2, 3'(2'),5'-bisphosphate nucleotidase, HAL2 family Back     alignment and domain information
>gnl|CDD|30137 cd01639, IMPase, IMPase, inositol monophosphatase and related domains Back     alignment and domain information
>gnl|CDD|30141 cd01643, Bacterial_IMPase_like_2, Bacterial family of Mg++ dependent phosphatases, related to inositol monophosphatases Back     alignment and domain information
>gnl|CDD|30140 cd01642, Arch_FBPase_2, Putative fructose-1,6-bisphosphatase or related enzymes of inositol monophosphatase family Back     alignment and domain information
>gnl|CDD|183673 PRK12676, PRK12676, bifunctional inositol-1 monophosphatase/fructose-1,6-bisphosphatase; Reviewed Back     alignment and domain information
>gnl|CDD|30131 cd01515, Arch_FBPase_1, Archaeal fructose-1,6-bisphosphatase and related enzymes of inositol monophosphatase family (FBPase class IV) Back     alignment and domain information
>gnl|CDD|178499 PLN02911, PLN02911, inositol-phosphate phosphatase Back     alignment and domain information
>gnl|CDD|184490 PRK14076, pnk, inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>gnl|CDD|130398 TIGR01331, bisphos_cysQ, 3'(2'),5'-bisphosphate nucleotidase, bacterial Back     alignment and domain information
>gnl|CDD|36741 KOG1528, KOG1528, KOG1528, Salt-sensitive 3'-phosphoadenosine-5'-phosphatase HAL2/SAL1 [Nucleotide transport and metabolism, Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182848 PRK10931, PRK10931, adenosine-3'(2'),5'-bisphosphate nucleotidase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 256 putative inositol-1-monophosphatase [Candidatus Liberib
PRK10757267 inositol monophosphatase; Provisional 100.0
PRK12676262 bifunctional inositol-1 monophosphatase/fructose-1,6-bi 100.0
cd01641248 Bacterial_IMPase_like_1 Predominantly bacterial family 100.0
TIGR02067269 his_9_proposed histidinol-phosphate phosphatase, putati 100.0
COG0483260 SuhB Archaeal fructose-1,6-bisphosphatase and related e 100.0
cd01643242 Bacterial_IMPase_like_2 Bacterial family of Mg++ depend 100.0
pfam00459269 Inositol_P Inositol monophosphatase family. 100.0
cd01639244 IMPase IMPase, inositol monophosphatase and related dom 100.0
cd01515257 Arch_FBPase_1 Archaeal fructose-1,6-bisphosphatase and 100.0
cd01637238 IMPase_like Inositol-monophosphatase-like domains. This 100.0
KOG2951279 consensus 100.0
cd01517274 PAP_phosphatase PAP-phosphatase_like domains. PAP-phosp 100.0
cd01638242 CysQ CysQ, a 3'-Phosphoadenosine-5'-phosphosulfate (PAP 100.0
PRK10931246 PAPS (adenosine 3'-phosphate 5'-phosphosulfate) 3'(2'), 100.0
TIGR01331263 bisphos_cysQ 3'(2'),5'-bisphosphate nucleotidase; Inter 100.0
cd01640293 IPPase IPPase; Inositol polyphosphate-1-phosphatase, a 100.0
cd01642244 Arch_FBPase_2 Putative fructose-1,6-bisphosphatase or r 100.0
COG1218276 CysQ 3'-Phosphoadenosine 5'-phosphosulfate (PAPS) 3'-ph 100.0
TIGR01330382 bisphos_HAL2 3'(2'),5'-bisphosphate nucleotidase; Inter 100.0
KOG1528351 consensus 100.0
KOG3853350 consensus 99.95
KOG3099340 consensus 99.94
PRK09293328 fructose-1,6-bisphosphatase; Provisional 99.08
cd00354315 FBPase Fructose-1,6-bisphosphatase, an enzyme that cata 99.05
pfam00316325 FBPase Fructose-1-6-bisphosphatase. 99.02
COG0158326 Fbp Fructose-1,6-bisphosphatase [Carbohydrate transport 98.87
KOG1458343 consensus 98.53
cd01636184 FIG FIG, FBPase/IMPase/glpX-like domain. A superfamily 100.0
pfam03320308 FBPase_glpX Bacterial fructose-1,6-bisphosphatase, glpX 96.53
PRK12388321 fructose-1,6-bisphosphatase II-like protein; Reviewed 96.46
PRK12415323 fructose 1,6-bisphosphatase II; Reviewed 96.41
PRK09479320 glpX fructose 1,6-bisphosphatase II; Reviewed 96.3
cd01516309 FBPase_glpX Bacterial fructose-1,6-bisphosphatase, glpX 96.29
>PRK10757 inositol monophosphatase; Provisional Back     alignment and domain information
>PRK12676 bifunctional inositol-1 monophosphatase/fructose-1,6-bisphosphatase; Reviewed Back     alignment and domain information
>cd01641 Bacterial_IMPase_like_1 Predominantly bacterial family of Mg++ dependend phosphatases, related to inositol monophosphatases Back     alignment and domain information
>TIGR02067 his_9_proposed histidinol-phosphate phosphatase, putative; InterPro: IPR011809 This entry contains proteins that belong to the inositol monophosphatase family Back     alignment and domain information
>COG0483 SuhB Archaeal fructose-1,6-bisphosphatase and related enzymes of inositol monophosphatase family [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd01643 Bacterial_IMPase_like_2 Bacterial family of Mg++ dependent phosphatases, related to inositol monophosphatases Back     alignment and domain information
>pfam00459 Inositol_P Inositol monophosphatase family Back     alignment and domain information
>cd01639 IMPase IMPase, inositol monophosphatase and related domains Back     alignment and domain information
>cd01515 Arch_FBPase_1 Archaeal fructose-1,6-bisphosphatase and related enzymes of inositol monophosphatase family (FBPase class IV) Back     alignment and domain information
>cd01637 IMPase_like Inositol-monophosphatase-like domains Back     alignment and domain information
>KOG2951 consensus Back     alignment and domain information
>cd01517 PAP_phosphatase PAP-phosphatase_like domains Back     alignment and domain information
>cd01638 CysQ CysQ, a 3'-Phosphoadenosine-5'-phosphosulfate (PAPS) 3'-phosphatase, is a bacterial member of the inositol monophosphatase family Back     alignment and domain information
>PRK10931 PAPS (adenosine 3'-phosphate 5'-phosphosulfate) 3'(2'),5'-bisphosphate nucleotidase; Provisional Back     alignment and domain information
>TIGR01331 bisphos_cysQ 3'(2'),5'-bisphosphate nucleotidase; InterPro: IPR006240 Sulphate is incorporated into 3-phosphoadenylylsulphate, PAPS, for utilization in pathways such as methionine biosynthesis Back     alignment and domain information
>cd01640 IPPase IPPase; Inositol polyphosphate-1-phosphatase, a member of the Mg++ dependent family of inositol monophosphatase-like domains, hydrolyzes the 1' position phosphate from inositol 1,3,4-trisphosphate and inositol 1,4-bisphosphate Back     alignment and domain information
>cd01642 Arch_FBPase_2 Putative fructose-1,6-bisphosphatase or related enzymes of inositol monophosphatase family Back     alignment and domain information
>COG1218 CysQ 3'-Phosphoadenosine 5'-phosphosulfate (PAPS) 3'-phosphatase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01330 bisphos_HAL2 3'(2'),5'-bisphosphate nucleotidase; InterPro: IPR006239 Sulphate is incorporated into 3-phosphoadenylylsulphate, PAPS, for utilization in pathways such as methionine biosynthesis Back     alignment and domain information
>KOG1528 consensus Back     alignment and domain information
>KOG3853 consensus Back     alignment and domain information
>KOG3099 consensus Back     alignment and domain information
>PRK09293 fructose-1,6-bisphosphatase; Provisional Back     alignment and domain information
>cd00354 FBPase Fructose-1,6-bisphosphatase, an enzyme that catalyzes the hydrolysis of fructose-1,6-biphosphate into fructose-6-phosphate and is critical in gluconeogenesis pathway Back     alignment and domain information
>pfam00316 FBPase Fructose-1-6-bisphosphatase Back     alignment and domain information
>COG0158 Fbp Fructose-1,6-bisphosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1458 consensus Back     alignment and domain information
>cd01636 FIG FIG, FBPase/IMPase/glpX-like domain Back     alignment and domain information
>pfam03320 FBPase_glpX Bacterial fructose-1,6-bisphosphatase, glpX-encoded Back     alignment and domain information
>PRK12388 fructose-1,6-bisphosphatase II-like protein; Reviewed Back     alignment and domain information
>PRK12415 fructose 1,6-bisphosphatase II; Reviewed Back     alignment and domain information
>PRK09479 glpX fructose 1,6-bisphosphatase II; Reviewed Back     alignment and domain information
>cd01516 FBPase_glpX Bacterial fructose-1,6-bisphosphatase, glpX-encoded Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target256 putative inositol-1-monophosphatase [Candidatus Liberib
2qfl_A267 Structure Of Suhb: Inositol Monophosphatase And Ext 4e-36
3luz_A267 Crystal Structure Of Extragenic Suppressor Protein 9e-34
2pcr_A264 Crystal Structure Of Myo-Inositol-1(Or 4)-Monophosp 1e-25
2p3n_A256 Thermotoga Maritima Impase Tm1415 Length = 256 2e-24
2czh_A299 Crystal Structure Of Human Myo-Inositol Monophospha 7e-20
2fvz_A273 Human Inositol Monophosphosphatase 2 Length = 273 1e-19
2hhm_A276 Structure Of Inositol Monophosphatase, The Putative 2e-19
1ima_A277 Structural Analysis Of Inositol Monophosphatase Com 2e-19
2bji_A277 High Resolution Structure Of Myo-Inositol Monophosp 1e-18
1lbv_A252 Crystal Structure Of Apo-Form (P21) Of Dual Activit 3e-10
1vdw_A254 A Hypothetical Protein Ph1897 From Pyrococcus Horik 1e-09
1dk4_A252 Crystal Structure Of Mj0109 Gene Product Inositol M 2e-08
1jp4_A308 Crystal Structure Of An Enzyme Displaying Both Inos 8e-06
1xi6_A262 Extragenic Suppressor From Pyrococcus Furiosus Pfu- 1e-05
2wef_A311 Human 3'(2'), 5'-Bisphosphate Nucleotidase 1 (Bpnt1 1e-04
3b8b_A292 Crystal Structure Of Cysq From Bacteroides Thetaiot 3e-07
1qgx_A357 X-Ray Structure Of Yeast Hal2p Length = 357 3e-04
>gi|157835913|pdb|2QFL|A Chain A, Structure Of Suhb: Inositol Monophosphatase And Extragenic Suppressor From E. Coli Length = 267 Back     alignment and structure
 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 88/257 (34%), Positives = 142/257 (55%), Gaps = 5/257 (1%)

Query: 5   ALLNVMVSAALKAGKFLSRDFGEVQDLQVSRKGPSDFVMKSHSKCQEIIYQELLGARPKY 64
            +LN+ V AA KAG  +++++     ++ S+KG +DFV       + +I   +  + P++
Sbjct: 3   PMLNIAVRAARKAGNLIAKNYETPDAVEASQKGSNDFVTNVDKAAEAVIIDTIRKSYPQH 62

Query: 65  GFYSGGKAY-VGQDSITRWIVDPLNGITNFFYAIPHFCISIALERDQEIIASVIFNPITD 123
              +       G D   +W++DPL+G TNF   +PHF +SIA+        +V+++P+ +
Sbjct: 63  TIITEESGELEGTDQDVQWVIDPLDGTTNFIKRLPHFAVSIAVRIKGRTEVAVVYDPMRN 122

Query: 124 ELYTAERGIGSFLNDRRIRVSSRRILSNSIICYATFKRNSRFLMQLCRI----MDEAVGV 179
           EL+TA RG G+ LN  R+R S+ R L  +I+      +  ++      I     +E    
Sbjct: 123 ELFTATRGQGAQLNGYRLRGSTARDLDGTILATGFPFKAKQYATTYINIVGKLFNECADF 182

Query: 180 RSFGSEALDLAYIAAGRFDGFLGKGLSIWCVAAGLLIICEAGGFATDFLGKNMGAETKSI 239
           R+ GS ALDLAY+AAGR DGF   GL  W  AAG L++ EAGG  +DF G +    T +I
Sbjct: 183 RATGSAALDLAYVAAGRVDGFFEIGLRPWDFAAGELLVREAGGIVSDFTGGHNYMLTGNI 242

Query: 240 ISGNMPIHEQLLAIIND 256
           ++GN  + + +LA + D
Sbjct: 243 VAGNPRVVKAMLANMRD 259


>gi|290560584|pdb|3LUZ|A Chain A, Crystal Structure Of Extragenic Suppressor Protein Suhb From Bartonella Henselae, Via Combined Iodide Sad Molecular Replacement Length = 267 Back     alignment and structure
>gi|158429409|pdb|2PCR|A Chain A, Crystal Structure Of Myo-Inositol-1(Or 4)-Monophosphatase (Aq_1983) From Aquifex Aeolicus Vf5 Length = 264 Back     alignment and structure
gi|146387079|pdb|2P3N|A Chain A, Thermotoga Maritima Impase Tm1415 Length = 256 Back     alignment and structure
>gi|112490221|pdb|2CZH|A Chain A, Crystal Structure Of Human Myo-Inositol Monophosphatase 2 (Impa2) With Phosphate Ion (Orthorhombic Form) Length = 299 Back     alignment and structure
>gi|90109699|pdb|2FVZ|A Chain A, Human Inositol Monophosphosphatase 2 Length = 273 Back     alignment and structure
>gi|443382|pdb|2HHM|A Chain A, Structure Of Inositol Monophosphatase, The Putative Target Of Lithium Therapy Length = 276 Back     alignment and structure
gi|996146|pdb|1IMA|A Chain A, Structural Analysis Of Inositol Monophosphatase Complexes With Substrates Length = 277 Back     alignment and structure
gi|61680900|pdb|2BJI|A Chain A, High Resolution Structure Of Myo-Inositol Monophosphatase, The Target Of Lithium Therapy Length = 277 Back     alignment and structure
gi|21466040|pdb|1LBV|A Chain A, Crystal Structure Of Apo-Form (P21) Of Dual Activity FbpaseIMPASE (AF2372) FROM ARCHAEOGLOBUS FULGIDUS Length = 252 Back     alignment and structure
gi|47169446|pdb|1VDW|A Chain A, A Hypothetical Protein Ph1897 From Pyrococcus Horikoshii With Similarities For Inositol-1 Monophosphatase Length = 254 Back     alignment and structure
gi|11513829|pdb|1DK4|A Chain A, Crystal Structure Of Mj0109 Gene Product Inositol Monophosphatase Length = 252 Back     alignment and structure
gi|15825834|pdb|1JP4|A Chain A, Crystal Structure Of An Enzyme Displaying Both Inositol- Polyphosphate 1-Phosphatase And 3'-Phosphoadenosine-5'- Phosphate Phosphatase Activities Length = 308 Back     alignment and structure
>gi|56967100|pdb|1XI6|A Chain A, Extragenic Suppressor From Pyrococcus Furiosus Pfu-1862794- 001 Length = 262 Back     alignment and structure
>gi|226887602|pdb|2WEF|A Chain A, Human 3'(2'), 5'-Bisphosphate Nucleotidase 1 (Bpnt1) In Complex With Amp, Po4 And Magnesium Length = 311 Back     alignment and structure
>gi|163311033|pdb|3B8B|A Chain A, Crystal Structure Of Cysq From Bacteroides Thetaiotaomicron, A Bacterial Member Of The Inositol Monophosphatase Family Length = 292 Back     alignment and structure
gi|7245969|pdb|1QGX|A Chain A, X-Ray Structure Of Yeast Hal2p Length = 357 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target256 putative inositol-1-monophosphatase [Candidatus Liberib
3lv0_A267 Extragenic suppressor protein SUHB; niaid, seattle stru 2e-62
2qfl_A267 Inositol-1-monophosphatase; impase extragenic suppresso 3e-42
2pcr_A264 Inositol-1-monophosphatase; bipolar disorder, structura 1e-36
1g0h_A252 Inositol monophosphatase; homodimer, complexed with Ca2 7e-36
2p3n_A256 Inositol-1-monophosphatase; tetramer, hydrolase; 2.20A 1e-35
1jp4_A308 3'(2'),5'-bisphosphate nucleotidase; protein-product co 3e-32
2bji_A277 Inositol-1(OR 4)-monophosphatase; hydrolase, aspartic p 3e-31
1lbv_A252 Fbpase/impase, fructose 1,6-bisphosphatase/inositol mon 3e-31
2q74_A299 Inositol-1-monophosphatase; alpha-beta-alpha-beta-alpha 1e-30
2fvz_A273 Inositol monophosphatase 2; inositol metabolism, struct 5e-29
3b8b_A292 CYSQ, sulfite synthesis pathway protein; 3'-phosphoaden 9e-26
1inp_A400 Inositol polyphosphate 1-phosphatase; hydrolase(phospho 2e-24
1vdw_A254 Hypothetical protein PH1897; homodimer, riken structura 3e-22
1xi6_A262 Extragenic suppressor; structural genomics, southeast c 3e-19
1inp_A 400 Inositol polyphosphate 1-phosphatase; hydrolase(phospho 6e-04
1ka1_A357 Halotolerance protein HAL2; nucleotidase, salt toleranc 1e-23
1ka1_A 357 Halotolerance protein HAL2; nucleotidase, salt toleranc 5e-05
>3lv0_A Extragenic suppressor protein SUHB; niaid, seattle structural genomics center for infectious disease, ssgcid, CAT scratch disease; 1.85A {Bartonella henselae} PDB: 3luz_A Length = 267 Back     alignment and structure
 Score =  234 bits (597), Expect = 2e-62
 Identities = 132/260 (50%), Positives = 179/260 (68%), Gaps = 5/260 (1%)

Query: 1   MSRSALLNVMVSAALKAGKFLSRDFGEVQDLQVSRKGPSDFVMKSHSKCQEIIYQELLGA 60
           M +SA++NVMV AA+KAG+ L RD+GEVQ+LQVS KGP+D+V ++  K ++II+ EL  A
Sbjct: 5   MPQSAVMNVMVQAAMKAGRSLVRDYGEVQNLQVSLKGPADYVSQADRKAEKIIFNELSKA 64

Query: 61  RPKYGFYS-GGKAYVGQDSITRWIVDPLNGITNFFYAIPHFCISIALERDQEIIASVIFN 119
           RPK+GF     +  +G+DS  R+IVDPL+G TNF + IP F +SIALE   +I+A VI+N
Sbjct: 65  RPKFGFLMEESEEIIGEDSQHRFIVDPLDGTTNFLHGIPFFAVSIALESQGKIVAGVIYN 124

Query: 120 PITDELYTAERGIGSFLNDRRIRVSSRRILSNSII----CYATFKRNSRFLMQLCRIMDE 175
           PI DEL+TAERG G+F NDRR RVS+RR L + +I     +     +  +L++L  +M E
Sbjct: 125 PINDELFTAERGSGAFFNDRRCRVSARRRLEDCVIATGMPHLGRPGHGTYLIELRNVMAE 184

Query: 176 AVGVRSFGSEALDLAYIAAGRFDGFLGKGLSIWCVAAGLLIICEAGGFATDFLGKNMGAE 235
             G+R FG+ ALDLAY+AAGR DGF    L IW +AAG+L++ EAGGF TD  G N    
Sbjct: 185 VSGIRRFGTAALDLAYVAAGRTDGFWEDNLQIWDMAAGILMVREAGGFVTDKEGGNDIFR 244

Query: 236 TKSIISGNMPIHEQLLAIIN 255
            K+II+GN  I  +L   + 
Sbjct: 245 KKNIIAGNEHIRIKLERALK 264


>2qfl_A Inositol-1-monophosphatase; impase extragenic suppressor, dimerization, hydrolase; 1.90A {Escherichia coli} Length = 267 Back     alignment and structure
>2pcr_A Inositol-1-monophosphatase; bipolar disorder, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.60A {Aquifex aeolicus VF5} Length = 264 Back     alignment and structure
>1g0h_A Inositol monophosphatase; homodimer, complexed with Ca2+ and I-1-P, hydrolase; HET: IPD; 2.30A {Methanocaldococcus jannaschii} SCOP: e.7.1.1 PDB: 1dk4_A* 1g0i_A* Length = 252 Back     alignment and structure
>2p3n_A Inositol-1-monophosphatase; tetramer, hydrolase; 2.20A {Thermotoga maritima MSB8} PDB: 2p3v_A* Length = 256 Back     alignment and structure
>1jp4_A 3'(2'),5'-bisphosphate nucleotidase; protein-product complex, sugar nucleotidase fold, hydrolase; HET: AMP; 1.69A {Rattus norvegicus} SCOP: e.7.1.1 PDB: 2wef_A* Length = 308 Back     alignment and structure
>2bji_A Inositol-1(OR 4)-monophosphatase; hydrolase, aspartic proteinase mechanism, aspartyl protease, succinimide, zymogen; 1.30A {Bos taurus} PDB: 1imb_A* 1ima_A* 1imc_A 1imd_A 1ime_A 1imf_A 2hhm_A 1awb_A Length = 277 Back     alignment and structure
>1lbv_A Fbpase/impase, fructose 1,6-bisphosphatase/inositol monophosphatase; dual activity, archaeal phosphatase, APO- form, hydrolase; 1.80A {Archaeoglobus fulgidus} SCOP: e.7.1.1 PDB: 1lbw_A 1lbx_A* 1lby_A* 1lbz_A* Length = 252 Back     alignment and structure
>2q74_A Inositol-1-monophosphatase; alpha-beta-alpha-beta-alpha sandwich, hydrolase; 2.60A {Mycobacterium tuberculosis H37RV} Length = 299 Back     alignment and structure
>2fvz_A Inositol monophosphatase 2; inositol metabolism, structural genomics, structural genomics consortium, SGC, hydrolase; 2.40A {Homo sapiens} PDB: 2czh_A 2czi_A 2czk_A 2ddk_A Length = 273 Back     alignment and structure
>3b8b_A CYSQ, sulfite synthesis pathway protein; 3'-phosphoadenosine-5'-phosphosulfate (PAPS) 3'-phosphatase, structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Length = 292 Back     alignment and structure
>1inp_A Inositol polyphosphate 1-phosphatase; hydrolase(phosphoric monoester); 2.30A {Bos taurus} SCOP: e.7.1.1 Length = 400 Back     alignment and structure
>1vdw_A Hypothetical protein PH1897; homodimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; 1.30A {Pyrococcus horikoshii} SCOP: e.7.1.1 Length = 254 Back     alignment and structure
>1xi6_A Extragenic suppressor; structural genomics, southeast collaboratory for structural genomics hyperthermophIle, PSI; 2.80A {Pyrococcus furiosus} SCOP: e.7.1.1 Length = 262 Back     alignment and structure
>1inp_A Inositol polyphosphate 1-phosphatase; hydrolase(phosphoric monoester); 2.30A {Bos taurus} SCOP: e.7.1.1 Length = 400 Back     alignment and structure
>1ka1_A Halotolerance protein HAL2; nucleotidase, salt tolerance, inositol, hydrolase; HET: A3P; 1.30A {Saccharomyces cerevisiae} SCOP: e.7.1.1 PDB: 1k9y_A 1ka0_A* 1k9z_A* 1qgx_A* Length = 357 Back     alignment and structure
>1ka1_A Halotolerance protein HAL2; nucleotidase, salt tolerance, inositol, hydrolase; HET: A3P; 1.30A {Saccharomyces cerevisiae} SCOP: e.7.1.1 PDB: 1k9y_A 1ka0_A* 1k9z_A* 1qgx_A* Length = 357 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target256 putative inositol-1-monophosphatase [Candidatus Liberib
3lv0_A267 Extragenic suppressor protein SUHB; niaid, seattle stru 100.0
2qfl_A267 Inositol-1-monophosphatase; impase extragenic suppresso 100.0
2p3n_A256 Inositol-1-monophosphatase; tetramer, hydrolase; 2.20A 100.0
2pcr_A264 Inositol-1-monophosphatase; bipolar disorder, structura 100.0
2bji_A277 Inositol-1(OR 4)-monophosphatase; hydrolase, aspartic p 100.0
2q74_A299 Inositol-1-monophosphatase; alpha-beta-alpha-beta-alpha 100.0
2fvz_A273 Inositol monophosphatase 2; inositol metabolism, struct 100.0
1vdw_A254 Hypothetical protein PH1897; homodimer, riken structura 100.0
1ka1_A357 Halotolerance protein HAL2; nucleotidase, salt toleranc 100.0
1lbv_A252 Fbpase/impase, fructose 1,6-bisphosphatase/inositol mon 100.0
1g0h_A252 Inositol monophosphatase; homodimer, complexed with Ca2 100.0
1xi6_A262 Extragenic suppressor; structural genomics, southeast c 100.0
3b8b_A292 CYSQ, sulfite synthesis pathway protein; 3'-phosphoaden 100.0
1jp4_A308 3'(2'),5'-bisphosphate nucleotidase; protein-product co 100.0
1inp_A400 Inositol polyphosphate 1-phosphatase; hydrolase(phospho 100.0
2gq1_A332 Fructose-1,6-bisphosphatase; allosteric activator site, 99.13
2fhy_A374 Fructose-1,6-bisphosphatase 1; allosteric inhibitors hu 99.11
1nuw_A337 Fructose-1,6-bisphosphatase; allosteric enzymes, glucon 99.02
1dcu_A357 Fructose-1,6-bisphosphatase; chloroplast, photosynthesi 99.07
3big_A338 Fructose-1,6-bisphosphatase class II GLPX; carbohydrate 96.01
>3lv0_A Extragenic suppressor protein SUHB; niaid, seattle structural genomics center for infectious disease, ssgcid, CAT scratch disease; 1.85A {Bartonella henselae} PDB: 3luz_A Back     alignment and structure
Probab=100.00  E-value=0  Score=445.94  Aligned_cols=256  Identities=51%  Similarity=0.815  Sum_probs=237.0

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHCCCHHHCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCC-CCC
Q ss_conf             9823799999999999999999961742403455408995005899999999999988510000001111222234-567
Q gi|254780156|r    1 MSRSALLNVMVSAALKAGKFLSRDFGEVQDLQVSRKGPSDFVMKSHSKCQEIIYQELLGARPKYGFYSGGKAYVGQ-DSI   79 (256)
Q Consensus         1 M~~~~~l~ia~~aa~~ag~~~~~~f~~~~~~~~~~k~~~d~vT~~D~~~e~~i~~~L~~~~P~~~i~~EE~~~~~~-~~~   79 (256)
                      |+.+++||+|+++|++||++++++|++.+++++++|+++|+||++|+++|++|++.|++.||++.|++||+..... +++
T Consensus         5 m~~~~~l~va~~aa~~Ag~~~l~~f~~~~~l~~~~K~~~d~VT~aD~~~e~~i~~~L~~~~p~~~i~~EE~~~~~~~~~~   84 (267)
T 3lv0_A            5 MPQSAVMNVMVQAAMKAGRSLVRDYGEVQNLQVSLKGPADYVSQADRKAEKIIFNELSKARPKFGFLMEESEEIIGEDSQ   84 (267)
T ss_dssp             ---CHHHHHHHHHHHHHHHHHHHHHTTGGGSCEEEEETTEEEEHHHHHHHHHHHHHHHHHCTTSEEEETTSCCBCCSSTT
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHCCHHHCEEEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCC
T ss_conf             97428999999999999999999847123045634599986659999999999999997299764887640234588987


Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECC
Q ss_conf             13443012334678776665655666420000010011001111221133457763433210001133444105788522
Q gi|254780156|r   80 TRWIVDPLNGITNFFYAIPHFCISIALERDQEIIASVIFNPITDELYTAERGIGSFLNDRRIRVSSRRILSNSIICYATF  159 (256)
Q Consensus        80 ~~WiIDPIDGT~nf~~g~p~~~v~ial~~~g~p~~gvi~~P~~~~~~~A~~g~Ga~~n~~~i~vs~~~~l~~~~i~~~~~  159 (256)
                      ++|||||||||.||++|+|.|||+|||+++|+|++|+||+|.++++|+|.+|.|||+|+++++++....+..+++.....
T Consensus        85 ~~WiIDPIDGT~nf~~g~p~~~vsial~~~g~pv~gvI~~P~~~~~~~a~~g~Ga~~n~~~~~~~~~~~~~~~~~~~~~~  164 (267)
T 3lv0_A           85 HRFIVDPLDGTTNFLHGIPFFAVSIALESQGKIVAGVIYNPINDELFTAERGSGAFFNDRRCRVSARRRLEDCVIATGMP  164 (267)
T ss_dssp             EEEEEEEEECHHHHHTTCSCCEEEEEEEETTEEEEEEEEETTTTEEEEEETTTEEEETTEECCCCCCCSGGGCEEEECCC
T ss_pred             CEEEEECCCCHHHHHCCCCCEEEEEEEEECCEEEEEEECCCCCCCEEEEECCCCCEECCCCCCCCCCCCHHHHEEECCCC
T ss_conf             78999544586787659986478888889998999998247789889986797644658532124443323312531455


Q ss_pred             CC----HHHHHHHHHHCCCCEEEEEEECCCCCCCCCHHCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEECCCCCCCCCC
Q ss_conf             20----14677875310453026775133321000000001232112699776831559999978938996889867888
Q gi|254780156|r  160 KR----NSRFLMQLCRIMDEAVGVRSFGSEALDLAYIAAGRFDGFLGKGLSIWCVAAGLLIICEAGGFATDFLGKNMGAE  235 (256)
Q Consensus       160 ~~----~~~~~~~~~~~~~~~~~ir~~Gs~~l~~~~va~G~~d~~v~~~~~~wD~aag~li~~eaGg~v~d~~G~~~~~~  235 (256)
                      ..    .............+...+|++||+++++|+||+|++|+|+..++++||+|||.+|++||||+++|++|+|+.++
T Consensus       165 ~~~~~~~~~~~~~~~~~~~~~~~ir~~gs~~~~~~~va~G~~d~~~~~~~~~WD~aAg~~i~~eAGG~v~d~~G~~~~~~  244 (267)
T 3lv0_A          165 HLGRPGHGTYLIELRNVMAEVSGIRRFGTAALDLAYVAAGRTDGFWEDNLQIWDMAAGILMVREAGGFVTDKEGGNDIFR  244 (267)
T ss_dssp             CC--CCHHHHHHHHHHHHTTCSEEEBCSCSHHHHHHHHTTSSSEEEESSCCHHHHHHHHHHHHHTTCEEECTTSSSCHHH
T ss_pred             CCCCCCHHHHHHHHHHHHHHCCCEEEEHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEECCCCCCCCCC
T ss_conf             44662102568999876655265776378999899986598652256899899999999999978998987899967689


Q ss_pred             CCEEEEECHHHHHHHHHHHCC
Q ss_conf             980999397999999998659
Q gi|254780156|r  236 TKSIISGNMPIHEQLLAIIND  256 (256)
Q Consensus       236 ~~~iia~n~~i~~~ll~~l~~  256 (256)
                      ++.++|+|+.+|++|+++|++
T Consensus       245 ~~~iia~n~~i~~~l~~~l~~  265 (267)
T 3lv0_A          245 KKNIIAGNEHIRIKLERALKK  265 (267)
T ss_dssp             HTCEEEECHHHHHHHHHHHHT
T ss_pred             CCEEEEECHHHHHHHHHHHHC
T ss_conf             999999899999999999871



>2qfl_A Inositol-1-monophosphatase; impase extragenic suppressor, dimerization, hydrolase; 1.90A {Escherichia coli} Back     alignment and structure
>2p3n_A Inositol-1-monophosphatase; tetramer, hydrolase; 2.20A {Thermotoga maritima MSB8} PDB: 2p3v_A* Back     alignment and structure
>2pcr_A Inositol-1-monophosphatase; bipolar disorder, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.60A {Aquifex aeolicus VF5} Back     alignment and structure
>2bji_A Inositol-1(OR 4)-monophosphatase; hydrolase, aspartic proteinase mechanism, aspartyl protease, succinimide, zymogen; 1.30A {Bos taurus} PDB: 1imb_A* 1ima_A* 1imc_A 1imd_A 1ime_A 1imf_A 2hhm_A 1awb_A Back     alignment and structure
>2q74_A Inositol-1-monophosphatase; alpha-beta-alpha-beta-alpha sandwich, hydrolase; 2.60A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>2fvz_A Inositol monophosphatase 2; inositol metabolism, structural genomics, structural genomics consortium, SGC, hydrolase; 2.40A {Homo sapiens} PDB: 2czh_A 2czi_A 2czk_A 2ddk_A Back     alignment and structure
>1vdw_A Hypothetical protein PH1897; homodimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; 1.30A {Pyrococcus horikoshii} SCOP: e.7.1.1 Back     alignment and structure
>1ka1_A Halotolerance protein HAL2; nucleotidase, salt tolerance, inositol, hydrolase; HET: A3P; 1.30A {Saccharomyces cerevisiae} SCOP: e.7.1.1 PDB: 1k9y_A 1ka0_A* 1k9z_A* 1qgx_A* Back     alignment and structure
>1lbv_A Fbpase/impase, fructose 1,6-bisphosphatase/inositol monophosphatase; dual activity, archaeal phosphatase, APO- form, hydrolase; 1.80A {Archaeoglobus fulgidus} SCOP: e.7.1.1 PDB: 1lbw_A 1lbx_A* 1lby_A* 1lbz_A* Back     alignment and structure
>1g0h_A Inositol monophosphatase; homodimer, complexed with Ca2+ and I-1-P, hydrolase; HET: IPD; 2.30A {Methanocaldococcus jannaschii} SCOP: e.7.1.1 PDB: 1dk4_A* 1g0i_A* Back     alignment and structure
>1xi6_A Extragenic suppressor; structural genomics, southeast collaboratory for structural genomics hyperthermophIle, PSI; 2.80A {Pyrococcus furiosus} SCOP: e.7.1.1 Back     alignment and structure
>3b8b_A CYSQ, sulfite synthesis pathway protein; 3'-phosphoadenosine-5'-phosphosulfate (PAPS) 3'-phosphatase, structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1jp4_A 3'(2'),5'-bisphosphate nucleotidase; protein-product complex, sugar nucleotidase fold, hydrolase; HET: AMP; 1.69A {Rattus norvegicus} SCOP: e.7.1.1 PDB: 2wef_A* Back     alignment and structure
>1inp_A Inositol polyphosphate 1-phosphatase; hydrolase(phosphoric monoester); 2.30A {Bos taurus} SCOP: e.7.1.1 Back     alignment and structure
>2gq1_A Fructose-1,6-bisphosphatase; allosteric activator site, quaternary conformation, hydrolase; 1.45A {Escherichia coli} PDB: 2owz_A* 2ox3_A* 2q8m_A* 2qvr_A* Back     alignment and structure
>2fhy_A Fructose-1,6-bisphosphatase 1; allosteric inhibitors human fbpase, benzoxazole, intersubunit allosteric inhibition of human fpbase, hydrolase; HET: A37; 2.95A {Homo sapiens} Back     alignment and structure
>1nuw_A Fructose-1,6-bisphosphatase; allosteric enzymes, gluconeogenesis, hydrolase; HET: F6P; 1.30A {Sus scrofa} SCOP: e.7.1.1 PDB: 1eyi_A* 1eyj_A* 1cnq_A* 1eyk_A* 1nux_A* 1nuy_A* 1nuz_A* 1nv0_A* 1nv1_A* 1nv2_A* 1nv3_A* 1nv4_A* 1nv5_A* 1nv6_A* 1nv7_A* 1q9d_A* 2qvu_A* 2qvv_A* 1fj6_A* 1fj9_A* ... Back     alignment and structure
>1dcu_A Fructose-1,6-bisphosphatase; chloroplast, photosynthesis, redox regulation, thioredoxin, allostery, hydrolase; 2.20A {Pisum sativum} SCOP: e.7.1.1 PDB: 1d9q_A 1dbz_A 1spi_A Back     alignment and structure
>3big_A Fructose-1,6-bisphosphatase class II GLPX; carbohydrate metabolism, cytoplasm, hydrolase, manganese; 1.85A {Escherichia coli K12} PDB: 2r8t_A 3bih_A 1ni9_A 3d1r_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 256 putative inositol-1-monophosphatase [Candidatus Liberib
d2hhma_272 e.7.1.1 (A:) Inositol monophosphatase {Human (Homo sapi 6e-33
d1jp4a_304 e.7.1.1 (A:) PIPase {Rat (Rattus norvegicus) [TaxId: 10 1e-26
d1inpa_400 e.7.1.1 (A:) Inositol polyphosphate 1-phosphatase {Cow 6e-24
d1vdwa_253 e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose 1e-21
d1lbva_252 e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose 8e-21
d1xi6a_249 e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose 3e-20
d1g0ha_252 e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose 5e-19
d1inpa_ 400 e.7.1.1 (A:) Inositol polyphosphate 1-phosphatase {Cow 6e-04
d1ka1a_354 e.7.1.1 (A:) 3';5'-adenosine bisphosphatase, PAP phosph 2e-04
d1ka1a_354 e.7.1.1 (A:) 3';5'-adenosine bisphosphatase, PAP phosph 1e-21
>d2hhma_ e.7.1.1 (A:) Inositol monophosphatase {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: Carbohydrate phosphatase
superfamily: Carbohydrate phosphatase
family: Inositol monophosphatase/fructose-1,6-bisphosphatase-like
domain: Inositol monophosphatase
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  134 bits (338), Expect = 6e-33
 Identities = 60/261 (22%), Positives = 123/261 (47%), Gaps = 12/261 (4%)

Query: 6   LLNVMVSAALKAGKFLSRDFGEVQDLQVSRKGPSDFVMKSHSKCQEIIYQELLGARPKYG 65
            ++  V+ A +AG+ +        ++ + +  P D V  +  K ++++   +    P + 
Sbjct: 4   CMDYAVTLARQAGEVVCEAIKNEMNVML-KSSPVDLVTATDQKVEKMLISSIKEKYPSHS 62

Query: 66  FYSGGKAYVGQDSI----TRWIVDPLNGITNFFYAIPHFCISIALERDQEIIASVIFNPI 121
           F        G+ SI      WI+DP++G TNF +  P   +SI    +++I   V+++ +
Sbjct: 63  FIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCV 122

Query: 122 TDELYTAERGIGSFLNDRRIRVSSRRILSNSIICYATFKRNSRFLMQL------CRIMDE 175
             ++YTA +G G+F N ++++VS +  ++ S++        +   +++            
Sbjct: 123 EGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIP 182

Query: 176 AVGVRSFGSEALDLAYIAAGRFDGFLGKGLSIWCVAAGLLIICEAGGFATDFLGKNMGAE 235
             G+RS G+ A+++  +A G  D +   G+  W VA   +I+ EAGG   D  G      
Sbjct: 183 VHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLM 242

Query: 236 TKSIISGNMPI-HEQLLAIIN 255
           ++ +I+ N  I  E++   I 
Sbjct: 243 SRRVIAANNRILAERIAKEIQ 263


>d1jp4a_ e.7.1.1 (A:) PIPase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 304 Back     information, alignment and structure
>d1inpa_ e.7.1.1 (A:) Inositol polyphosphate 1-phosphatase {Cow (Bos taurus), brain [TaxId: 9913]} Length = 400 Back     information, alignment and structure
>d1vdwa_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 253 Back     information, alignment and structure
>d1lbva_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 252 Back     information, alignment and structure
>d1xi6a_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Pyrococcus furiosus [TaxId: 2261]} Length = 249 Back     information, alignment and structure
>d1g0ha_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 252 Back     information, alignment and structure
>d1inpa_ e.7.1.1 (A:) Inositol polyphosphate 1-phosphatase {Cow (Bos taurus), brain [TaxId: 9913]} Length = 400 Back     information, alignment and structure
>d1ka1a_ e.7.1.1 (A:) 3';5'-adenosine bisphosphatase, PAP phosphatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 354 Back     information, alignment and structure
>d1ka1a_ e.7.1.1 (A:) 3';5'-adenosine bisphosphatase, PAP phosphatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 354 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target256 putative inositol-1-monophosphatase [Candidatus Liberib
d2hhma_272 Inositol monophosphatase {Human (Homo sapiens) [TaxId: 100.0
d1vdwa_253 Archaeal inositol monophosphatase/fructose-1,6-bisphosp 100.0
d1g0ha_252 Archaeal inositol monophosphatase/fructose-1,6-bisphosp 100.0
d1ka1a_354 3';5'-adenosine bisphosphatase, PAP phosphatase {Baker' 100.0
d1xi6a_249 Archaeal inositol monophosphatase/fructose-1,6-bisphosp 100.0
d1lbva_252 Archaeal inositol monophosphatase/fructose-1,6-bisphosp 100.0
d1jp4a_304 PIPase {Rat (Rattus norvegicus) [TaxId: 10116]} 100.0
d1inpa_400 Inositol polyphosphate 1-phosphatase {Cow (Bos taurus), 100.0
d1d9qa_340 Fructose-1,6-bisphosphatase {Garden pea (Pisum sativum) 99.0
d1nuwa_328 Fructose-1,6-bisphosphatase {Pig (Sus scrofa) [TaxId: 9 98.99
d1ni9a_328 Glycerol metabolism protein GlpX {Escherichia coli [Tax 95.79
>d2hhma_ e.7.1.1 (A:) Inositol monophosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Carbohydrate phosphatase
superfamily: Carbohydrate phosphatase
family: Inositol monophosphatase/fructose-1,6-bisphosphatase-like
domain: Inositol monophosphatase
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=0  Score=401.11  Aligned_cols=252  Identities=23%  Similarity=0.432  Sum_probs=219.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCHHHCEEEEC-CCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCC----CC
Q ss_conf             2379999999999999999996174240345540-899500589999999999998851000000111122223----45
Q gi|254780156|r    3 RSALLNVMVSAALKAGKFLSRDFGEVQDLQVSRK-GPSDFVMKSHSKCQEIIYQELLGARPKYGFYSGGKAYVG----QD   77 (256)
Q Consensus         3 ~~~~l~ia~~aa~~ag~~~~~~f~~~~~~~~~~k-~~~d~vT~~D~~~e~~i~~~L~~~~P~~~i~~EE~~~~~----~~   77 (256)
                      .|++|++++++|++||+++++.|++  ..+...| +..|+||++|+++|++|++.|++.||++.|+|||.+..+    .+
T Consensus         1 ~qe~l~~a~~~a~~ag~~i~~~~~~--~~~~~~k~~~~d~VT~aD~~~e~~i~~~L~~~~p~~~ii~EE~~~~~~~~~~~   78 (272)
T d2hhma_           1 WQECMDYAVTLARQAGEVVCEAIKN--EMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILT   78 (272)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHTTS--CCCEEESSSTTCEEEHHHHHHHHHHHHHHHHHCTTCEEEEHHHHHTTCCCCCC
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHCC--CCCEEECCCCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCC
T ss_conf             9899999999999999999998456--77379718997734299999999999999752222101233312222012467


Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEE
Q ss_conf             67134430123346787766656556664200000100110011112211334577634332100011334441057885
Q gi|254780156|r   78 SITRWIVDPLNGITNFFYAIPHFCISIALERDQEIIASVIFNPITDELYTAERGIGSFLNDRRIRVSSRRILSNSIICYA  157 (256)
Q Consensus        78 ~~~~WiIDPIDGT~nf~~g~p~~~v~ial~~~g~p~~gvi~~P~~~~~~~A~~g~Ga~~n~~~i~vs~~~~l~~~~i~~~  157 (256)
                      ++++|||||||||+||++|+|.|||+|+|+++++|++|+||+|.++++|+|.+|+|||+|+++++++...++....+...
T Consensus        79 ~~~~WiiDPIDGT~nf~~g~p~~~isial~~~~~~~~gvi~~P~~~~~~~a~~G~Ga~~n~~~~~~~~~~~~~~~~~~~~  158 (272)
T d2hhma_          79 DNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTE  158 (272)
T ss_dssp             SSCEEEEEEEETHHHHHHTCSCCEEEEEEEETTEEEEEEEEETTTTEEEEEETTSCEEETTEECCCCCCCCGGGCEEECC
T ss_pred             CCCEEEECCCCCCHHHHHHHHHHEEECCCCCCCCCCCCCEECCCCCCEEEECCCCCCCCCCCCCCCCCCCCHHHHHEEEE
T ss_conf             88879956654338999760101010021125763223210025684499728966535784343345566323003431


Q ss_pred             CCCCH--HH----HHHHHHHCCCCEEEEEEECCCCCCCCCHHCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEECCCCCC
Q ss_conf             22201--46----7787531045302677513332100000000123211269977683155999997893899688986
Q gi|254780156|r  158 TFKRN--SR----FLMQLCRIMDEAVGVRSFGSEALDLAYIAAGRFDGFLGKGLSIWCVAAGLLIICEAGGFATDFLGKN  231 (256)
Q Consensus       158 ~~~~~--~~----~~~~~~~~~~~~~~ir~~Gs~~l~~~~va~G~~d~~v~~~~~~wD~aag~li~~eaGg~v~d~~G~~  231 (256)
                      .....  ..    ..............+|++||+++++|+||+|++|+|++.+++.||+|||.+|++||||.++|++|+|
T Consensus       159 ~~~~~~~~~~~~~~~~~~~~~~~~~~~ir~~Gs~~l~~~~va~G~~d~~v~~~~~~wD~aAg~li~~eaGg~vtd~~G~~  238 (272)
T d2hhma_         159 LGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGP  238 (272)
T ss_dssp             CCSCCCHHHHHHHHHHHHHHHTTTCSEEEBCSCHHHHHHHHHHTSSSEEEEESCCHHHHHHHHHHHHHTTCEEECTTSSC
T ss_pred             ECCCCCCHHHHHHHHHHHCCCCCCCCCEEEECHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHCCCEEECCCCCC
T ss_conf             11356622455565431000224546465642599987886068725996369886666899999997899398899992


Q ss_pred             CCCCCCEEEEEC-HHHHHHHHHHHCC
Q ss_conf             788898099939-7999999998659
Q gi|254780156|r  232 MGAETKSIISGN-MPIHEQLLAIIND  256 (256)
Q Consensus       232 ~~~~~~~iia~n-~~i~~~ll~~l~~  256 (256)
                      +.+.++.+++++ +.+|+.|++.|+.
T Consensus       239 ~~~~~~~ii~a~~~~~~~~l~~~l~~  264 (272)
T d2hhma_         239 FDLMSRRVIAANNRILAERIAKEIQV  264 (272)
T ss_dssp             CCTTSSEEEEESSHHHHHHHHHHCCC
T ss_pred             CCCCCCCEEEECCHHHHHHHHHHHHH
T ss_conf             67899909999999999999997340



>d1vdwa_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g0ha_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ka1a_ e.7.1.1 (A:) 3';5'-adenosine bisphosphatase, PAP phosphatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xi6a_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lbva_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jp4a_ e.7.1.1 (A:) PIPase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1inpa_ e.7.1.1 (A:) Inositol polyphosphate 1-phosphatase {Cow (Bos taurus), brain [TaxId: 9913]} Back     information, alignment and structure
>d1d9qa_ e.7.1.1 (A:) Fructose-1,6-bisphosphatase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1nuwa_ e.7.1.1 (A:) Fructose-1,6-bisphosphatase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ni9a_ e.7.1.2 (A:) Glycerol metabolism protein GlpX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 256 putative inositol-1-monophosphatase [Candidatus Li
2qfl_A_267 (A:) Inositol-1-monophosphatase; impase extragenic 3e-44
2pcr_A_264 (A:) Inositol-1-monophosphatase; bipolar disorder, 2e-43
2q74_A_299 (A:) Inositol-1-monophosphatase; alpha-beta-alpha- 8e-43
2p3n_A_256 (A:) Inositol-1-monophosphatase; tetramer, hydrola 3e-42
2fvz_A_273 (A:) Inositol monophosphatase 2; inositol metaboli 7e-42
1vdw_A_254 (A:) Hypothetical protein PH1897; homodimer, riken 8e-42
1xi6_A_262 (A:) Extragenic suppressor; structural genomics, s 3e-41
2bji_A_277 (A:) Inositol-1(OR 4)-monophosphatase; hydrolase, 1e-40
1g0h_A_252 (A:) Inositol monophosphatase; homodimer, complexe 3e-39
1inp_A_400 (A:) Inositol polyphosphate 1-phosphatase; hydrola 6e-39
1ka1_A_357 (A:) Halotolerance protein HAL2; nucleotidase, sal 4e-38
1lbv_A_252 (A:) Fbpase/impase, fructose 1,6-bisphosphatase/in 7e-38
3b8b_A_292 (A:) CYSQ, sulfite synthesis pathway protein; 3'-p 5e-37
1jp4_A_308 (A:) 3'(2'),5'-bisphosphate nucleotidase; protein- 3e-34
1nuw_A_337 (A:) Fructose-1,6-bisphosphatase; allosteric enzym 5e-31
2fhy_A_374 (A:) Fructose-1,6-bisphosphatase 1; allosteric inh 6e-31
1dcu_A_1-228228 (A:1-228) Fructose-1,6-bisphosphatase; chloroplast 2e-21
2gq1_A_1-197197 (A:1-197) Fructose-1,6-bisphosphatase; allosteric 3e-19
>2qfl_A (A:) Inositol-1-monophosphatase; impase extragenic suppressor, dimerization, hydrolase; 1.90A {Escherichia coli}Length = 267 Back     alignment and structure
 Score =  172 bits (437), Expect = 3e-44
 Identities = 87/256 (33%), Positives = 146/256 (57%), Gaps = 5/256 (1%)

Query: 6   LLNVMVSAALKAGKFLSRDFGEVQDLQVSRKGPSDFVMKSHSKCQEIIYQELLGARPKYG 65
           +LN+ V AA KAG  +++++     ++ S+KG +DFV       + +I   +  + P++ 
Sbjct: 4   MLNIAVRAARKAGNLIAKNYETPDAVEASQKGSNDFVTNVDKAAEAVIIDTIRKSYPQHT 63

Query: 66  FYSG-GKAYVGQDSITRWIVDPLNGITNFFYAIPHFCISIALERDQEIIASVIFNPITDE 124
             +       G D   +W++DPL+G TNF   +PHF +SIA+        +V+++P+ +E
Sbjct: 64  IITEESGELEGTDQDVQWVIDPLDGTTNFIKRLPHFAVSIAVRIKGRTEVAVVYDPMRNE 123

Query: 125 LYTAERGIGSFLNDRRIRVSSRRILSNSIIC----YATFKRNSRFLMQLCRIMDEAVGVR 180
           L+TA RG G+ LN  R+R S+ R L  +I+     +   +  + ++  + ++ +E    R
Sbjct: 124 LFTATRGQGAQLNGYRLRGSTARDLDGTILATGFPFKAKQYATTYINIVGKLFNECADFR 183

Query: 181 SFGSEALDLAYIAAGRFDGFLGKGLSIWCVAAGLLIICEAGGFATDFLGKNMGAETKSII 240
           + GS ALDLAY+AAGR DGF   GL  W  AAG L++ EAGG  +DF G +    T +I+
Sbjct: 184 ATGSAALDLAYVAAGRVDGFFEIGLRPWDFAAGELLVREAGGIVSDFTGGHNYMLTGNIV 243

Query: 241 SGNMPIHEQLLAIIND 256
           +GN  + + +LA + D
Sbjct: 244 AGNPRVVKAMLANMRD 259


>2pcr_A (A:) Inositol-1-monophosphatase; bipolar disorder, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.60A {Aquifex aeolicus VF5}Length = 264 Back     alignment and structure
>2q74_A (A:) Inositol-1-monophosphatase; alpha-beta-alpha-beta-alpha sandwich, hydrolase; 2.60A {Mycobacterium tuberculosis H37RV}Length = 299 Back     alignment and structure
>2p3n_A (A:) Inositol-1-monophosphatase; tetramer, hydrolase; 2.20A {Thermotoga maritima MSB8} PDB: 2p3v_A*Length = 256 Back     alignment and structure
>2fvz_A (A:) Inositol monophosphatase 2; inositol metabolism, structural genomics, structural genomics consortium, SGC, hydrolase; 2.40A {Homo sapiens} PDB: 2czh_A 2czi_A 2czk_A 2ddk_ALength = 273 Back     alignment and structure
>1vdw_A (A:) Hypothetical protein PH1897; homodimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; 1.30A {Pyrococcus horikoshii}Length = 254 Back     alignment and structure
>1xi6_A (A:) Extragenic suppressor; structural genomics, southeast collaboratory for structural genomics hyperthermophIle, PSI; 2.80A {Pyrococcus furiosus}Length = 262 Back     alignment and structure
>2bji_A (A:) Inositol-1(OR 4)-monophosphatase; hydrolase, aspartic proteinase mechanism, aspartyl protease, succinimide, zymogen; 1.30A {Bos taurus} PDB: 1imb_A* 1ima_A* 1imc_A 1imd_A 1ime_A 1imf_A 2hhm_A 1awb_ALength = 277 Back     alignment and structure
>1g0h_A (A:) Inositol monophosphatase; homodimer, complexed with Ca2+ and I-1-P, hydrolase; HET: IPD; 2.30A {Methanocaldococcus jannaschii}Length = 252 Back     alignment and structure
>1inp_A (A:) Inositol polyphosphate 1-phosphatase; hydrolase(phosphoric monoester); 2.30A {Bos taurus}Length = 400 Back     alignment and structure
>1ka1_A (A:) Halotolerance protein HAL2; nucleotidase, salt tolerance, inositol, hydrolase; HET: A3P; 1.30A {Saccharomyces cerevisiae}Length = 357 Back     alignment and structure
>1lbv_A (A:) Fbpase/impase, fructose 1,6-bisphosphatase/inositol monophosphatase; dual activity, archaeal phosphatase, APO- form, hydrolase; 1.80A {Archaeoglobus fulgidus}Length = 252 Back     alignment and structure
>3b8b_A (A:) CYSQ, sulfite synthesis pathway protein; 3'-phosphoadenosine-5'-phosphosulfate (PAPS) 3'-phosphatase, structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482}Length = 292 Back     alignment and structure
>1jp4_A (A:) 3'(2'),5'-bisphosphate nucleotidase; protein-product complex, sugar nucleotidase fold, hydrolase; HET: AMP; 1.69A {Rattus norvegicus}Length = 308 Back     alignment and structure
>1nuw_A (A:) Fructose-1,6-bisphosphatase; allosteric enzymes, gluconeogenesis, hydrolase; HET: F6P; 1.30A {Sus scrofa}Length = 337 Back     alignment and structure
>2fhy_A (A:) Fructose-1,6-bisphosphatase 1; allosteric inhibitors human fbpase, benzoxazole, intersubunit allosteric inhibition of human fpbase, hydrolase; HET: A37; 2.95A {Homo sapiens}Length = 374 Back     alignment and structure