254780157

254780157

phosphoribosylaminoimidazole carboxylase catalytic subunit protein

GeneID in NCBI database:8209134Locus tag:CLIBASIA_00200
Protein GI in NCBI database:254780157Protein Accession:YP_003064570.1
Gene range:+(39722, 40219)Protein Length:165aa
Gene description:phosphoribosylaminoimidazole carboxylase catalytic subunit protein
COG prediction:[F] Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase
KEGG prediction:purE; phosphoribosylaminoimidazole carboxylase catalytic subunit protein; K01588 5-(carboxyamino)imidazole ribonucleotide mutase [EC:5.4.99.18]
SEED prediction:Phosphoribosylaminoimidazole carboxylase catalytic subunit (EC 4.1.1.21)
Pathway involved in KEGG:Purine metabolism [PATH:las00230]
Subsystem involved in SEED:De Novo Purine Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-----
MNIAPPVAIIMGSQSDWKIMKYAADMLDTLGIDYEARIISAHRTPDRLIEFAKNARFEGFKLIIAGAGGAAHLPGMIAAMTSLPVLGVPIISQTLGGIDSLLSIVQMPAGVPVGTMAIGQSGAINASLLAVAILALDDKELTDRLNEWRTQQTISISEYPKDIPA
ccccccEEEEEcccccHHHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHcccccEEEEcccccccccHHHHHHHHHccccccEEEEEEcccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccHHHccc
cccccEEEEEEccHHHHHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHcccccccEEEEEEEccccHHHHHHHHccccEEEEEEcccccccHHHHHHHHccccccccEEcccccHcHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcHccccc
mniappvaiimgSQSDWKIMKYAADMLDTLGIDYEARIISAHRTPDRLIEFAKNARFEGFKLIIAgaggaahlpGMIAAMtslpvlgvpiisqtlggiDSLLSIvqmpagvpvgtmaigqsGAINASLLAVAILALDDKELTDRLNEWRTQQtisiseypkdipa
MNIAPPVAIIMGSQSDWKIMKYAADMLDTLGIDYEARIISAHRTPDRLIEFAKNARFEGFKLIIAGAGGAAHLPGMIAAMTSLPVLGVPIISQTLGGIDSLLSIVQMPAGVPVGTMAIGQSGAINASLLAVAILALDDKELTDRLNewrtqqtisiseypkdipa
MNIAPPVAIIMGSQSDWKIMKYAADMLDTLGIDYEARIISAHRTPDRLIEFAKNARFEGFKLIIagaggaaHLPGMIAAMTSLPVLGVPIISQTLGGIDSLLSIVQMPAGVPVGTMAIGQSGAINASLLAVAILALDDKELTDRLNEWRTQQTISISEYPKDIPA
****PPV*IIMGSQSDWKIMKYAADMLDTLGIDYEARIISAHRTPDRLIEFAKNARFEGFKLIIAGAGGAAHLPGMIAAMTSLPVLGVPIISQTLGGIDSLLSIVQMPAGVPVGTMAIGQSGAINASLLAVAILALDDKELTDRLNEWRT***************
MNIAPPVAIIMGSQSDWKIMKYAADMLDTLGIDYEARIISAHRTPDRLIEFAKNARFEGFKLIIAGAGGAAHLPGMIAAMTSLPVLGVPIISQTLGGIDSLLSIVQMPAGVPVGTMAIGQSGAINASLLAVAILALDDKELTDRLNEWRTQQTISISEYPKDIPA
***APPVAIIMGSQSDWKIMKYAADMLDTLGIDYEARIISAHRTPDRLIEFAKNARFEGFKLIIAGAGGAAHLPGMIAAMTSLPVLGVPIISQTLGGIDSLLSIVQMPAGVPVGTMAIGQSGAINASLLAVAILALDDKELTDRLNEWRTQQTISISEY******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNIAPPVAIIMGSQSDWKIMKYAADMLDTLGIDYEARIISAHRTPDRLIEFAKNARFEGFKLIIAGAGGAAHLPGMIAAMTSLPVLGVPIISQTLGGIDSLLSIVQMPAGVPVGTMAIGQSGAINASLLAVAILALDDKELTDRLNEWRTQQTISISEYPKDIPA
MNIAPPVAIIMGSQSDWKIMKYAADMLDTLGIDYEARIISAHRTPDRLIEFAKNARFEGFKLIIAGAGGAAHLPGMIAAMTSLPVLGVPIISQTLGGIDSLLSIVQMPAGVPVGTMAIGQSGAINASLLAVAILALDDKELTDRLNEWRTQQTISISEYPKDIPA
MNIAPPVAIIMGSQSDWKIMKYAADMLDTLGIDYEARIISAHRTPDRLIEFAKNARFEGFKLIIAGAGGAAHLPGMIAAMTSLPVLGVPIISQTLGGIDSLLSIVQMPAGVPVGTMAIGQSGAINASLLAVAILALDDKELTDRLNEWRTQQTISISEYPKDIPA

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target165 phosphoribosylaminoimidazole carboxylase catalytic subu
315122757165 phosphoribosylaminoimidazole carboxylase catalytic subu 1 4e-70
319409271171 phosphoribosylaminoimidazole carboxylase catalytic subu 1 4e-55
15966538166 phosphoribosylaminoimidazole carboxylase catalytic subu 1 7e-55
307300425170 phosphoribosylaminoimidazole carboxylase, catalytic sub 1 7e-55
312115020165 phosphoribosylaminoimidazole carboxylase, catalytic sub 1 3e-54
87201276161 phosphoribosylaminoimidazole carboxylase, catalytic sub 1 1e-53
114705536170 phosphoribosylaminoimidazole carboxylase catalytic subu 1 1e-53
326386293170 phosphoribosylaminoimidazole carboxylase, catalytic sub 1 1e-53
327188799164 phosphoribosylaminoimidazole carboxylase protein, catal 1 2e-53
325063172166 phosphoribosylaminoimidazole carboxylase catalytic subu 1 2e-53
>gi|315122757|ref|YP_004063246.1| phosphoribosylaminoimidazole carboxylase catalytic subunit protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 165 Back     alignment and organism information
 Score =  267 bits (682), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 154/163 (94%)

Query: 1   MNIAPPVAIIMGSQSDWKIMKYAADMLDTLGIDYEARIISAHRTPDRLIEFAKNARFEGF 60
           M+  PP+AIIMGSQSDWKIMKYAADMLDTLG+DYEARIISAHRTPDRL+EFAKNARFEGF
Sbjct: 1   MSRTPPIAIIMGSQSDWKIMKYAADMLDTLGVDYEARIISAHRTPDRLVEFAKNARFEGF 60

Query: 61  KLIIAGAGGAAHLPGMIAAMTSLPVLGVPIISQTLGGIDSLLSIVQMPAGVPVGTMAIGQ 120
           KL+IAGAGGAAHLPGMIAAMTSLPVLGVPI+S+ L G+DSLLSIVQMPAGVPVGT+AIG+
Sbjct: 61  KLVIAGAGGAAHLPGMIAAMTSLPVLGVPIMSRALQGLDSLLSIVQMPAGVPVGTLAIGK 120

Query: 121 SGAINASLLAVAILALDDKELTDRLNEWRTQQTISISEYPKDI 163
           SG++NA+LLA+AILAL+D+ +T+RL +WR QQT S+SEYPKD 
Sbjct: 121 SGSVNAALLAIAILALNDENITERLEDWRIQQTTSVSEYPKDF 163


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|319409271|emb|CBI82915.1| phosphoribosylaminoimidazole carboxylase catalytic subunit [Bartonella schoenbuchensis R1] Length = 171 Back     alignment and organism information
>gi|15966538|ref|NP_386891.1| phosphoribosylaminoimidazole carboxylase catalytic subunit protein [Sinorhizobium meliloti 1021] Length = 166 Back     alignment and organism information
>gi|307300425|ref|ZP_07580205.1| phosphoribosylaminoimidazole carboxylase, catalytic subunit [Sinorhizobium meliloti BL225C] Length = 170 Back     alignment and organism information
>gi|312115020|ref|YP_004012616.1| phosphoribosylaminoimidazole carboxylase, catalytic subunit [Rhodomicrobium vannielii ATCC 17100] Length = 165 Back     alignment and organism information
>gi|87201276|ref|YP_498533.1| phosphoribosylaminoimidazole carboxylase, catalytic subunit [Novosphingobium aromaticivorans DSM 12444] Length = 161 Back     alignment and organism information
>gi|114705536|ref|ZP_01438439.1| phosphoribosylaminoimidazole carboxylase catalytic subunit [Fulvimarina pelagi HTCC2506] Length = 170 Back     alignment and organism information
>gi|326386293|ref|ZP_08207917.1| phosphoribosylaminoimidazole carboxylase, catalytic subunit [Novosphingobium nitrogenifigens DSM 19370] Length = 170 Back     alignment and organism information
>gi|327188799|gb|EGE55993.1| phosphoribosylaminoimidazole carboxylase protein, catalytic subunit [Rhizobium etli CNPAF512] Length = 164 Back     alignment and organism information
>gi|325063172|gb|ADY66862.1| phosphoribosylaminoimidazole carboxylase catalytic subunit [Agrobacterium sp. H13-3] Length = 166 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target165 phosphoribosylaminoimidazole carboxylase catalytic subu
TIGR01162156 TIGR01162, purE, phosphoribosylaminoimidazole carboxyla 4e-57
COG0041162 COG0041, PurE, Phosphoribosylcarboxyaminoimidazole (NCA 1e-56
PLN02948577 PLN02948, PLN02948, phosphoribosylaminoimidazole carbox 3e-55
KOG2835373 KOG2835, KOG2835, KOG2835, Phosphoribosylamidoimidazole 3e-21
COG1691254 COG1691, COG1691, NCAIR mutase (PurE)-related proteins 2e-07
pfam00731150 pfam00731, AIRC, AIR carboxylase 4e-62
>gnl|CDD|130230 TIGR01162, purE, phosphoribosylaminoimidazole carboxylase, PurE protein Back     alignment and domain information
>gnl|CDD|30390 COG0041, PurE, Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|178534 PLN02948, PLN02948, phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>gnl|CDD|38046 KOG2835, KOG2835, KOG2835, Phosphoribosylamidoimidazole-succinocarboxamide synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|31877 COG1691, COG1691, NCAIR mutase (PurE)-related proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|144362 pfam00731, AIRC, AIR carboxylase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 165 phosphoribosylaminoimidazole carboxylase catalytic subu
TIGR01162159 purE phosphoribosylaminoimidazole carboxylase, catalyti 100.0
COG0041162 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase 100.0
pfam00731150 AIRC AIR carboxylase. Members of this family catalyse t 100.0
KOG2835373 consensus 99.92
pfam06506169 PrpR_N Propionate catabolism activator. This domain is 95.13
cd06321 271 PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-bindin 94.14
COG1691254 NCAIR mutase (PurE)-related proteins [General function 99.95
PRK09423 366 gldA glycerol dehydrogenase; Provisional 97.41
pfam00465 312 Fe-ADH Iron-containing alcohol dehydrogenase. 97.11
PRK13054 299 lipid kinase; Reviewed 96.76
PRK13337 305 putative lipid kinase; Reviewed 96.64
PRK13055 334 putative lipid kinase; Reviewed 96.26
PRK10624 381 L-1,2-propanediol oxidoreductase; Provisional 96.16
PRK09860 383 putative alcohol dehydrogenase; Provisional 96.03
PRK00843 351 egsA NAD(P)-dependent glycerol-1-phosphate dehydrogenas 95.61
COG1454 377 EutG Alcohol dehydrogenase, class IV [Energy production 95.45
pfam01761 310 DHQ_synthase 3-dehydroquinate synthase. The 3-dehydroqu 95.37
COG0371 360 GldA Glycerol dehydrogenase and related enzymes [Energy 95.22
PRK00861 296 putative lipid kinase; Reviewed 93.8
cd01539 303 PBP1_GGBP Periplasmic glucose/galactose-binding protein 93.22
COG2984 322 ABC-type uncharacterized transport system, periplasmic 93.17
cd06305 273 PBP1_methylthioribose_binding_like Methylthioribose-bin 92.7
PRK11914 304 diacylglycerol kinase; Reviewed 92.51
COG2515323 Acd 1-aminocyclopropane-1-carboxylate deaminase [Amino 91.96
cd06325 281 PBP1_ABC_uncharacterized_transporter Type I periplasmic 91.5
PRK13805 862 bifunctional acetaldehyde-CoA/alcohol dehydrogenase; Pr 91.31
PRK13059 294 putative lipid kinase; Reviewed 90.9
COG3199 355 Predicted inorganic polyphosphate/ATP-NAD kinase [Gener 90.68
>TIGR01162 purE phosphoribosylaminoimidazole carboxylase, catalytic subunit; InterPro: IPR000031 Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE Back     alignment and domain information
>COG0041 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] Back     alignment and domain information
>pfam00731 AIRC AIR carboxylase Back     alignment and domain information
>KOG2835 consensus Back     alignment and domain information
>pfam06506 PrpR_N Propionate catabolism activator Back     alignment and domain information
>cd06321 PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>COG1691 NCAIR mutase (PurE)-related proteins [General function prediction only] Back     alignment and domain information
>PRK09423 gldA glycerol dehydrogenase; Provisional Back     alignment and domain information
>pfam00465 Fe-ADH Iron-containing alcohol dehydrogenase Back     alignment and domain information
>PRK13054 lipid kinase; Reviewed Back     alignment and domain information
>PRK13337 putative lipid kinase; Reviewed Back     alignment and domain information
>PRK13055 putative lipid kinase; Reviewed Back     alignment and domain information
>PRK10624 L-1,2-propanediol oxidoreductase; Provisional Back     alignment and domain information
>PRK09860 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>PRK00843 egsA NAD(P)-dependent glycerol-1-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>COG1454 EutG Alcohol dehydrogenase, class IV [Energy production and conversion] Back     alignment and domain information
>pfam01761 DHQ_synthase 3-dehydroquinate synthase Back     alignment and domain information
>COG0371 GldA Glycerol dehydrogenase and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK00861 putative lipid kinase; Reviewed Back     alignment and domain information
>cd01539 PBP1_GGBP Periplasmic glucose/galactose-binding protein (GGBP) involved in chemotaxis towards, and active transport of, glucose and galactose in various bacterial species Back     alignment and domain information
>COG2984 ABC-type uncharacterized transport system, periplasmic component [General function prediction only] Back     alignment and domain information
>cd06305 PBP1_methylthioribose_binding_like Methylthioribose-binding protein-like of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily Back     alignment and domain information
>PRK11914 diacylglycerol kinase; Reviewed Back     alignment and domain information
>COG2515 Acd 1-aminocyclopropane-1-carboxylate deaminase [Amino acid transport and metabolism] Back     alignment and domain information
>cd06325 PBP1_ABC_uncharacterized_transporter Type I periplasmic ligand-binding domain of uncharacterized ABC-type transport systems that are predicted to be involved in the uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>PRK13805 bifunctional acetaldehyde-CoA/alcohol dehydrogenase; Provisional Back     alignment and domain information
>PRK13059 putative lipid kinase; Reviewed Back     alignment and domain information
>COG3199 Predicted inorganic polyphosphate/ATP-NAD kinase [General function prediction only] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target165 phosphoribosylaminoimidazole carboxylase catalytic subu
1o4v_A183 Crystal Structure Of The Catalytic Subunit Of A Pho 3e-46
1xmp_A170 Crystal Structure Of Pure (Ba0288) From Bacillus An 3e-42
3opq_A163 Phosphoribosylaminoimidazole Carboxylase With Fruct 2e-40
3oow_A166 Octameric Structure Of The Phosphoribosylaminoimida 3e-40
3lp6_A174 Crystal Structure Of Rv3275c-E60a From Mycobacteriu 3e-35
2ywx_A157 Crystal Structure Of Phosphoribosylaminoimidazole C 1e-34
1u11_A182 Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutas 8e-34
2fw1_A183 Structure Of Pure (N5-Carboxyaminoimidazole Ribonuc 1e-33
2fwb_A183 Structure Of Pure (N5-Carboxyaminoimidazole Ribonuc 2e-33
2fwa_A183 Structure Of Pure (N5-Carboxyaminoimidazole Ribonuc 4e-33
2fw8_A183 Structure Of Pure (N5-Carboxyaminoimidazole Ribonuc 2e-32
2fw9_A183 Structure Of Pure (N5-Carboxyaminoimidazole Ribonuc 3e-32
2fw6_A183 Structure Of Pure (N5-Carboxyaminoimidazole Ribonuc 3e-32
2fwi_A183 Structure Of Pure (N5-Carboxyaminoimidazole Ribonuc 5e-32
2nsh_A169 E. Coli Pure H45q Mutant Complexed With Nitro-Air L 9e-32
2nsl_A169 E. Coli Pure H45n Mutant Complexed With Cair Length 1e-31
2ate_A169 Structure Of The Complex Of Pure With Nitroair Leng 1e-30
1d7a_A161 Crystal Structure Of E. Coli Pure-Mononucleotide Co 1e-30
1qcz_A169 Crystal Structure Of E. Coli Pure, An Unusual Mutas 2e-30
3kuu_A174 Structure Of The Pure Phosphoribosylaminoimidazole 4e-28
2h31_A425 Crystal Structure Of Human Paics, A Bifunctional Ca 1e-26
>gi|34811258|pdb|1O4V|A Chain A, Crystal Structure Of The Catalytic Subunit Of A Phosphoribosylaminoimidazole Mutase (Tm0446) From Thermotoga Maritima At 1.77 A Resolution Length = 183 Back     alignment and structure
 Score =  187 bits (476), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 85/160 (53%), Positives = 114/160 (71%), Gaps = 2/160 (1%)

Query: 5   PPVAIIMGSQSDWKIMKYAADMLDTLGIDYEARIISAHRTPDRLIEFAKNARFEGFKLII 64
           P V IIMGS SD  +MK AA++L+  GIDYE  I+SAHRTPDR+ E+AKNA   G ++II
Sbjct: 14  PRVGIIMGSDSDLPVMKQAAEILEEFGIDYEITIVSAHRTPDRMFEYAKNAEERGIEVII 73

Query: 65  AGAGGAAHLPGMIAAMTSLPVLGVPIISQTLGGIDSLLSIVQMPAGVPVGTMAIGQSGAI 124
           AGAGGAAHLPGM+A++T LPV+GVP+ + TL G+DSL SIVQMP GVPV T+AI    A 
Sbjct: 74  AGAGGAAHLPGMVASITHLPVIGVPVKTSTLNGLDSLFSIVQMPGGVPVATVAIN--NAK 131

Query: 125 NASLLAVAILALDDKELTDRLNEWRTQQTISISEYPKDIP 164
           NA +LA +IL +   E+  ++ E++ +    + E  + + 
Sbjct: 132 NAGILAASILGIKYPEIARKVKEYKERMKREVLEKAQRLE 171


>gi|56967152|pdb|1XMP|A Chain A, Crystal Structure Of Pure (Ba0288) From Bacillus Anthracis At 1.8 Resolution Length = 170 Back     alignment and structure
>gi|312208044|pdb|3OPQ|A Chain A, Phosphoribosylaminoimidazole Carboxylase With Fructose-6-Phosphate Bound To The Central Channel Of The Octameric Protein Structure. Length = 163 Back     alignment and structure
>gi|306992119|pdb|3OOW|A Chain A, Octameric Structure Of The Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit From Francisella Tularensis Subsp. Tularensis Schu S4. Length = 166 Back     alignment and structure
>gi|298508502|pdb|3LP6|A Chain A, Crystal Structure Of Rv3275c-E60a From Mycobacterium Tubercu 1.7a Resolution Length = 174 Back     alignment and structure
gi|159795637|pdb|2YWX|A Chain A, Crystal Structure Of Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit From Methanocaldococcus Jannaschii Length = 157 Back     alignment and structure
>gi|55670104|pdb|1U11|A Chain A, Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) From The Acidophile Acetobacter Aceti Length = 182 Back     alignment and structure
>gi|110591479|pdb|2FW1|A Chain A, Structure Of Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8.5 Length = 183 Back     alignment and structure
>gi|110591491|pdb|2FWB|A Chain A, Structure Of Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) H89f From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8 Length = 183 Back     alignment and structure
>gi|110591489|pdb|2FWA|A Chain A, Structure Of Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) H89n From The Acidophilic Bacterium Acetobacter Aceti, At Ph 7 Length = 183 Back     alignment and structure
>gi|110591485|pdb|2FW8|A Chain A, Structure Of Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) H89g From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8 Length = 183 Back     alignment and structure
>gi|110591487|pdb|2FW9|A Chain A, Structure Of Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) H59f From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8 Length = 183 Back     alignment and structure
>gi|110591481|pdb|2FW6|A Chain A, Structure Of Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) Mutant H59n From The Acidophilic Bacterium Acetobacter Aceti, At Ph 5.4 Length = 183 Back     alignment and structure
>gi|110591497|pdb|2FWI|A Chain A, Structure Of Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) H59d, From The Acidophilic Bacterium Acetobacter Aceti, Complexed With 5-Aminoimidazole Ribonucleotide (Air) Length = 183 Back     alignment and structure
>gi|146386589|pdb|2NSH|A Chain A, E. Coli Pure H45q Mutant Complexed With Nitro-Air Length = 169 Back     alignment and structure
>gi|146386937|pdb|2NSL|A Chain A, E. Coli Pure H45n Mutant Complexed With Cair Length = 169 Back     alignment and structure
>gi|114793433|pdb|2ATE|A Chain A, Structure Of The Complex Of Pure With Nitroair Length = 169 Back     alignment and structure
>gi|6730254|pdb|1D7A|A Chain A, Crystal Structure Of E. Coli Pure-Mononucleotide Complex. Length = 161 Back     alignment and structure
>gi|6573638|pdb|1QCZ|A Chain A, Crystal Structure Of E. Coli Pure, An Unusual Mutase That Catalyzes The Conversion Of N5-Carboxyaminoimidazole Ribonucleotide (N5-Cair) To 4-Carboxyaminoimidazole Ribonucleotide (Cair) In The Purine Biosynthetic Pathway Length = 169 Back     alignment and structure
>gi|281500973|pdb|3KUU|A Chain A, Structure Of The Pure Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit From Yersinia Pestis Length = 174 Back     alignment and structure
>gi|126030593|pdb|2H31|A Chain A, Crystal Structure Of Human Paics, A Bifunctional Carboxylase And Synthetase In Purine Biosynthesis Length = 425 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target165 phosphoribosylaminoimidazole carboxylase catalytic subu
3oow_A166 Phosphoribosylaminoimidazole carboxylase,catalyic; stru 2e-51
2h31_A425 Multifunctional protein ADE2; alpha-beta-alpha, ligase, 9e-50
1o4v_A183 Phosphoribosylaminoimidazole mutase PURE; TM0446, struc 8e-48
3lp6_A174 Phosphoribosylaminoimidazole carboxylase catalyti; alph 8e-48
3kuu_A174 Phosphoribosylaminoimidazole carboxylase catalytic subu 4e-46
1u11_A182 PURE (N5-carboxyaminoimidazole ribonucleotide mutase); 2e-44
1xmp_A170 PURE, phosphoribosylaminoimidazole carboxylase; purine 3e-41
2ywx_A157 Phosphoribosylaminoimidazole carboxylase catalytic subu 1e-38
>3oow_A Phosphoribosylaminoimidazole carboxylase,catalyic; structural genomics, center for structural genomics of infec diseases, csgid; HET: MSE; 1.75A {Francisella tularensis subsp} Length = 166 Back     alignment and structure
 Score =  196 bits (499), Expect = 2e-51
 Identities = 91/156 (58%), Positives = 114/156 (73%)

Query: 5   PPVAIIMGSQSDWKIMKYAADMLDTLGIDYEARIISAHRTPDRLIEFAKNARFEGFKLII 64
             V +IMGS+SDW  MK   D+LD LGI YE  ++SAHRTPD++ ++A+ A+  G K+II
Sbjct: 6   VQVGVIMGSKSDWSTMKECCDILDNLGIGYECEVVSAHRTPDKMFDYAETAKERGLKVII 65

Query: 65  AGAGGAAHLPGMIAAMTSLPVLGVPIISQTLGGIDSLLSIVQMPAGVPVGTMAIGQSGAI 124
           AGAGGAAHLPGM+AA T+LPVLGVP+ S TL G DSLLSIVQMPAG+PV T AIG +GA 
Sbjct: 66  AGAGGAAHLPGMVAAKTTLPVLGVPVKSSTLNGQDSLLSIVQMPAGIPVATFAIGMAGAK 125

Query: 125 NASLLAVAILALDDKELTDRLNEWRTQQTISISEYP 160
           NA+L A +IL   D  +   L E+R +QT  + E P
Sbjct: 126 NAALFAASILQHTDINIAKALAEFRAEQTRFVLENP 161


>2h31_A Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} Length = 425 Back     alignment and structure
>1o4v_A Phosphoribosylaminoimidazole mutase PURE; TM0446, structural genomics, JCSG, PSI, protein structure initiative; 1.77A {Thermotoga maritima} SCOP: c.23.8.1 Length = 183 Back     alignment and structure
>3lp6_A Phosphoribosylaminoimidazole carboxylase catalyti; alpha and beta protein, structural genomics, PSI-2, protein initiative; 1.70A {Mycobacterium tuberculosis} Length = 174 Back     alignment and structure
>3kuu_A Phosphoribosylaminoimidazole carboxylase catalytic subunit PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structural genomics; 1.41A {Yersinia pestis} PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* Length = 174 Back     alignment and structure
>1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide mutase); acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A Length = 182 Back     alignment and structure
>1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1 Length = 170 Back     alignment and structure
>2ywx_A Phosphoribosylaminoimidazole carboxylase catalytic subunit; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} Length = 157 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target165 phosphoribosylaminoimidazole carboxylase catalytic subu
3oow_A166 Phosphoribosylaminoimidazole carboxylase,catalyic; stru 100.0
3kuu_A174 Phosphoribosylaminoimidazole carboxylase catalytic subu 100.0
1xmp_A170 PURE, phosphoribosylaminoimidazole carboxylase; purine 100.0
1u11_A182 PURE (N5-carboxyaminoimidazole ribonucleotide mutase); 100.0
3lp6_A174 Phosphoribosylaminoimidazole carboxylase catalyti; alph 100.0
1o4v_A183 Phosphoribosylaminoimidazole mutase PURE; TM0446, struc 100.0
2h31_A425 Multifunctional protein ADE2; alpha-beta-alpha, ligase, 100.0
2ywx_A157 Phosphoribosylaminoimidazole carboxylase catalytic subu 100.0
2q5c_A196 NTRC family transcriptional regulator; structural genom 96.61
2pju_A225 Propionate catabolism operon regulatory protein; struct 91.59
1jq5_A 370 Glycerol dehydrogenase; oxidoreductase, NAD, glycerol m 97.19
1o2d_A 371 Alcohol dehydrogenase, iron-containing; TM0920, structu 96.89
1vlj_A 407 NADH-dependent butanol dehydrogenase; TM0820, structura 96.72
1ta9_A 450 Glycerol dehydrogenase; oxidoreductase; 1.90A {Schizosa 96.65
1rrm_A 386 Lactaldehyde reductase; structural genomics, dehydrogen 96.63
3bfj_A 387 1,3-propanediol oxidoreductase; opportunistic pathogens 95.9
2bon_A 332 Lipid kinase; DAG kinase, ATP-binding, transferase; 1.9 95.74
3ce9_A 354 Glycerol dehydrogenase; NP_348253.1, 3-dehydroquinate s 95.42
3jzd_A 358 Iron-containing alcohol dehydrogenase; YP_298327.1, put 95.31
2gru_A 368 2-deoxy-scyllo-inosose synthase; aminoglycoside, 2-deox 95.24
3okf_A 390 3-dehydroquinate synthase; structural genomics, center 95.01
1oj7_A 408 Hypothetical oxidoreductase YQHD; structural genomics; 94.89
3lft_A 295 Uncharacterized protein; ABC, ATPase, cassette, L-Trp, 94.85
3iv7_A 364 Alcohol dehydrogenase IV; NP_602249.1, iron-containing 94.76
3hl0_A 353 Maleylacetate reductase; structural genomics, PSI-2, pr 94.23
2qv7_A 337 Diacylglycerol kinase DGKB; alpha-beta domain 1, beta s 94.02
1pfk_A 320 Phosphofructokinase; transferase(phosphotransferase); H 93.82
1xah_A 354 Sadhqs, 3-dehydroquinate synthase; shikimate pathway, a 93.11
2fn9_A 290 Ribose ABC transporter, periplasmic ribose- binding pro 92.93
3l6u_A 293 ABC-type sugar transport system periplasmic component; 91.67
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and b 90.77
>3oow_A Phosphoribosylaminoimidazole carboxylase,catalyic; structural genomics, center for structural genomics of infec diseases, csgid; HET: MSE; 1.75A {Francisella tularensis subsp} Back     alignment and structure
Probab=100.00  E-value=0  Score=410.24  Aligned_cols=163  Identities=56%  Similarity=0.892  Sum_probs=160.2

Q ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEEEEHHCCHHHHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHC
Q ss_conf             98874999958816989999999999980998265453010387999988987653598299997267668511346522
Q gi|254780157|r    2 NIAPPVAIIMGSQSDWKIMKYAADMLDTLGIDYEARIISAHRTPDRLIEFAKNARFEGFKLIIAGAGGAAHLPGMIAAMT   81 (165)
Q Consensus         2 ~~~pkV~Ii~GS~SD~~~~~~a~~~L~~~gI~~~~~V~SAHR~p~~l~~~~~~~~~~~~~viIa~AG~aaaLpgvva~~t   81 (165)
                      +|++||+|||||+||+++|+++.++|++|||+|+++|+||||+|+++++|++++++++++|||++|||++|||||++++|
T Consensus         3 ~~~~kV~IimGS~SD~~~~~~a~~~L~~~gI~~e~~V~SAHRtp~~l~~~~~~~~~~~~~ViIa~AG~aa~LpGvva~~t   82 (166)
T 3oow_A            3 AMSVQVGVIMGSKSDWSTMKECCDILDNLGIGYECEVVSAHRTPDKMFDYAETAKERGLKVIIAGAGGAAHLPGMVAAKT   82 (166)
T ss_dssp             --CEEEEEEESSGGGHHHHHHHHHHHHHTTCEEEEEECCTTTCHHHHHHHHHHTTTTTCCEEEEEECSSCCHHHHHHHTC
T ss_pred             CCCCCEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHCC
T ss_conf             89873899978786899999999999984994588888160798999999999985597499980577644541176636


Q ss_pred             CCCEEEECCCCCCCCCCCCHHHHHHCCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             42036612577666750016998403569862044316753122899999997069999999999999999999984054
Q gi|254780157|r   82 SLPVLGVPIISQTLGGIDSLLSIVQMPAGVPVGTMAIGQSGAINASLLAVAILALDDKELTDRLNEWRTQQTISISEYPK  161 (165)
Q Consensus        82 ~~PVIgVP~~~~~~~G~dallS~vqMP~Gvpvatv~vg~~~~~NAal~A~~Il~~~d~~i~~kl~~~r~~~~~~v~~~~~  161 (165)
                      ++||||||+++++++|+|+|||++|||+||||+|+++|++|++|||++|+|||+++|++|++||++||++++++|.++++
T Consensus        83 ~~PVIgVP~~~~~l~G~d~llS~vqMP~GvPVatvavg~~~~~NAallA~~Ilal~d~~i~~~l~~yr~~~~~~v~~~~~  162 (166)
T 3oow_A           83 TLPVLGVPVKSSTLNGQDSLLSIVQMPAGIPVATFAIGMAGAKNAALFAASILQHTDINIAKALAEFRAEQTRFVLENPD  162 (166)
T ss_dssp             SSCEEEEECCCTTTTTHHHHHHHHTCCTTSCCEECCSTHHHHHHHHHHHHHHHGGGCHHHHHHHHHHHHHHHHHHHTCCC
T ss_pred             CCCEEEECCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             88868630454567772128999709878984478627764278999999998479999999999999999999863788


Q ss_pred             HCC
Q ss_conf             067
Q gi|254780157|r  162 DIP  164 (165)
Q Consensus       162 ~l~  164 (165)
                      ++|
T Consensus       163 ~~e  165 (166)
T 3oow_A          163 PRE  165 (166)
T ss_dssp             CC-
T ss_pred             CCC
T ss_conf             445



>3kuu_A Phosphoribosylaminoimidazole carboxylase catalytic subunit PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structural genomics; 1.41A {Yersinia pestis} PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* Back     alignment and structure
>1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1 Back     alignment and structure
>1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide mutase); acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A Back     alignment and structure
>3lp6_A Phosphoribosylaminoimidazole carboxylase catalyti; alpha and beta protein, structural genomics, PSI-2, protein initiative; 1.70A {Mycobacterium tuberculosis} Back     alignment and structure
>1o4v_A Phosphoribosylaminoimidazole mutase PURE; TM0446, structural genomics, JCSG, PSI, protein structure initiative; 1.77A {Thermotoga maritima} SCOP: c.23.8.1 Back     alignment and structure
>2h31_A Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} Back     alignment and structure
>2ywx_A Phosphoribosylaminoimidazole carboxylase catalytic subunit; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} Back     alignment and structure
>2q5c_A NTRC family transcriptional regulator; structural genomics, PSI-2, protein structure initiative; HET: SO4 GOL; 1.49A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>2pju_A Propionate catabolism operon regulatory protein; structural genomics, PRPR, transcriptional regulation, PSI- 2, protein structure initiative; 2.10A {Escherichia coli} SCOP: c.92.3.1 Back     alignment and structure
>1jq5_A Glycerol dehydrogenase; oxidoreductase, NAD, glycerol metabolism; HET: NAD; 1.70A {Geobacillus stearothermophilus} SCOP: e.22.1.2 PDB: 1jpu_A* 1jqa_A* Back     alignment and structure
>1o2d_A Alcohol dehydrogenase, iron-containing; TM0920, structural genomics, JCSG, PSI, protein structure initiative; HET: MSE NAP TRS; 1.30A {Thermotoga maritima} SCOP: e.22.1.2 PDB: 1vhd_A* Back     alignment and structure
>1vlj_A NADH-dependent butanol dehydrogenase; TM0820, structural genomics, JCSG, protein structure initiative, PSI; HET: NAP; 1.78A {Thermotoga maritima MSB8} SCOP: e.22.1.2 Back     alignment and structure
>1ta9_A Glycerol dehydrogenase; oxidoreductase; 1.90A {Schizosaccharomyces pombe} Back     alignment and structure
>1rrm_A Lactaldehyde reductase; structural genomics, dehydrogenase, PSI, protein structure initiative; HET: APR; 1.60A {Escherichia coli} SCOP: e.22.1.2 PDB: 2bi4_A* 2bl4_A* Back     alignment and structure
>3bfj_A 1,3-propanediol oxidoreductase; opportunistic pathogens, decamer, structural genomics, structural proteomics in europe, spine; 2.70A {Klebsiella pneumoniae} Back     alignment and structure
>2bon_A Lipid kinase; DAG kinase, ATP-binding, transferase; 1.9A {Escherichia coli} SCOP: e.52.1.2 PDB: 2jgr_A 2p1r_A Back     alignment and structure
>3ce9_A Glycerol dehydrogenase; NP_348253.1, 3-dehydroquinate synthase, structural genomics, joint center for structural genomics; HET: MSE; 2.37A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>3jzd_A Iron-containing alcohol dehydrogenase; YP_298327.1, putative alcohol dehedrogenase, structural genomics; HET: MSE NAD PG4 P6G PGE; 2.10A {Ralstonia eutropha JMP134} Back     alignment and structure
>2gru_A 2-deoxy-scyllo-inosose synthase; aminoglycoside, 2-deoxystreptamine, dehydroquinate synthase, lyase; HET: NAD EXO CAK; 2.15A {Bacillus circulans} PDB: 2d2x_A* Back     alignment and structure
>3okf_A 3-dehydroquinate synthase; structural genomics, center for structural genomics of infec diseases, csgid, NAD, lyase; HET: NAD; 2.50A {Vibrio cholerae o1 biovar eltor} Back     alignment and structure
>1oj7_A Hypothetical oxidoreductase YQHD; structural genomics; HET: NZQ; 2.0A {Escherichia coli} SCOP: e.22.1.2 Back     alignment and structure
>3lft_A Uncharacterized protein; ABC, ATPase, cassette, L-Trp, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE TRP; 1.35A {Streptococcus pneumoniae} Back     alignment and structure
>3iv7_A Alcohol dehydrogenase IV; NP_602249.1, iron-containing alcohol dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>3hl0_A Maleylacetate reductase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 1.60A {Agrobacterium tumefaciens str} Back     alignment and structure
>2qv7_A Diacylglycerol kinase DGKB; alpha-beta domain 1, beta sandwich domain 2, protein-ADP complex, transferase; HET: ADP; 2.30A {Staphylococcus aureus} SCOP: e.52.1.2 PDB: 2qvl_A Back     alignment and structure
>1pfk_A Phosphofructokinase; transferase(phosphotransferase); HET: FBP ADP; 2.40A {Escherichia coli} SCOP: c.89.1.1 PDB: 2pfk_A Back     alignment and structure
>1xah_A Sadhqs, 3-dehydroquinate synthase; shikimate pathway, aromatic amino acid biosynthesis, open form, form B, domain movement, cyclase; HET: NAD; 2.20A {Staphylococcus aureus} PDB: 1xag_A* 1xai_A* 1xaj_A* 1xal_A* Back     alignment and structure
>2fn9_A Ribose ABC transporter, periplasmic ribose- binding protein; RBP, periplasmic binding protein, thermophilic proteins; 1.40A {Thermotoga maritima MSB8} PDB: 2fn8_A* Back     alignment and structure
>3l6u_A ABC-type sugar transport system periplasmic component; structural genomics, nysgrc, target 11006S, PSI-2, protein structure initiative; 1.90A {Exiguobacterium sibiricum} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 165 phosphoribosylaminoimidazole carboxylase catalytic subu
d1o4va_169 c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidaz 1e-44
d1xmpa_155 c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidaz 2e-43
d1u11a_159 c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidaz 9e-43
d1qcza_163 c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidaz 1e-42
>d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} Length = 169 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
family: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
domain: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
species: Thermotoga maritima [TaxId: 2336]
 Score =  172 bits (438), Expect = 1e-44
 Identities = 85/159 (53%), Positives = 114/159 (71%), Gaps = 2/159 (1%)

Query: 5   PPVAIIMGSQSDWKIMKYAADMLDTLGIDYEARIISAHRTPDRLIEFAKNARFEGFKLII 64
           P V IIMGS SD  +MK AA++L+  GIDYE  I+SAHRTPDR+ E+AKNA   G ++II
Sbjct: 1   PRVGIIMGSDSDLPVMKQAAEILEEFGIDYEITIVSAHRTPDRMFEYAKNAEERGIEVII 60

Query: 65  AGAGGAAHLPGMIAAMTSLPVLGVPIISQTLGGIDSLLSIVQMPAGVPVGTMAIGQSGAI 124
           AGAGGAAHLPGM+A++T LPV+GVP+ + TL G+DSL SIVQMP GVPV T+AI    A 
Sbjct: 61  AGAGGAAHLPGMVASITHLPVIGVPVKTSTLNGLDSLFSIVQMPGGVPVATVAIN--NAK 118

Query: 125 NASLLAVAILALDDKELTDRLNEWRTQQTISISEYPKDI 163
           NA +LA +IL +   E+  ++ E++ +    + E  + +
Sbjct: 119 NAGILAASILGIKYPEIARKVKEYKERMKREVLEKAQRL 157


>d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} Length = 155 Back     information, alignment and structure
>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} Length = 159 Back     information, alignment and structure
>d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} Length = 163 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target165 phosphoribosylaminoimidazole carboxylase catalytic subu
d1qcza_163 N5-CAIR mutase (phosphoribosylaminoimidazole carboxylas 100.0
d1u11a_159 N5-CAIR mutase (phosphoribosylaminoimidazole carboxylas 100.0
d1xmpa_155 N5-CAIR mutase (phosphoribosylaminoimidazole carboxylas 100.0
d1o4va_169 N5-CAIR mutase (phosphoribosylaminoimidazole carboxylas 100.0
d2pjua1186 Propionate catabolism operon regulatory protein PrpR {E 91.84
d1jq5a_ 366 Glycerol dehydrogenase {Bacillus stearothermophilus [Ta 97.19
d1o2da_ 359 Alcohol dehydrogenase TM0920 {Thermotoga maritima [TaxI 96.89
d1vlja_ 398 NADH-dependent butanol dehydrogenase A (TM0820) {Thermo 96.75
d1rrma_ 385 Lactaldehyde reductase FucO {Escherichia coli [TaxId: 5 96.28
d2bona1 295 Lipid kinase YegS {Escherichia coli [TaxId: 562]} 96.14
d2qv7a1 312 Diacylglycerol kinase DgkB {Staphylococcus aureus [TaxI 95.05
d1oj7a_ 390 Hypothetical oxidoreductase yqhD {Escherichia coli [Tax 94.66
d1kq3a_ 364 Glycerol dehydrogenase {Thermotoga maritima [TaxId: 233 90.69
>d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
family: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
domain: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=395.99  Aligned_cols=161  Identities=58%  Similarity=0.937  Sum_probs=158.1

Q ss_pred             CEEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEEEEHHCCHHHHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHCCCC
Q ss_conf             74999958816989999999999980998265453010387999988987653598299997267668511346522420
Q gi|254780157|r    5 PPVAIIMGSQSDWKIMKYAADMLDTLGIDYEARIISAHRTPDRLIEFAKNARFEGFKLIIAGAGGAAHLPGMIAAMTSLP   84 (165)
Q Consensus         5 pkV~Ii~GS~SD~~~~~~a~~~L~~~gI~~~~~V~SAHR~p~~l~~~~~~~~~~~~~viIa~AG~aaaLpgvva~~t~~P   84 (165)
                      +||+|||||+||+++|+++.++|++|||+|+++|+||||+|+++++|++++++++++|||++|||++||||+++++|++|
T Consensus         2 aKV~IImGS~SD~~~~~~a~~~L~~~gI~~e~~v~SAHRtp~~l~~~~~~~~~~~~~ViIa~AG~aa~LpgvvA~~t~~P   81 (163)
T d1qcza_           2 ARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVP   81 (163)
T ss_dssp             CCEEEEESSGGGHHHHHHHHHHHHHHTCCEEEEECCTTTCHHHHHHHHHHTTTTTCSEEEEEECSSCCHHHHHHHSCSSC
T ss_pred             CEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHCCCE
T ss_conf             85999978674499999999999983997699984220488999999999997497699985268876520466734411


Q ss_pred             EEEECCCCCCCCCCCCHHHHHHCCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             36612577666750016998403569862044316753122899999997069999999999999999999984054067
Q gi|254780157|r   85 VLGVPIISQTLGGIDSLLSIVQMPAGVPVGTMAIGQSGAINASLLAVAILALDDKELTDRLNEWRTQQTISISEYPKDIP  164 (165)
Q Consensus        85 VIgVP~~~~~~~G~dallS~vqMP~Gvpvatv~vg~~~~~NAal~A~~Il~~~d~~i~~kl~~~r~~~~~~v~~~~~~l~  164 (165)
                      |||||+++++++|+|+|||++|||+||||+|+++|++|++|||++|+|||+++|++|++||++||+++++++.+++++..
T Consensus        82 VIgVP~~~~~~~g~d~lls~~qMp~g~pv~tv~v~~~~~~nAal~A~~IL~~~d~~l~~kl~~~r~~~~~~v~~~~~~~~  161 (163)
T d1qcza_          82 VLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPRG  161 (163)
T ss_dssp             EEEEECCCTTTTTHHHHHHHHTCCTTCCCEECCSSHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHTCCCCSC
T ss_pred             EEECCCCCCCCCCCCHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             45113311246774036677544579996279975675489999999997479999999999999999999856877545


Q ss_pred             C
Q ss_conf             9
Q gi|254780157|r  165 A  165 (165)
Q Consensus       165 a  165 (165)
                      |
T Consensus       162 a  162 (163)
T d1qcza_         162 A  162 (163)
T ss_dssp             C
T ss_pred             C
T ss_conf             8



>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} Back     information, alignment and structure
>d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pjua1 c.92.3.1 (A:11-196) Propionate catabolism operon regulatory protein PrpR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jq5a_ e.22.1.2 (A:) Glycerol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1o2da_ e.22.1.2 (A:) Alcohol dehydrogenase TM0920 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vlja_ e.22.1.2 (A:) NADH-dependent butanol dehydrogenase A (TM0820) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rrma_ e.22.1.2 (A:) Lactaldehyde reductase FucO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bona1 e.52.1.2 (A:5-299) Lipid kinase YegS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qv7a1 e.52.1.2 (A:1-312) Diacylglycerol kinase DgkB {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1oj7a_ e.22.1.2 (A:) Hypothetical oxidoreductase yqhD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kq3a_ e.22.1.2 (A:) Glycerol dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 165 phosphoribosylaminoimidazole carboxylase catalytic
1xmp_A_170 (A:) PURE, phosphoribosylaminoimidazole carboxylas 3e-50
1o4v_A_183 (A:) Phosphoribosylaminoimidazole mutase PURE; TM0 2e-48
1u11_A_182 (A:) PURE (N5-carboxyaminoimidazole ribonucleotide 3e-48
3kuu_A_174 (A:) Phosphoribosylaminoimidazole carboxylase cata 4e-47
2ywx_A_157 (A:) Phosphoribosylaminoimidazole carboxylase cata 7e-43
2h31_A_261-394134 (A:261-394) Multifunctional protein ADE2; alpha-be 5e-36
>1xmp_A (A:) PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis}Length = 170 Back     alignment and structure
 Score =  191 bits (488), Expect = 3e-50
 Identities = 88/162 (54%), Positives = 115/162 (70%)

Query: 2   NIAPPVAIIMGSQSDWKIMKYAADMLDTLGIDYEARIISAHRTPDRLIEFAKNARFEGFK 61
           ++   V +IMGS SDW+ MKYA D+LD L I YE +++SAHRTPD + E+A+ AR  G K
Sbjct: 9   HMKSLVGVIMGSTSDWETMKYACDILDELNIPYEKKVVSAHRTPDYMFEYAETARERGLK 68

Query: 62  LIIAGAGGAAHLPGMIAAMTSLPVLGVPIISQTLGGIDSLLSIVQMPAGVPVGTMAIGQS 121
           +IIAGAGGAAHLPGM+AA T+LPV+GVP+ S+ L G+DSLLSIVQMP GVPV T+AIG++
Sbjct: 69  VIIAGAGGAAHLPGMVAAKTNLPVIGVPVQSKALNGLDSLLSIVQMPGGVPVATVAIGKA 128

Query: 122 GAINASLLAVAILALDDKELTDRLNEWRTQQTISISEYPKDI 163
           G+ NA LLA  IL     ++ D L   R      + E  + +
Sbjct: 129 GSTNAGLLAAQILGSFHDDIHDALELRREAIEKDVREGSELV 170


>1o4v_A (A:) Phosphoribosylaminoimidazole mutase PURE; TM0446, structural genomics, JCSG, PSI, protein structure initiative; 1.77A {Thermotoga maritima}Length = 183 Back     alignment and structure
>1u11_A (A:) PURE (N5-carboxyaminoimidazole ribonucleotide mutase); acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti}Length = 182 Back     alignment and structure
>3kuu_A (A:) Phosphoribosylaminoimidazole carboxylase catalytic subunit PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structural genomics; 1.41A {Yersinia pestis} PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A*Length = 174 Back     alignment and structure
>2ywx_A (A:) Phosphoribosylaminoimidazole carboxylase catalytic subunit; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii}Length = 157 Back     alignment and structure
>2h31_A (A:261-394) Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens}Length = 134 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target165 phosphoribosylaminoimidazole carboxylase catalytic subu
3kuu_A_174 Phosphoribosylaminoimidazole carboxylase catalytic 100.0
1u11_A_182 PURE (N5-carboxyaminoimidazole ribonucleotide muta 100.0
1xmp_A_170 PURE, phosphoribosylaminoimidazole carboxylase; pu 100.0
1o4v_A_183 Phosphoribosylaminoimidazole mutase PURE; TM0446, 100.0
2ywx_A_157 Phosphoribosylaminoimidazole carboxylase catalytic 100.0
2h31_A_261-394134 Multifunctional protein ADE2; alpha-beta-alpha, li 100.0
3lft_A_1-117_236-266148 Uncharacterized protein; ABC, ATPase, cassette, L- 96.71
1qpz_A_58-160_293-340151 PURA, protein (purine nucleotide synthesis repress 91.45
2h31_A_1-89_235-260_395-425146 Multifunctional protein ADE2; alpha-beta-alpha, li 97.67
1jq5_A_1-163163 Glycerol dehydrogenase; oxidoreductase, NAD, glyce 97.08
1o2d_A_1-188188 Alcohol dehydrogenase, iron-containing; TM0920, st 96.46
1vlj_A_1-193193 NADH-dependent butanol dehydrogenase; TM0820, stru 96.43
2q5c_A_1-78_169-196106 NTRC family transcriptional regulator; structural 96.34
3bfj_A_1-185185 1,3-propanediol oxidoreductase; opportunistic path 96.31
3ce9_A_1-162162 Glycerol dehydrogenase; NP_348253.1, 3-dehydroquin 95.79
1rrm_A_1-183183 Lactaldehyde reductase; structural genomics, dehyd 95.42
1xah_A_1-165165 Sadhqs, 3-dehydroquinate synthase; shikimate pathw 95.26
1ta9_A_1-219219 Glycerol dehydrogenase; oxidoreductase; 1.90A {Sch 95.23
1oj7_A_27-201175 Hypothetical oxidoreductase YQHD; structural genom 95.23
3brs_A_1-112_246-289156 Periplasmic binding protein/LACI transcriptional r 95.01
2fn9_A_1-106_247-290150 Ribose ABC transporter, periplasmic ribose- bindin 94.89
3jzd_A_1-161161 Iron-containing alcohol dehydrogenase; YP_298327.1 94.81
1ujn_A_1-160160 Dehydroquinate synthase; riken structural genomics 94.65
1pfk_A_1-132_254-306185 Phosphofructokinase; transferase(phosphotransferas 94.21
1zxx_A_1-131_253-303182 6-phosphofructokinase; allosteric regulation, lact 93.86
3hl0_A_1-159159 Maleylacetate reductase; structural genomics, PSI- 93.21
3dzc_A_1-196_382-396211 UDP-N-acetylglucosamine 2-epimerase; structural ge 92.54
2dri_A_1-104_237-271139 D-ribose-binding protein; sugar transport; HET: RI 92.14
3clh_A_1-160160 3-dehydroquinate synthase; shikimate pathway, arom 91.24
1sg6_A_1-181181 Pentafunctional AROM polypeptide; shikimate pathwa 90.86
3h75_A_1-121_264-350208 Periplasmic sugar-binding domain protein; protein 90.59
2fvy_A_1-112_258-309164 D-galactose-binding periplasmic protein; periplasm 90.37
2gru_A_1-173173 2-deoxy-scyllo-inosose synthase; aminoglycoside, 2 90.37
>3kuu_A (A:) Phosphoribosylaminoimidazole carboxylase catalytic subunit PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structural genomics; 1.41A {Yersinia pestis} PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=390.95  Aligned_cols=164  Identities=53%  Similarity=0.880  Sum_probs=161.1

Q ss_pred             CCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEEEEHHCCHHHHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHH
Q ss_conf             99887499995881698999999999998099826545301038799998898765359829999726766851134652
Q gi|254780157|r    1 MNIAPPVAIIMGSQSDWKIMKYAADMLDTLGIDYEARIISAHRTPDRLIEFAKNARFEGFKLIIAGAGGAAHLPGMIAAM   80 (165)
Q Consensus         1 m~~~pkV~Ii~GS~SD~~~~~~a~~~L~~~gI~~~~~V~SAHR~p~~l~~~~~~~~~~~~~viIa~AG~aaaLpgvva~~   80 (165)
                      ++..++|+|||||+||+++++|+..+|++|||+|+++|+||||+|+++++|+++++.++++|||++|||++||||+++++
T Consensus         9 ~~~~~~V~Ii~gS~SD~~~~~~a~~~L~~~gi~~e~~V~SaHR~p~~l~~~~~~~~~~~~~viIa~AG~aa~Lpgvva~~   88 (174)
T 3kuu_A            9 YAAGVKIAIVXGSKSDWATXQFAADVLTTLNVPFHVEVVSAHRTPDRLFSFAEQAEANGLHVIIAGNGGAAHLPGXLAAK   88 (174)
T ss_dssp             SCCCCCEEEEESSGGGHHHHHHHHHHHHHTTCCEEEEECCTTTCHHHHHHHHHHTTTTTCSEEEEEEESSCCHHHHHHHT
T ss_pred             CCCCCCEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEEEEEECHHHHHHHHHHHHHCCCEEEEEECCCCCCCCHHHHHH
T ss_conf             04799489997967459999999999998499569999977708178888899998649839998147754450167773


Q ss_pred             CCCCEEEECCCCCCCCCCCCHHHHHHCCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             24203661257766675001699840356986204431675312289999999706999999999999999999998405
Q gi|254780157|r   81 TSLPVLGVPIISQTLGGIDSLLSIVQMPAGVPVGTMAIGQSGAINASLLAVAILALDDKELTDRLNEWRTQQTISISEYP  160 (165)
Q Consensus        81 t~~PVIgVP~~~~~~~G~dallS~vqMP~Gvpvatv~vg~~~~~NAal~A~~Il~~~d~~i~~kl~~~r~~~~~~v~~~~  160 (165)
                      |++||||||+++++++|+|+|||++|||+||||+|+++|++|++|||++|+|||+++|++||+||++||++++++++++|
T Consensus        89 t~~PVIgvP~~~~~~~g~d~l~s~vqMp~g~pvat~~v~i~~~~nAa~~A~qIL~~~d~~i~~kl~~~r~~~~~~v~~~~  168 (174)
T 3kuu_A           89 TLVPVLGVPVQSAALSGVDSLYSIVQXPRGIPVGTLAIGKAGAANAALLAAQILALHDTELAGRLAHWRQSQTDDVLDNP  168 (174)
T ss_dssp             CSSCEEEEEECCTTTTTHHHHHHHHTCCTTSCCEECCSSHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHTCC
T ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             56762123335566766546888864667999658863776538899999999817999999999999999999986686


Q ss_pred             HHCC
Q ss_conf             4067
Q gi|254780157|r  161 KDIP  164 (165)
Q Consensus       161 ~~l~  164 (165)
                      ++|+
T Consensus       169 ~~l~  172 (174)
T 3kuu_A          169 DPRE  172 (174)
T ss_dssp             CTTS
T ss_pred             CCCC
T ss_conf             4110



>1u11_A (A:) PURE (N5-carboxyaminoimidazole ribonucleotide mutase); acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} Back     alignment and structure
>1xmp_A (A:) PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} Back     alignment and structure
>1o4v_A (A:) Phosphoribosylaminoimidazole mutase PURE; TM0446, structural genomics, JCSG, PSI, protein structure initiative; 1.77A {Thermotoga maritima} Back     alignment and structure
>2ywx_A (A:) Phosphoribosylaminoimidazole carboxylase catalytic subunit; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} Back     alignment and structure
>2h31_A (A:261-394) Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} Back     alignment and structure
>3lft_A (A:1-117,A:236-266) Uncharacterized protein; ABC, ATPase, cassette, L-Trp, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE TRP; 1.35A {Streptococcus pneumoniae} Back     alignment and structure
>1qpz_A (A:58-160,A:293-340) PURA, protein (purine nucleotide synthesis repressor); transcription regulation, DNA-binding, purine biosynthesis; HET: DNA HPA; 2.50A {Escherichia coli} Back     alignment and structure
>2h31_A (A:1-89,A:235-260,A:395-425) Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} Back     alignment and structure
>1jq5_A (A:1-163) Glycerol dehydrogenase; oxidoreductase, NAD, glycerol metabolism; HET: NAD; 1.70A {Geobacillus stearothermophilus} Back     alignment and structure
>1o2d_A (A:1-188) Alcohol dehydrogenase, iron-containing; TM0920, structural genomics, JCSG, PSI, protein structure initiative; HET: MSE NAP TRS; 1.30A {Thermotoga maritima} Back     alignment and structure
>1vlj_A (A:1-193) NADH-dependent butanol dehydrogenase; TM0820, structural genomics, JCSG, protein structure initiative, PSI; HET: NAP; 1.78A {Thermotoga maritima MSB8} Back     alignment and structure
>2q5c_A (A:1-78,A:169-196) NTRC family transcriptional regulator; structural genomics, PSI-2, protein structure initiative; HET: SO4 GOL; 1.49A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>3bfj_A (A:1-185) 1,3-propanediol oxidoreductase; opportunistic pathogens, decamer, structural genomics, structural proteomics in europe, spine; 2.70A {Klebsiella pneumoniae} Back     alignment and structure
>3ce9_A (A:1-162) Glycerol dehydrogenase; NP_348253.1, 3-dehydroquinate synthase, structural genomics, joint center for structural genomics; HET: MSE; 2.37A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>1rrm_A (A:1-183) Lactaldehyde reductase; structural genomics, dehydrogenase, PSI, protein structure initiative; HET: APR; 1.60A {Escherichia coli} Back     alignment and structure
>1xah_A (A:1-165) Sadhqs, 3-dehydroquinate synthase; shikimate pathway, aromatic amino acid biosynthesis, open form, form B, domain movement, cyclase; HET: NAD; 2.20A {Staphylococcus aureus} PDB: 1xag_A* 1xai_A* 1xaj_A* 1xal_A* Back     alignment and structure
>1ta9_A (A:1-219) Glycerol dehydrogenase; oxidoreductase; 1.90A {Schizosaccharomyces pombe} Back     alignment and structure
>1oj7_A (A:27-201) Hypothetical oxidoreductase YQHD; structural genomics; HET: NZQ; 2.0A {Escherichia coli} Back     alignment and structure
>3brs_A (A:1-112,A:246-289) Periplasmic binding protein/LACI transcriptional regulator; structural genomics, protein structure initiative; 2.00A {Clostridium phytofermentans isdg} Back     alignment and structure
>2fn9_A (A:1-106,A:247-290) Ribose ABC transporter, periplasmic ribose- binding protein; RBP, periplasmic binding protein, thermophilic proteins; 1.40A {Thermotoga maritima MSB8} PDB: 2fn8_A* Back     alignment and structure
>3jzd_A (A:1-161) Iron-containing alcohol dehydrogenase; YP_298327.1, putative alcohol dehedrogenase, structural genomics; HET: MSE NAD PG4 P6G PGE; 2.10A {Ralstonia eutropha JMP134} Back     alignment and structure
>1ujn_A (A:1-160) Dehydroquinate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, lyase; 1.80A {Thermus thermophilus HB8} Back     alignment and structure
>1pfk_A (A:1-132,A:254-306) Phosphofructokinase; transferase(phosphotransferase); HET: FBP ADP; 2.40A {Escherichia coli} Back     alignment and structure
>1zxx_A (A:1-131,A:253-303) 6-phosphofructokinase; allosteric regulation, lactobacillus bulgaricus, transferase; 1.85A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3hl0_A (A:1-159) Maleylacetate reductase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 1.60A {Agrobacterium tumefaciens str} Back     alignment and structure
>3dzc_A (A:1-196,A:382-396) UDP-N-acetylglucosamine 2-epimerase; structural genomics, infectious diseases, isomerase; 2.35A {Vibrio cholerae} Back     alignment and structure
>2dri_A (A:1-104,A:237-271) D-ribose-binding protein; sugar transport; HET: RIP; 1.60A {Escherichia coli} Back     alignment and structure
>3clh_A (A:1-160) 3-dehydroquinate synthase; shikimate pathway, aromatic amino acid biosynthesis, DHQS, amino-acid biosynthesis, cytoplasm, lyase, NAD; HET: NAD; 2.40A {Helicobacter pylori} Back     alignment and structure
>1sg6_A (A:1-181) Pentafunctional AROM polypeptide; shikimate pathway, aromatic amino acid biosynthesis, DHQS, open form, form J, domain movement, cyclase; HET: NAD; 1.70A {Emericella nidulans} Back     alignment and structure
>3h75_A (A:1-121,A:264-350) Periplasmic sugar-binding domain protein; protein structure initiative II (PSI II), sugar binding protein, alpha/beta fold; 1.60A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>2fvy_A (A:1-112,A:258-309) D-galactose-binding periplasmic protein; periplasmic binding protien, hinge, chemotaxis, transport,, transport protein; HET: BGC; 0.92A {Escherichia coli} Back     alignment and structure
>2gru_A (A:1-173) 2-deoxy-scyllo-inosose synthase; aminoglycoside, 2-deoxystreptamine, dehydroquinate synthase, lyase; HET: NAD EXO CAK; 2.15A {Bacillus circulans} PDB: 2d2x_A* Back     alignment and structure