254780158

254780158

phosphoribosylaminoimidazole carboxylase ATPase subunit

GeneID in NCBI database:8209135Locus tag:CLIBASIA_00205
Protein GI in NCBI database:254780158Protein Accession:YP_003064571.1
Gene range:+(40216, 41280)Protein Length:354aa
Gene description:phosphoribosylaminoimidazole carboxylase ATPase subunit
COG prediction:[F] Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase)
KEGG prediction:purK; phosphoribosylaminoimidazole carboxylase ATPase subunit (EC:4.1.1.21); K01589 5-(carboxyamino)imidazole ribonucleotide synthase [EC:6.3.4.18]
SEED prediction:Phosphoribosylaminoimidazole carboxylase ATPase subunit (EC 4.1.1.21)
Pathway involved in KEGG:Purine metabolism [PATH:las00230]
Subsystem involved in SEED:De Novo Purine Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350----
MKKKTIGIIGGGQLARMLSMSAARLGFCTVILDPDSNCPANQVSNQQIAARHDDIKALNTFADICDYATYESENIPEKSISYLSTLLPTYPSSRAIEISQDRLYEKKFFQESGLTTVDFYEINSQESLTNILGGFKGKGILKTRRLGYDGKGQKVYHENDCTQNLYASLGNVPLILERFTDFNCEISIIAARSLNGSICFYDPIQNTHVNGILHKSIVPASISQKTSLLAHSAMRKVLETLDYVGILCIEFFVTNDGNVIANEMAPRVHNSGHWTEASCVISQFEQHIRSITNLPLGNPNRHSNCVMYNIIGSDIDQYEQWLHCDSSVIHIYGKSQTLCGRKMGHVTQIYPKNP
ccccEEEEEcccHHHHHHHHHHHHcccEEEEEccccccHHHHHcccEEccccccHHHHHHHHHHccEEEEccccccHHHHHHHccccEEcccHHHHHHHccHHHHHHHHHHcccccccccEEccHHHHHHHHHHHcccEEEEEcccccccccEEEEccHHHHHHHHHHcccccEEEEEEccccEEEEEEEEEcccccEEEEcccccEEEccEEEEEEccccccHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEccccEEEEEEcccccccccEEEHHccccHHHHHHHHHcccccccccccccEEEEEEEccccccHHHHHcccccEEEEccccccccccEEEEEEEEccccc
ccccEEEEEcccHHHHHHHHHHHHcccEEEEEcccccccHHHHcccEEEcccccHHHHHHHHHcccEEEEEEEcccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccEEEcccHHHHHHHHHHccccEEEEEcccccccccEEEEccHHHHHHHHHHHccccEEEEEEccccEEEEEEEEEcccccEEEEcccccccccccccEEEccccccHHHHHHHHHHHHHHHHHcccEEEEEEEEEEcccccEEEEEEEccccHHHccHHHHccccHHHHHHHHHcccccccccccccEEEEEEEcccccHHHHHHcccccEEEEccccccccccccEEEEEEccccc
mkkktigiigGGQLARMLSMSAARLGFCTVildpdsncpanqvsnqqIAARHDDIKALNTFAdicdyatyesenipekSISYLSTllptypssraieiSQDRLYEKkffqesglttvdfyeinSQESLTNILggfkgkgilktrrlgydgkgqkvyhendctqnlyaslgnvplilerftdfncEISIIAARSlngsicfydpiqnthvNGILhksivpasisqKTSLLAHSAMRKVLETLDYVGILCIEFFVtndgnvianemaprvhnsghwteASCVISQFEQHIRSitnlplgnpnrhsncvmyniigsdidqyeqwlhcdssvihiygksqtlcgrkmghvtqiypknp
mkkktigiigggqLARMLSMSAARLGFCTVILDPDSNCPANQVSNQQIAARHDDIKALNTFADICDYATYESENIPEKSISYLSTLLPTYPSSRAIEISQDRLYEKKFFQESGLTTVDFYEINSQESLTNILGGFKGKGILKTRRLGYDGKGQKVYHENDCTQNLYASLGNVPLILERFTDFNCEISIIAARSLNGSICFYDPIQNTHVNGILHKSIVPASISQKTSLLAHSAMRKVLETLDYVGILCIEFFVTNDGNVIANEMAPRVHNSGHWTEASCVISQFEQHIRSITNLPLGNPNRHSNCVMYNIIGSDIDQYEQWLHCDSSVIHIYGKSQTlcgrkmghvtqiypknp
MKKKTigiigggQLARMLSMSAARLGFCTVILDPDSNCPANQVSNQQIAARHDDIKALNTFADICDYATYESENIPEKSISYLSTLLPTYPSSRAIEISQDRLYEKKFFQESGLTTVDFYEINSQESLTNilggfkgkgilkTRRLGYDGKGQKVYHENDCTQNLYASLGNVPLILERFTDFNCEISIIAARSLNGSICFYDPIQNTHVNGILHKSIVPASISQKTSLLAHSAMRKVLETLDYVGILCIEFFVTNDGNVIANEMAPRVHNSGHWTEASCVISQFEQHIRSITNLPLGNPNRHSNCVMYNIIGSDIDQYEQWLHCDSSVIHIYGKSQTLCGRKMGHVTQIYPKNP
*KKKTIGIIGGGQLARMLSMSAARLGFCTVILDPDSNCPANQVSNQQIAARHDDIKALNTFADICDYATYESENIPEKSISYLSTLLPTYPSSRAIEISQDRLYEKKFFQESGLTTVDFYEINSQESLTNILGGFKGKGILKTRRLGYDGKGQKVYHENDCTQNLYASLGNVPLILERFTDFNCEISIIAARSLNGSICFYDPIQNTHVNGILHKSIVPASISQKTSLLAHSAMRKVLETLDYVGILCIEFFVTNDGNVIANEMAPRVHNSGHWTEASCVISQFEQHIRSITNLPLGNPNRHSNCVMYNIIGSDIDQYEQWLHCDSSVIHIYGKSQTLCGRKMGHVTQIY****
MKKKTIGIIGGGQLARMLSMSAARLGFCTVILDPDSNCPANQVSNQQIAARHDDIKALNTFADICDYATYESENIPEKSISYLSTLLPTYPSSRAIEISQDRLYEKKFFQESGLTTVDFYEINSQESLTNILGGFKGKGILKTRRLGYDGKGQKVYHENDCTQNLYASLGNVPLILERFTDFNCEISIIAARSLNGSICFYDPIQNTHVNGILHKSIVPASISQKTSLLAHSAMRKVLETLDYVGILCIEFFVTNDGNVIANEMAPRVHNSGHWTEASCVISQFEQHIRSITNLPLGNPNRHSNCVMYNIIGSDIDQYEQWLHCDSSVIHIYGKSQTLCGRKMGHVTQIYPKNP
**KKTIGIIGGGQLARMLSMSAARLGFCTVILDPDSNCPANQVSNQQIAARHDDIKALNTFADICDYATYESENIPEKSISYLSTLLPTYPSSRAIEISQDRLYEKKFFQESGLTTVDFYEINSQESLTNILGGFKGKGILKTRRLGYDGKGQKVYHENDCTQNLYASLGNVPLILERFTDFNCEISIIAARSLNGSICFYDPIQNTHVNGILHKSIVPASISQKTSLLAHSAMRKVLETLDYVGILCIEFFVTNDGNVIANEMAPRVHNSGHWTEASCVISQFEQHIRSITNLPLGNPNRHSNCVMYNIIGSDIDQYEQWLHCDSSVIHIYGKSQTLCGRKMGHVTQIYP***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKKTIGIIGGGQLARMLSMSAARLGFCTVILDPDSNCPANQVSNQQIAARHDDIKALNTFADICDYATYESENIPEKSISYLSTLLPTYPSSRAIEISQDRLYEKKFFQESGLTTVDFYEINSQESLTNILGGFKGKGILKTRRLGYDGKGQKVYHENDCTQNLYASLGNVPLILERFTDFNCEISIIAARSLNGSICFYDPIQNTHVNGILHKSIVPASISQKTSLLAHSAMRKVLETLDYVGILCIEFFVTNDGNVIANEMAPRVHNSGHWTEASCVISQFEQHIRSITNLPLGNPNRHSNCVMYNIIGSDIDQYEQWLHCDSSVIHIYGKSQTLCGRKMGHVTQIYPKNP
MKKKTIGIIGGGQLARMLSMSAARLGFCTVILDPDSNCPANQVSNQQIAARHDDIKALNTFADICDYATYESENIPEKSISYLSTLLPTYPSSRAIEISQDRLYEKKFFQESGLTTVDFYEINSQESLTNILGGFKGKGILKTRRLGYDGKGQKVYHENDCTQNLYASLGNVPLILERFTDFNCEISIIAARSLNGSICFYDPIQNTHVNGILHKSIVPASISQKTSLLAHSAMRKVLETLDYVGILCIEFFVTNDGNVIANEMAPRVHNSGHWTEASCVISQFEQHIRSITNLPLGNPNRHSNCVMYNIIGSDIDQYEQWLHCDSSVIHIYGKSQTLCGRKMGHVTQIYPKNP
MKKKTIGIIGGGQLARMLSMSAARLGFCTVILDPDSNCPANQVSNQQIAARHDDIKALNTFADICDYATYESENIPEKSISYLSTLLPTYPSSRAIEISQDRLYEKKFFQESGLTTVDFYEINSQESLTNILGGFKGKGILKTRRLGYDGKGQKVYHENDCTQNLYASLGNVPLILERFTDFNCEISIIAARSLNGSICFYDPIQNTHVNGILHKSIVPASISQKTSLLAHSAMRKVLETLDYVGILCIEFFVTNDGNVIANEMAPRVHNSGHWTEASCVISQFEQHIRSITNLPLGNPNRHSNCVMYNIIGSDIDQYEQWLHCDSSVIHIYGKSQTLCGRKMGHVTQIYPKNP

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target354 phosphoribosylaminoimidazole carboxylase ATPase subunit
315122758363 phosphoribosylaminoimidazole carboxylase ATPase subunit 1 1e-168
209550851358 phosphoribosylaminoimidazole carboxylase ATPase subunit 1 1e-114
190893356358 phosphoribosylaminoimidazole carboxylase protein, ATPas 1 1e-114
218463585356 phosphoribosylaminoimidazole carboxylase ATPase subunit 1 1e-114
241206263358 phosphoribosylaminoimidazole carboxylase ATPase subunit 1 1e-113
86359123373 phosphoribosylaminoimidazole carboxylase ATPase subunit 1 1e-111
222087038352 phosphoribosylaminoimidazole carboxylase [Agrobacterium 1 1e-110
116253784358 phosphoribosylaminoimidazole carboxylase ATPase subunit 1 1e-110
110635740364 phosphoribosylaminoimidazole carboxylase ATPase subunit 1 1e-107
222149704351 phosphoribosylaminoimidazole carboxylase ATPase subunit 1 1e-107
>gi|315122758|ref|YP_004063247.1| phosphoribosylaminoimidazole carboxylase ATPase subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 363 Back     alignment and organism information
 Score =  594 bits (1532), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 277/353 (78%), Positives = 317/353 (89%)

Query: 1   MKKKTIGIIGGGQLARMLSMSAARLGFCTVILDPDSNCPANQVSNQQIAARHDDIKALNT 60
           M +KTIGIIGGGQLARMLSMSAARLGFC VILDPDS CPANQVSN+QI A++DDI +L  
Sbjct: 1   MNRKTIGIIGGGQLARMLSMSAARLGFCVVILDPDSTCPANQVSNRQIVAQYDDIDSLKN 60

Query: 61  FADICDYATYESENIPEKSISYLSTLLPTYPSSRAIEISQDRLYEKKFFQESGLTTVDFY 120
            A++CDY TYE+ENIP KSISYLSTLLPT+PS+R IEI+QDRLYEK+FFQ+ GL+TVDF 
Sbjct: 61  LANLCDYVTYENENIPTKSISYLSTLLPTHPSARVIEIAQDRLYEKQFFQDYGLSTVDFC 120

Query: 121 EINSQESLTNILGGFKGKGILKTRRLGYDGKGQKVYHENDCTQNLYASLGNVPLILERFT 180
           EINSQESLT IL  FKGKGILKTRR+GYDGKGQKVY++ND T+NLY SLGN PLI E F 
Sbjct: 121 EINSQESLTKILTNFKGKGILKTRRMGYDGKGQKVYNQNDSTKNLYVSLGNKPLIFEHFA 180

Query: 181 DFNCEISIIAARSLNGSICFYDPIQNTHVNGILHKSIVPASISQKTSLLAHSAMRKVLET 240
            F+CEISIIAAR+L+GS+ FYDPIQNTH+NGILHKS+VPA IS+KT+ LA+SAM KVL  
Sbjct: 181 IFDCEISIIAARALDGSMHFYDPIQNTHINGILHKSVVPAHISKKTTCLAYSAMEKVLNA 240

Query: 241 LDYVGILCIEFFVTNDGNVIANEMAPRVHNSGHWTEASCVISQFEQHIRSITNLPLGNPN 300
           L+YVG+LCIEFFVT DGNV+ NEMAPRVHNSGHWTEASC ISQFEQHIRSI+ LPLGNP 
Sbjct: 241 LNYVGVLCIEFFVTEDGNVLINEMAPRVHNSGHWTEASCTISQFEQHIRSISGLPLGNPY 300

Query: 301 RHSNCVMYNIIGSDIDQYEQWLHCDSSVIHIYGKSQTLCGRKMGHVTQIYPKN 353
           RHSNCVMYNIIGS+I+Q E+WL+CDSS++HIYGKS+TL GRKMGH+TQIYPK+
Sbjct: 301 RHSNCVMYNIIGSEINQSEKWLNCDSSIVHIYGKSKTLPGRKMGHITQIYPKD 353


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|209550851|ref|YP_002282768.1| phosphoribosylaminoimidazole carboxylase ATPase subunit [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 358 Back     alignment and organism information
>gi|190893356|ref|YP_001979898.1| phosphoribosylaminoimidazole carboxylase protein, ATPase subunit [Rhizobium etli CIAT 652] Length = 358 Back     alignment and organism information
>gi|218463585|ref|ZP_03503676.1| phosphoribosylaminoimidazole carboxylase ATPase subunit [Rhizobium etli Kim 5] Length = 356 Back     alignment and organism information
>gi|241206263|ref|YP_002977359.1| phosphoribosylaminoimidazole carboxylase ATPase subunit [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 358 Back     alignment and organism information
>gi|86359123|ref|YP_471015.1| phosphoribosylaminoimidazole carboxylase ATPase subunit [Rhizobium etli CFN 42] Length = 373 Back     alignment and organism information
>gi|222087038|ref|YP_002545573.1| phosphoribosylaminoimidazole carboxylase [Agrobacterium radiobacter K84] Length = 352 Back     alignment and organism information
>gi|116253784|ref|YP_769622.1| phosphoribosylaminoimidazole carboxylase ATPase subunit [Rhizobium leguminosarum bv. viciae 3841] Length = 358 Back     alignment and organism information
>gi|110635740|ref|YP_675948.1| phosphoribosylaminoimidazole carboxylase ATPase subunit [Mesorhizobium sp. BNC1] Length = 364 Back     alignment and organism information
>gi|222149704|ref|YP_002550661.1| phosphoribosylaminoimidazole carboxylase ATPase subunit [Agrobacterium vitis S4] Length = 351 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target354 phosphoribosylaminoimidazole carboxylase ATPase subunit
PRK06019372 PRK06019, PRK06019, phosphoribosylaminoimidazole carbox 1e-140
TIGR01161352 TIGR01161, purK, phosphoribosylaminoimidazole carboxyla 1e-103
PLN02948 577 PLN02948, PLN02948, phosphoribosylaminoimidazole carbox 6e-69
COG0027394 COG0027, PurT, Formate-dependent phosphoribosylglycinam 4e-26
TIGR01142380 TIGR01142, purT, phosphoribosylglycinamide formyltransf 5e-23
PRK09288395 PRK09288, purT, phosphoribosylglycinamide formyltransfe 4e-16
COG0026375 COG0026, PurK, Phosphoribosylaminoimidazole carboxylase 1e-123
pfam02222171 pfam02222, ATP-grasp, ATP-grasp domain 2e-48
COG4770 645 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alp 2e-04
KOG2835 373 KOG2835, KOG2835, KOG2835, Phosphoribosylamidoimidazole 2e-13
>gnl|CDD|180352 PRK06019, PRK06019, phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>gnl|CDD|162228 TIGR01161, purK, phosphoribosylaminoimidazole carboxylase, PurK protein Back     alignment and domain information
>gnl|CDD|178534 PLN02948, PLN02948, phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>gnl|CDD|30377 COG0027, PurT, Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase) [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|130212 TIGR01142, purT, phosphoribosylglycinamide formyltransferase 2 Back     alignment and domain information
>gnl|CDD|181759 PRK09288, purT, phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>gnl|CDD|30376 COG0026, PurK, Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|145401 pfam02222, ATP-grasp, ATP-grasp domain Back     alignment and domain information
>gnl|CDD|34383 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|38046 KOG2835, KOG2835, KOG2835, Phosphoribosylamidoimidazole-succinocarboxamide synthase [Nucleotide transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 354 phosphoribosylaminoimidazole carboxylase ATPase subunit
TIGR01161386 purK phosphoribosylaminoimidazole carboxylase, ATPase s 100.0
PRK06019377 phosphoribosylaminoimidazole carboxylase ATPase subunit 100.0
COG0026375 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR sy 100.0
PRK09288395 purT phosphoribosylglycinamide formyltransferase 2; Val 100.0
COG0027394 PurT Formate-dependent phosphoribosylglycinamide formyl 100.0
TIGR01142407 purT phosphoribosylglycinamide formyltransferase 2; Int 100.0
PRK12999 1147 pyruvate carboxylase; Reviewed 100.0
PRK08463478 acetyl-CoA carboxylase; Validated 100.0
COG4770 645 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid 100.0
TIGR01369 1089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 99.98
PRK07206415 hypothetical protein; Provisional 99.97
COG0458400 CarB Carbamoylphosphate synthase large subunit (split g 99.93
pfam02222171 ATP-grasp ATP-grasp domain. This family does not contai 100.0
pfam02786211 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP b 100.0
pfam07478201 Dala_Dala_lig_C D-ala D-ala ligase C-terminus. This fam 99.95
pfam01071193 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp 99.9
pfam08443190 RimK RimK-like ATP-grasp domain. This ATP-grasp domain 99.88
pfam02655160 ATP-grasp_3 ATP-grasp domain. No functional information 99.83
TIGR03103547 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103. 99.59
PRK06524480 biotin carboxylase-like protein; Validated 99.16
pfam08442202 ATP-grasp_2 ATP-grasp domain. 98.8
pfam02955176 GSH-S_ATP Prokaryotic glutathione synthetase, ATP-grasp 98.63
TIGR02291320 rimK_rel_E_lig alpha-L-glutamate ligase homolog; InterP 98.06
pfam03133291 TTL Tubulin-tyrosine ligase family. Tubulins and microt 96.54
KOG1057 1018 consensus 95.95
pfam02750203 Synapsin_C Synapsin, ATP binding domain. Ca dependent A 95.14
KOG3895488 consensus 94.59
PRK05586447 biotin carboxylase; Validated 100.0
PRK08462446 biotin carboxylase; Validated 100.0
PRK08654 497 pyruvate carboxylase subunit A; Validated 100.0
PRK06111449 acetyl-CoA carboxylase biotin carboxylase subunit; Vali 100.0
PRK08591449 acetyl-CoA carboxylase biotin carboxylase subunit; Vali 100.0
PRK12833458 acetyl-CoA carboxylase biotin carboxylase subunit; Prov 100.0
PRK07178471 acetyl-CoA carboxylase; Validated 100.0
PRK12767325 carbamoyl phosphate synthase-like protein; Provisional 100.0
COG0439449 AccC Biotin carboxylase [Lipid metabolism] 100.0
TIGR01235 1169 pyruv_carbox pyruvate carboxylase; InterPro: IPR005930 100.0
TIGR00514451 accC acetyl-CoA carboxylase, biotin carboxylase; InterP 100.0
KOG0238 670 consensus 99.97
COG1038 1149 PycA Pyruvate carboxylase [Energy production and conver 99.97
PRK02186 892 argininosuccinate lyase; Provisional 99.97
PRK13789426 phosphoribosylamine--glycine ligase; Provisional 99.96
), forming GARS-AIRS-GART.; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00877">TIGR00877459 purD phosphoribosylamine--glycine ligase; InterPro: IPR 99.95
PRK00885424 phosphoribosylamine--glycine ligase; Provisional 99.95
PRK13790415 phosphoribosylamine--glycine ligase; Provisional 99.95
COG0151428 PurD Phosphoribosylamine-glycine ligase [Nucleotide tra 99.94
KOG0369 1176 consensus 99.94
PRK06395435 phosphoribosylamine--glycine ligase; Provisional 99.93
PRK05784485 phosphoribosylamine--glycine ligase; Provisional 99.92
KOG0370 1435 consensus 99.88
KOG0237 788 consensus 99.82
COG2232389 Predicted ATP-dependent carboligase related to biotin c 99.7
TIGR01369 1089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 100.0
PRK05294 1063 carB carbamoyl phosphate synthase large subunit; Review 100.0
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; Review 99.98
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; Review 99.97
PRK05294 1063 carB carbamoyl phosphate synthase large subunit; Review 99.97
TIGR02712 1226 urea_carbox urea carboxylase; InterPro: IPR014084 Membe 99.97
PRK01966344 ddl D-alanyl-alanine synthetase A; Reviewed 99.97
PRK06849387 hypothetical protein; Provisional 99.91
TIGR02144289 LysX_arch Lysine biosynthesis enzyme LysX; InterPro: IP 99.87
KOG0368 2196 consensus 99.82
COG0189318 RimK Glutathione synthase/Ribosomal protein S6 modifica 99.78
KOG0370 1435 consensus 99.67
PRK13278356 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribo 99.56
COG1821307 Predicted ATP-utilizing enzyme (ATP-grasp superfamily) 99.5
COG1759361 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofuranos 99.45
PRK13277363 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuran 99.43
COG3919415 Predicted ATP-grasp enzyme [General function prediction 99.38
PRK05246316 glutathione synthetase; Provisional 98.91
PRK01372304 ddl D-alanine--D-alanine ligase; Reviewed 99.97
TIGR01205375 D_ala_D_alaTIGR D-alanine--D-alanine ligase; InterPro: 99.96
TIGR00768321 rimK_fam alpha-L-glutamate ligases, RimK family; InterP 99.87
PRK10446300 ribosomal protein S6 modification protein; Provisional 99.86
COG1181317 DdlA D-alanine-D-alanine ligase and related ATP-grasp e 99.86
PRK12458349 glutathione synthetase; Provisional 98.77
pfam05770307 Ins134_P3_kin Inositol 1, 3, 4-trisphosphate 5/6-kinase 98.34
TIGR01380322 glut_syn glutathione synthase; InterPro: IPR006284 Thes 98.21
KOG2835 373 consensus 99.87
TIGR02068 876 cya_phycin_syn cyanophycin synthetase; InterPro: IPR011 99.53
PRK02471753 bifunctional glutamate--cysteine ligase/glutathione syn 99.35
pfam11379355 DUF3182 Protein of unknown function (DUF3182). This fam 95.64
TIGR01016389 sucCoAbeta succinyl-CoA synthetase, beta subunit; Inter 98.99
COG0045387 SucC Succinyl-CoA synthetase, beta subunit [Energy prod 98.64
TIGR03278404 methan_mark_10 putative methanogenesis marker protein 1 93.42
PRK00696 388 sucC succinyl-CoA synthetase subunit beta; Provisional 98.82
pfam00289109 CPSase_L_chain Carbamoyl-phosphate synthase L chain, N- 97.74
CHL00194319 ycf39 Ycf39; Provisional 97.5
PRK13581524 D-3-phosphoglycerate dehydrogenase; Provisional 97.42
PRK07574385 formate dehydrogenase; Provisional 97.19
pfam02254115 TrkA_N TrkA-N domain. This domain is found in a wide va 96.93
pfam06849124 DUF1246 Protein of unknown function (DUF1246). This fam 96.93
pfam0284499 GARS_N Phosphoribosylglycinamide synthetase, N domain. 96.89
PRK11199374 tyrA bifunctional chorismate mutase/prephenate dehydrog 96.82
COG1748389 LYS9 Saccharopine dehydrogenase and related proteins [A 96.79
PRK06932314 glycerate dehydrogenase; Provisional 96.33
PRK10669558 putative cation:proton antiport protein; Provisional 96.29
KOG0068406 consensus 96.17
PRK12367250 short chain dehydrogenase; Provisional 96.01
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transport and 95.74
COG2910211 Putative NADH-flavin reductase [General function predic 95.3
PRK09739201 hypothetical protein; Provisional 94.83
PRK07424410 bifunctional sterol desaturase/short chain dehydrogenas 94.65
PRK07417280 arogenate dehydrogenase; Reviewed 93.99
KOG2614420 consensus 93.87
TIGR01983275 UbiG ubiquinone biosynthesis O-methyltransferase; Inter 93.58
PRK07502307 cyclohexadienyl dehydrogenase; Validated 93.43
PRK08306296 dipicolinate synthase subunit A; Reviewed 93.16
PRK05134233 3-demethylubiquinone-9 3-methyltransferase; Provisional 92.99
pfam03435384 Saccharop_dh Saccharopine dehydrogenase. This family co 92.94
cd01171254 YXKO-related B.subtilis YXKO protein of unknown functio 92.73
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases [Cell 92.58
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.54
pfam10727111 Rossmann-like Rossmann-like domain. This family of prot 92.52
pfam01256241 Carb_kinase Carbohydrate kinase. This family is related 92.03
pfam00670162 AdoHcyase_NAD S-adenosyl-L-homocysteine hydrolase, NAD 91.75
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 91.29
PRK08507275 prephenate dehydrogenase; Validated 90.11
COG0111324 SerA Phosphoglycerate dehydrogenase and related dehydro 97.63
pfam02826176 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogen 97.57
PRK00257379 erythronate-4-phosphate dehydrogenase; Validated 97.54
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 97.41
PRK12480330 D-lactate dehydrogenase; Provisional 97.37
pfam05368232 NmrA NmrA-like family. NmrA is a negative transcription 97.02
PRK06436303 glycerate dehydrogenase; Provisional 96.83
PRK09496455 trkA potassium transporter peripheral membrane componen 96.82
COG1052324 LdhA Lactate dehydrogenase and related dehydrogenases [ 96.79
TIGR01214317 rmlD dTDP-4-dehydrorhamnose reductase; InterPro: IPR005 96.71
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequences 96.68
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General funct 96.44
KOG0023360 consensus 96.37
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope bi 96.23
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 96.16
PRK08655441 prephenate dehydrogenase; Provisional 96.15
pfam03446163 NAD_binding_2 NAD binding domain of 6-phosphogluconate 96.11
PRK10537356 voltage-gated potassium channel; Provisional 95.97
PRK11908347 NAD-dependent epimerase/dehydratase family protein; Pro 95.77
pfam01370235 Epimerase NAD dependent epimerase/dehydratase family. T 95.74
PRK00045429 hemA glutamyl-tRNA reductase; Reviewed 95.65
PRK08220253 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 95.51
PRK10675338 UDP-galactose-4-epimerase; Provisional 95.48
PRK13940414 glutamyl-tRNA reductase; Provisional 95.4
pfam01262150 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domai 95.24
PRK05993277 short chain dehydrogenase; Provisional 95.17
pfam01488134 Shikimate_DH Shikimate / quinate 5-dehydrogenase. This 95.16
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, 95.14
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 95.07
PRK06179270 short chain dehydrogenase; Provisional 95.02
PRK07856254 short chain dehydrogenase; Provisional 94.96
pfam04321284 RmlD_sub_bind RmlD substrate binding domain. L-rhamnose 94.89
PRK07577234 short chain dehydrogenase; Provisional 94.88
PRK08251248 short chain dehydrogenase; Provisional 94.54
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell enve 94.52
PRK07024256 short chain dehydrogenase; Provisional 94.45
KOG1201300 consensus 94.43
pfam0380793 F420_oxidored NADP oxidoreductase coenzyme F420-depende 94.39
pfam01408120 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossman 94.33
PRK03806438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.26
PRK12428261 3-alpha-hydroxysteroid dehydrogenase; Provisional 94.25
PRK11559295 garR tartronate semialdehyde reductase; Provisional 94.23
PTZ00082322 L-lactate dehydrogenase; Provisional 94.1
PRK08177225 short chain dehydrogenase; Provisional 94.07
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This enzy 94.03
PRK06483236 short chain dehydrogenase; Provisional 93.95
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 93.93
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 93.65
PRK09072262 short chain dehydrogenase; Provisional 93.57
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 93.37
PRK06953222 short chain dehydrogenase; Provisional 93.37
PRK08277278 D-mannonate oxidoreductase; Provisional 93.3
PRK06928275 pyrroline-5-carboxylate reductase; Reviewed 93.27
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G 93.23
PRK08226263 short chain dehydrogenase; Provisional 93.21
pfam01073280 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase 93.2
KOG0409327 consensus 93.14
PRK07814263 short chain dehydrogenase; Provisional 93.06
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 92.99
PRK08219226 short chain dehydrogenase; Provisional 92.95
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 92.88
PRK07576260 short chain dehydrogenase; Provisional 92.78
PRK07831261 short chain dehydrogenase; Provisional 92.78
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisional 92.67
PRK07832272 short chain dehydrogenase; Provisional 92.45
PRK05872296 short chain dehydrogenase; Provisional 92.29
TIGR03023451 WcaJ_sugtrans Undecaprenyl-phosphate glucose phosphotra 92.21
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and related bet 92.13
PTZ00142 474 6-phosphogluconate dehydrogenase; Provisional 92.07
PRK08862227 short chain dehydrogenase; Provisional 92.07
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid tran 92.04
TIGR02352357 thiamin_ThiO glycine oxidase ThiO; InterPro: IPR012727 92.01
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-am 91.97
PRK06523260 short chain dehydrogenase; Provisional 91.93
PRK06346251 consensus 91.85
PRK07825273 short chain dehydrogenase; Provisional 91.79
PRK07109338 short chain dehydrogenase; Provisional 91.74
PRK06398256 aldose dehydrogenase; Validated 91.73
PRK08264235 short chain dehydrogenase; Validated 91.64
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 91.58
PRK07806248 short chain dehydrogenase; Provisional 91.58
PRK05866290 short chain dehydrogenase; Provisional 91.58
COG0300265 DltE Short-chain dehydrogenases of various substrate sp 91.58
KOG1430361 consensus 91.57
TIGR03025445 EPS_sugtrans exopolysaccharide biosynthesis polyprenyl 91.54
PRK08057241 cobalt-precorrin-6x reductase; Reviewed 91.2
PRK07326235 short chain dehydrogenase; Provisional 91.16
PRK07454241 short chain dehydrogenase; Provisional 91.15
KOG1198347 consensus 91.14
PRK09135249 pteridine reductase; Provisional 91.12
PRK06940277 short chain dehydrogenase; Provisional 91.11
PRK05650270 short chain dehydrogenase; Provisional 91.08
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 91.05
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenas 90.9
PRK07775275 short chain dehydrogenase; Provisional 90.88
PRK07666238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 90.69
PRK05693274 short chain dehydrogenase; Provisional 90.68
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of gluta 90.59
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyl 90.57
PRK06720169 hypothetical protein; Provisional 90.57
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Reviewed 90.54
PRK06114262 short chain dehydrogenase; Provisional 90.48
PRK06101241 short chain dehydrogenase; Provisional 90.36
PRK07062265 short chain dehydrogenase; Provisional 90.33
PRK07533254 enoyl-(acyl carrier protein) reductase; Provisional 90.11
COG0569225 TrkA K+ transport systems, NAD-binding component [Inorg 97.52
PRK03659602 glutathione-regulated potassium-efflux system protein K 97.03
PRK03562615 glutathione-regulated potassium-efflux system protein K 96.95
COG0673342 MviM Predicted dehydrogenases and related proteins [Gen 95.93
PRK11579346 putative oxidoreductase; Provisional 95.41
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 94.48
PRK13301267 putative L-aspartate dehydrogenase; Provisional 94.47
KOG2380480 consensus 93.48
TIGR02152303 D_ribokin_bact ribokinase; InterPro: IPR011877 This ent 93.46
PTZ00117313 malate dehydrogenase; Provisional 93.03
PRK13302271 putative L-aspartate dehydrogenase; Provisional 92.92
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases and s 92.48
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-lactate 91.88
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-lactate 91.62
COG2099257 CobK Precorrin-6x reductase [Coenzyme metabolism] 91.45
PRK13304265 L-aspartate dehydrogenase; Reviewed 91.13
PRK13303265 L-aspartate dehydrogenase; Provisional 91.05
PRK08605332 D-lactate dehydrogenase; Validated 97.45
PRK06130310 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.92
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.56
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 96.46
PRK08293288 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.39
PRK07660283 consensus 96.37
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA deh 96.29
PRK07236386 hypothetical protein; Provisional 96.2
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.14
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 96.1
PRK07531 489 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioestera 95.53
PRK09117282 consensus 95.36
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.22
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 95.18
PRK06847375 hypothetical protein; Provisional 95.14
PRK09260289 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.06
pfam02737180 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding do 95.01
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 94.95
PRK07819284 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.91
PRK06123249 short chain dehydrogenase; Provisional 94.88
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisio 94.8
PRK07208 474 hypothetical protein; Provisional 94.79
pfam01210159 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehyd 94.74
PRK09754400 phenylpropionate dioxygenase ferredoxin reductase subun 94.65
PRK12409410 D-amino acid dehydrogenase small subunit; Provisional 94.6
PRK04965378 nitric oxide reductase; Provisional 94.59
PRK08163396 salicylate hydroxylase; Provisional 94.58
PRK08268 503 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.52
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of this 94.46
PRK06914280 short chain dehydrogenase; Provisional 94.36
PRK12825250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 94.35
PRK06182273 short chain dehydrogenase; Validated 94.23
PRK13512438 coenzyme A disulfide reductase; Provisional 94.17
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 94.11
PRK08642254 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 94.07
PRK08263275 short chain dehydrogenase; Provisional 94.06
PRK07890258 short chain dehydrogenase; Provisional 94.05
PRK08774402 consensus 94.03
PRK03369 487 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.01
PRK06834 488 hypothetical protein; Provisional 93.98
PRK07677254 short chain dehydrogenase; Provisional 93.94
PRK06124259 gluconate 5-dehydrogenase; Provisional 93.92
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 93.88
PRK07494386 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 93.76
TIGR02053 494 MerA mercuric reductase; InterPro: IPR011796 This entry 93.75
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 93.75
PRK01747660 mnmC 5-methylaminomethyl-2-thiouridine methyltransferas 93.64
PRK06077249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 93.58
PRK12810472 gltD glutamate synthase subunit beta; Reviewed 93.57
PRK11749460 putative oxidoreductase; Provisional 93.55
PRK12745259 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 93.53
PRK06180277 short chain dehydrogenase; Provisional 93.52
PRK12938246 acetyacetyl-CoA reductase; Provisional 93.51
pfam0007082 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 93.5
PRK07041240 short chain dehydrogenase; Provisional 93.5
PRK06185409 hypothetical protein; Provisional 93.45
PRK09564443 coenzyme A disulfide reductase; Reviewed 93.41
pfam00743 532 FMO-like Flavin-binding monooxygenase-like. This family 93.4
COG2072443 TrkA Predicted flavoprotein involved in K+ transport [I 93.37
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validated 93.36
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid 93.3
PRK06125259 short chain dehydrogenase; Provisional 93.19
PRK12742237 oxidoreductase; Provisional 93.17
PRK02006 501 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.1
PRK09134256 short chain dehydrogenase; Provisional 93.1
PRK05335434 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 93.06
PRK07045388 putative monooxygenase; Reviewed 93.05
PRK01390457 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.01
PRK06126 545 hypothetical protein; Provisional 92.97
PRK07231250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 92.94
PRK06057255 short chain dehydrogenase; Provisional 92.89
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisional 92.87
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Provision 92.87
PRK06500249 short chain dehydrogenase; Provisional 92.84
PRK08017256 short chain dehydrogenase; Provisional 92.8
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 92.78
PRK07067256 sorbitol dehydrogenase; Provisional 92.78
PRK06947252 glucose-1-dehydrogenase; Provisional 92.76
PRK05875277 short chain dehydrogenase; Provisional 92.74
PRK06701289 short chain dehydrogenase; Provisional 92.68
PRK05868372 hypothetical protein; Validated 92.67
PRK06138252 short chain dehydrogenase; Provisional 92.61
PRK12831464 putative oxidoreductase; Provisional 92.59
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimat 92.59
PRK12935247 acetoacetyl-CoA reductase; Provisional 92.57
PRK12771560 putative glutamate synthase (NADPH) small subunit; Prov 92.57
PRK08936261 glucose-1-dehydrogenase; Provisional 92.5
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid 92.47
PRK00711416 D-amino acid dehydrogenase small subunit; Validated 92.47
pfam03721185 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase fa 92.39
PRK13984604 putative oxidoreductase; Provisional 92.36
PRK07776252 consensus 92.33
PRK12770350 putative glutamate synthase subunit beta; Provisional 92.29
PRK06753373 hypothetical protein; Provisional 92.26
PRK12809639 putative oxidoreductase Fe-S binding subunit; Reviewed 92.11
PRK12769654 putative oxidoreductase Fe-S binding subunit; Reviewed 92.1
PRK12748257 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 92.09
PRK12744257 short chain dehydrogenase; Provisional 92.07
PRK12814 652 putative NADPH-dependent glutamate synthase small subun 92.07
PRK06475400 salicylate hydroxylase; Provisional 92.06
PRK08628258 short chain dehydrogenase; Provisional 92.04
PRK06184 503 hypothetical protein; Provisional 92.04
PRK08013400 hypothetical protein; Provisional 92.04
PRK08265261 short chain dehydrogenase; Provisional 92.02
PRK08401 464 L-aspartate oxidase; Provisional 91.99
COG2081408 Predicted flavoproteins [General function prediction on 91.9
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase 91.85
PRK01438 481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 91.83
PRK00141 476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 91.78
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; Revi 91.75
PRK06949258 short chain dehydrogenase; Provisional 91.75
PRK05976 464 dihydrolipoamide dehydrogenase; Validated 91.73
PRK07588391 hypothetical protein; Provisional 91.71
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogena 91.69
PRK06116450 glutathione reductase; Validated 91.69
PRK06198268 short chain dehydrogenase; Provisional 91.65
PRK07102243 short chain dehydrogenase; Provisional 91.64
PRK12824245 acetoacetyl-CoA reductase; Provisional 91.64
PRK07035252 short chain dehydrogenase; Provisional 91.63
PRK07846 453 mycothione/glutathione reductase; Reviewed 91.56
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 91.48
PRK09242258 tropinone reductase; Provisional 91.47
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 91.45
TIGR03452 452 mycothione_red mycothione reductase. Mycothiol, a gluta 91.41
PRK05867253 short chain dehydrogenase; Provisional 91.35
PRK08085254 gluconate 5-dehydrogenase; Provisional 91.35
PRK12826253 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed 91.33
cd01483143 E1_enzyme_family Superfamily of activating enzymes (E1) 91.27
PRK07074256 short chain dehydrogenase; Provisional 91.26
PRK07774250 short chain dehydrogenase; Provisional 91.24
PRK08339263 short chain dehydrogenase; Provisional 91.24
PRK09186255 flagellin modification protein A; Provisional 91.23
PRK12490298 6-phosphogluconate dehydrogenase-like protein; Reviewed 91.18
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 91.13
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 91.11
PRK07478254 short chain dehydrogenase; Provisional 91.1
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 91.08
PRK06327 475 dihydrolipoamide dehydrogenase; Validated 91.05
PRK06227256 consensus 91.01
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 90.99
PRK05579392 bifunctional phosphopantothenoylcysteine decarboxylase/ 90.96
PRK07479252 consensus 90.94
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-li 90.94
PTZ00318 514 NADH dehydrogenase; Provisional 90.93
PRK06416 462 dihydrolipoamide dehydrogenase; Reviewed 90.93
PRK07845 467 flavoprotein disulfide reductase; Reviewed 90.9
PRK00258275 aroE shikimate 5-dehydrogenase; Reviewed 90.87
PRK06912 458 acoL dihydrolipoamide dehydrogenase; Validated 90.86
PRK06467 472 dihydrolipoamide dehydrogenase; Reviewed 90.84
PRK06115 466 dihydrolipoamide dehydrogenase; Reviewed 90.81
PRK07538413 hypothetical protein; Provisional 90.7
PRK06292 460 dihydrolipoamide dehydrogenase; Validated 90.68
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihy 90.66
PRK07097265 gluconate 5-dehydrogenase; Provisional 90.65
PRK02472450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 90.62
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; Revi 90.62
pfam01494349 FAD_binding_3 FAD binding domain. This domain is involv 90.61
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. Memb 90.6
PRK07523251 gluconate 5-dehydrogenase; Provisional 90.53
PRK06183 554 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validat 90.41
PRK12828239 short chain dehydrogenase; Provisional 90.41
PRK12937245 short chain dehydrogenase; Provisional 90.38
pfam07992277 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreducta 90.3
PRK06841255 short chain dehydrogenase; Provisional 90.29
PRK07190 480 hypothetical protein; Provisional 90.17
PRK09853 1032 putative selenate reductase subunit YgfK; Provisional 90.15
PRK09126392 hypothetical protein; Provisional 90.13
PRK13243333 glyoxylate reductase; Reviewed 97.37
pfam00389313 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenas 96.1
PRK09754400 phenylpropionate dioxygenase ferredoxin reductase subun 94.43
PRK09880343 L-idonate 5-dehydrogenase; Provisional 94.06
TIGR03366280 HpnZ_proposed putative phosphonate catabolism associate 93.7
KOG0069336 consensus 93.27
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 92.81
PRK06487317 glycerate dehydrogenase; Provisional 97.07
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 97.05
PRK09496455 trkA potassium transporter peripheral membrane componen 96.67
pfam06973188 DUF1297 Domain of unknown function (DUF1297). This fami 94.91
COG4091438 Predicted homoserine dehydrogenase [Amino acid transpor 96.46
PRK06545357 prephenate dehydrogenase; Validated 93.23
PRK09424510 pntA NAD(P) transhydrogenase subunit alpha; Provisional 93.46
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] 92.92
>TIGR01161 purK phosphoribosylaminoimidazole carboxylase, ATPase subunit; InterPro: IPR005875 Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>COG0027 PurT Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase) [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01142 purT phosphoribosylglycinamide formyltransferase 2; InterPro: IPR005862 The formation of isosinate, a precursor of adenylate and guanylate, from 5-phosphoribosyl 1-pyrophosphate in the de novo purine biosynthesis pathway is basically composed of 10 steps of reactions Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>PRK08463 acetyl-CoA carboxylase; Validated Back     alignment and domain information
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit; InterPro: IPR006275 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>PRK07206 hypothetical protein; Provisional Back     alignment and domain information
>COG0458 CarB Carbamoylphosphate synthase large subunit (split gene in MJ) [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>pfam02222 ATP-grasp ATP-grasp domain Back     alignment and domain information
>pfam02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain Back     alignment and domain information
>pfam07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus Back     alignment and domain information
>pfam01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain Back     alignment and domain information
>pfam08443 RimK RimK-like ATP-grasp domain Back     alignment and domain information
>pfam02655 ATP-grasp_3 ATP-grasp domain Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>PRK06524 biotin carboxylase-like protein; Validated Back     alignment and domain information
>pfam08442 ATP-grasp_2 ATP-grasp domain Back     alignment and domain information
>pfam02955 GSH-S_ATP Prokaryotic glutathione synthetase, ATP-grasp domain Back     alignment and domain information
>TIGR02291 rimK_rel_E_lig alpha-L-glutamate ligase homolog; InterPro: IPR011758 Members of this protein family contain a region of homology to the RimK family of alpha-L-glutamate ligases (IPR004666 from INTERPRO), various members of which modify the Glu-Glu C-terminus of ribosomal protein S6, or tetrahydromethanopterin, or a form of coenzyme F420 derivative Back     alignment and domain information
>pfam03133 TTL Tubulin-tyrosine ligase family Back     alignment and domain information
>KOG1057 consensus Back     alignment and domain information
>pfam02750 Synapsin_C Synapsin, ATP binding domain Back     alignment and domain information
>KOG3895 consensus Back     alignment and domain information
>PRK05586 biotin carboxylase; Validated Back     alignment and domain information
>PRK08462 biotin carboxylase; Validated Back     alignment and domain information
>PRK08654 pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>PRK06111 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>PRK08591 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>PRK12833 acetyl-CoA carboxylase biotin carboxylase subunit; Provisional Back     alignment and domain information
>PRK07178 acetyl-CoA carboxylase; Validated Back     alignment and domain information
>PRK12767 carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>COG0439 AccC Biotin carboxylase [Lipid metabolism] Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase; InterPro: IPR005930 In the postabsorptive state, blood glucose concentration is kept constant by a combination of glycogenolysis and gluconeogenesis Back     alignment and domain information
>TIGR00514 accC acetyl-CoA carboxylase, biotin carboxylase; InterPro: IPR004549 This family represents the biotin carboxylase subunit found usually as a component of acetyl-CoA carboxylase Back     alignment and domain information
>KOG0238 consensus Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>PRK02186 argininosuccinate lyase; Provisional Back     alignment and domain information
>PRK13789 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>TIGR00877 purD phosphoribosylamine--glycine ligase; InterPro: IPR000115 Phosphoribosylglycinamide synthetase (6 Back     alignment and domain information
>PRK00885 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK13790 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>COG0151 PurD Phosphoribosylamine-glycine ligase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0369 consensus Back     alignment and domain information
>PRK06395 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK05784 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>KOG0370 consensus Back     alignment and domain information
>KOG0237 consensus Back     alignment and domain information
>COG2232 Predicted ATP-dependent carboligase related to biotin carboxylase [General function prediction only] Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit; InterPro: IPR006275 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase; InterPro: IPR014084 Members of this family are ATP-dependent urea carboxylases, including characterised members from Oleomonas sagaranensis (alpha class Proteobacterium) and yeasts such as Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>PRK01966 ddl D-alanyl-alanine synthetase A; Reviewed Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02144 LysX_arch Lysine biosynthesis enzyme LysX; InterPro: IPR011870 The family of proteins found in this family include the characterised LysX from Thermus thermophilus which is part of a well-organised lysine biosynthesis gene cluster Back     alignment and domain information
>KOG0368 consensus Back     alignment and domain information
>COG0189 RimK Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase) [Coenzyme metabolism / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0370 consensus Back     alignment and domain information
>PRK13278 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase; Provisional Back     alignment and domain information
>COG1821 Predicted ATP-utilizing enzyme (ATP-grasp superfamily) [General function prediction only] Back     alignment and domain information
>COG1759 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate synthetase (purine biosynthesis) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13277 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase-like protein; Provisional Back     alignment and domain information
>COG3919 Predicted ATP-grasp enzyme [General function prediction only] Back     alignment and domain information
>PRK05246 glutathione synthetase; Provisional Back     alignment and domain information
>PRK01372 ddl D-alanine--D-alanine ligase; Reviewed Back     alignment and domain information
>TIGR01205 D_ala_D_alaTIGR D-alanine--D-alanine ligase; InterPro: IPR005905 D-alanine--D-alanine ligase (6 Back     alignment and domain information
>TIGR00768 rimK_fam alpha-L-glutamate ligases, RimK family; InterPro: IPR004666 Escherichia coli RimK adds additional Glu residues to the native Glu-Glu C-terminus of ribosomal protein S6 Back     alignment and domain information
>PRK10446 ribosomal protein S6 modification protein; Provisional Back     alignment and domain information
>COG1181 DdlA D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12458 glutathione synthetase; Provisional Back     alignment and domain information
>pfam05770 Ins134_P3_kin Inositol 1, 3, 4-trisphosphate 5/6-kinase Back     alignment and domain information
>TIGR01380 glut_syn glutathione synthase; InterPro: IPR006284 These are the glutathione synthetases found in Gram-negative bacteria Back     alignment and domain information
>KOG2835 consensus Back     alignment and domain information
>TIGR02068 cya_phycin_syn cyanophycin synthetase; InterPro: IPR011810 Cyanophycin is an insoluble storage polymer for carbon, nitrogen, and energy, found in most Cyanobacteria Back     alignment and domain information
>PRK02471 bifunctional glutamate--cysteine ligase/glutathione synthetase; Provisional Back     alignment and domain information
>pfam11379 DUF3182 Protein of unknown function (DUF3182) Back     alignment and domain information
>TIGR01016 sucCoAbeta succinyl-CoA synthetase, beta subunit; InterPro: IPR005809 There are four different enzymes that share a similar catalytic mechanism which involves the phosphorylation by ATP (or GTP) of a specific histidine residue in the active site Back     alignment and domain information
>COG0045 SucC Succinyl-CoA synthetase, beta subunit [Energy production and conversion] Back     alignment and domain information
>TIGR03278 methan_mark_10 putative methanogenesis marker protein 10 Back     alignment and domain information
>PRK00696 sucC succinyl-CoA synthetase subunit beta; Provisional Back     alignment and domain information