254780159

254780159

hypothetical protein CLIBASIA_00210

GeneID in NCBI database:8209136Locus tag:CLIBASIA_00210
Protein GI in NCBI database:254780159Protein Accession:YP_003064572.1
Gene range:-(41643, 41933)Protein Length:96aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM2 TM-Helix
TOPPRED2 TM-Helix
HMMTOP2 TM-Helix
MEMSAT2 TM-Helix
MEMSAT_SVM2 TM-Helix
PHOBIUS2 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90------
MSIFDSRAICSNFPVSAFFIFVVLYTIVCASIIGNWQYSIHKRPALDMIASMICGLLMSLLIILSFTIVQDRRSSPRIDSDIETSEWNSDKNQDTT
ccccccHHHHccccHHHHHHHHHHHHHHHHHHHccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHcccccccccc
cccccccHHcccccHHHHHHHHHHHHHHHHHHHHcHHHHHcHcHHHHHHHHHHHHHHHHHHHHHHHHEEEcccccccccccccccccccccccccc
msifdsraicsnfpvSAFFIFVVLYTIVCASIignwqysihkrpaLDMIASMICGLLMSLLIILSFTIvqdrrsspridsdietsewnsdknqdtt
MSIFDSRAICSNFPVSAFFIFVVLYTIVCASIIGNWQYSIHKRPALDMIASMICGLLMSLLIILSFTivqdrrsspridsdietsewnsdknqdtt
MSIFDSRAICSNFPVSAFFIFVVLYTIVCASIIGNWQYSIHKRPALDMIASMICGLLMSLLIILSFTIVQDRRSSPRIDSDIETSEWNSDKNQDTT
****DSRAICSNFPVSAFFIFVVLYTIVCASIIGNWQYSIHKRPALDMIASMICGLLMSLLIILSFTIVQ**************************
MSIFDSRAICSNFPVSAFFIFVVLYTIVCASIIGNWQYSIHKRPALDMIASMICGLLMSLLIILSFTIVQD*************************
***FDSRAICSNFPVSAFFIFVVLYTIVCASIIGNWQYSIHKRPALDMIASMICGLLMSLLIILSFTIVQDR************************
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooo
iiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIFDSRAICSNFPVSAFFIFVVLYTIVCASIIGNWQYSIHKRPALDMIASMICGLLMSLLIILSFTIVQDRRSSPRIDSDIETSEWNSDKNQDTT

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target96 hypothetical protein CLIBASIA_00210 [Candidatus Liberib
31512275989 hypothetical protein CKC_05065 [Candidatus Liberibacter 1 8e-24
>gi|315122759|ref|YP_004063248.1| hypothetical protein CKC_05065 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 89 Back     alignment and organism information
 Score =  113 bits (283), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 70/73 (95%)

Query: 1  MSIFDSRAICSNFPVSAFFIFVVLYTIVCASIIGNWQYSIHKRPALDMIASMICGLLMSL 60
          M+IFDSRAICSNFPVS FFIFVVLYTIVCASIIG W+Y I+KRPALDMIASMICGLLMSL
Sbjct: 1  MNIFDSRAICSNFPVSGFFIFVVLYTIVCASIIGTWKYGIYKRPALDMIASMICGLLMSL 60

Query: 61 LIILSFTIVQDRR 73
          LIILSF+I+QD++
Sbjct: 61 LIILSFSIMQDKK 73


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00