254780160

254780160

hypothetical protein CLIBASIA_00215

GeneID in NCBI database:8209137Locus tag:CLIBASIA_00215
Protein GI in NCBI database:254780160Protein Accession:YP_003064573.1
Gene range:+(42884, 43780)Protein Length:298aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------30
MTISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMDKNGQHNT
cEEEEHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEEEEccccccccccEEEEEEccccccccccEEEEEccccccEEEEccccEEEEEEEEEEEEEEEEEEcccccccEEEEEEEccEEEEEEEEcccccccHHHEEEEEEEcccccccEEcccccccEEEEEccccEEEEEEEccccEEEEEEEEEccccEEEEEEEccEEEEEEEEHHHHccccccccEEEEEccccccHHHHcccccEEEEEcccEEEEEEccccEEEEEEEEEEccccEEEEEEEHHHHHccccccc
cEEEEccccccEEcccccEEEccccccccccEEEEEcccEEEEEEcccccccccccEEEEEcccccccccccEEEEcccccccEEcccccEEEEEEccccEEEEEEEEccccccccEEEEEcccEEEEEEEEcccccccHHcEEEEEEEcccccccccccccccccEEEccccEEEEEEcccccccEcccccEEcccccccEEEEHHHHHEcHHHHHHcccccccccccccccccccEEEEEEccccEEEEccccEEEEEEcccEEEEEcEEEEEcccccEEEEEEHHHHHccccccc
mtisfssyAKAENMHTTSTLlnnniskgkgkrvVDAQRITCEArltenstsidsgvsWHIFDsisnkkntlsttkkiiggkvsfdlfpgdylisasfghVGVVKKITVSSKEKNQKQVFILNAggirlysiykpgspivddeltfsiysnpnhkallitdkvrsgtlvrlgtnnyqitshygkyNAIVSTVVkvepgkiiDVTIQNRAAKITFKLVSemggeavaDTAWSILTAsgdtvgesanaspsmvlsegdYTVIArnkernysrefsVLTGKSTIVEVLMRQKrmdkngqhnt
MTISFSSYAKAENMHTtstllnnniskgkgkrvVDAQRITCEarltenstsidsgvsWHIFDSisnkkntlsttKKIIGGKVSFDLFPGDYLISASFGHVGVVKKItvsskeknqkQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTnnyqitshygkYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTvgesanaspsmvlseGDYTVIARnkernysrefsvltgkstIVEVLMrqkrmdkngqhnt
MTISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDsisnkkntlsttkkiiGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMDKNGQHNT
***************************************TCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTT**IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLM*************
MTISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKR*********
MTISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMDK******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMDKNGQHNT
MTISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMDKNGQHNT
MTISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMDKNGQHNT

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target298 hypothetical protein CLIBASIA_00215 [Candidatus Liberib
315122760301 hypothetical protein CKC_05070 [Candidatus Liberibacter 1 1e-123
190891874365 hypothetical protein RHECIAT_CH0002283 [Rhizobium etli 1 2e-66
327188319365 hypothetical protein RHECNPAF_910012 [Rhizobium etli CN 1 4e-66
86357811367 hypothetical protein RHE_CH02195 [Rhizobium etli CFN 42 1 3e-65
209549438366 hypothetical protein Rleg2_1844 [Rhizobium leguminosaru 1 3e-64
116252273366 hypothetical protein RL2527 [Rhizobium leguminosarum bv 1 5e-64
241204764366 hypothetical protein Rleg_2043 [Rhizobium leguminosarum 1 1e-63
222086048376 hypothetical protein Arad_2470 [Agrobacterium radiobact 1 6e-61
150396276349 hypothetical protein Smed_1055 [Sinorhizobium medicae W 1 5e-57
15889048326 hypothetical protein Atu1745 [Agrobacterium tumefaciens 1 7e-56
>gi|315122760|ref|YP_004063249.1| hypothetical protein CKC_05070 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 301 Back     alignment and organism information
 Score =  446 bits (1146), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 217/294 (73%), Positives = 254/294 (86%), Gaps = 5/294 (1%)

Query: 4   SFSSYAKAEN---MHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHI 60
           SF SYAK EN   +HTTST  +N++SKGKGK+++ AQ+I C+ARLTENS  I+SGVSWH+
Sbjct: 6   SFPSYAKTENPSDIHTTSTS-SNDMSKGKGKKIIPAQKIICKARLTENSPFINSGVSWHV 64

Query: 61  FDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFI 120
           FD+  NKK+TLST KKIIGG V  +LFPGDYL+SASFGHVGVVK+ITV+  ++ +K  F+
Sbjct: 65  FDTTLNKKDTLSTIKKIIGGIVYLELFPGDYLVSASFGHVGVVKRITVTPTKQIEKHTFV 124

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVR-LGTNNYQITS 179
            NAGGIRLYSIYKP SPIVDDELTFSIYSNPN K L+I DKV SGTL+R LG+ NYQITS
Sbjct: 125 FNAGGIRLYSIYKPDSPIVDDELTFSIYSNPNQKPLMIADKVSSGTLIRLLGSTNYQITS 184

Query: 180 HYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTV 239
           HYGKYNA+VST+VKVE GK+IDVTIQNRAAK TFKLVSE GGEA+ADTAWSILTA GDTV
Sbjct: 185 HYGKYNAVVSTIVKVESGKVIDVTIQNRAAKTTFKLVSEAGGEAIADTAWSILTAGGDTV 244

Query: 240 GESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMDKN 293
           GES +A PSM+LSEGDY VIARNKER YSREFSV TGK+ ++EV+M+QKR+DK+
Sbjct: 245 GESVHAFPSMILSEGDYVVIARNKERIYSREFSVTTGKNKVIEVIMKQKRVDKS 298


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|190891874|ref|YP_001978416.1| hypothetical protein RHECIAT_CH0002283 [Rhizobium etli CIAT 652] Length = 365 Back     alignment and organism information
>gi|327188319|gb|EGE55537.1| hypothetical protein RHECNPAF_910012 [Rhizobium etli CNPAF512] Length = 365 Back     alignment and organism information
>gi|86357811|ref|YP_469703.1| hypothetical protein RHE_CH02195 [Rhizobium etli CFN 42] Length = 367 Back     alignment and organism information
>gi|209549438|ref|YP_002281355.1| hypothetical protein Rleg2_1844 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 366 Back     alignment and organism information
>gi|116252273|ref|YP_768111.1| hypothetical protein RL2527 [Rhizobium leguminosarum bv. viciae 3841] Length = 366 Back     alignment and organism information
>gi|241204764|ref|YP_002975860.1| hypothetical protein Rleg_2043 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 366 Back     alignment and organism information
>gi|222086048|ref|YP_002544580.1| hypothetical protein Arad_2470 [Agrobacterium radiobacter K84] Length = 376 Back     alignment and organism information
>gi|150396276|ref|YP_001326743.1| hypothetical protein Smed_1055 [Sinorhizobium medicae WSM419] Length = 349 Back     alignment and organism information
>gi|15889048|ref|NP_354729.1| hypothetical protein Atu1745 [Agrobacterium tumefaciens str. C58] Length = 326 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 298 hypothetical protein CLIBASIA_00215 [Candidatus Liberib
COG4932 1531 Predicted outer membrane protein [Cell envelope biogene 100.0
COG49321531 Predicted outer membrane protein [Cell envelope biogene 100.0
KOG1948 1165 consensus 99.45
KOG1948 1165 consensus 99.14
pfam0573869 Cna_B Cna protein B-type domain. This domain is found i 97.95
pfam0236993 Big_1 Bacterial Ig-like domain (group 1). This family c 92.21
pfam08400134 phage_tail_N Prophage tail fibre N-terminal. This domai 91.56
smart0063492 BID_1 Bacterial Ig-like domain (group 1). 90.8
pfam0573869 Cna_B Cna protein B-type domain. This domain is found i 97.94
cd03864392 M14_CPN Peptidase M14 Carboxypeptidase N (CPN, also kno 96.85
cd06245363 M14_CPD_III The third carboxypeptidase (CP)-like domain 96.76
cd03863375 M14_CPD_II The second carboxypeptidase (CP)-like domain 96.53
cd03865402 M14_CPE_H Peptidase M14 Carboxypeptidase (CP) E (CPE, a 96.52
cd03869405 M14_CPX_like Peptidase M14-like domain of carboxypeptid 96.03
cd03858374 M14_CP_N-E_like Carboxypeptidase (CP) N/E-like subfamil 96.02
cd03868372 M14_CPD_I The first carboxypeptidase (CP)-like domain o 95.66
cd03867395 M14_CPZ Peptidase M14-like domain of carboxypeptidase ( 95.54
cd03866376 M14_CPM Peptidase M14 Carboxypeptidase (CP) M (CPM) bel 94.3
pfam0830871 PEGA PEGA domain. This domain is found in both archaea 93.89
cd03863375 M14_CPD_II The second carboxypeptidase (CP)-like domain 97.89
cd03864392 M14_CPN Peptidase M14 Carboxypeptidase N (CPN, also kno 97.79
cd03865402 M14_CPE_H Peptidase M14 Carboxypeptidase (CP) E (CPE, a 97.68
cd06245363 M14_CPD_III The third carboxypeptidase (CP)-like domain 97.67
cd03868372 M14_CPD_I The first carboxypeptidase (CP)-like domain o 97.48
cd03867395 M14_CPZ Peptidase M14-like domain of carboxypeptidase ( 97.36
KOG2649500 consensus 97.33
cd03869405 M14_CPX_like Peptidase M14-like domain of carboxypeptid 97.3
cd03858374 M14_CP_N-E_like Carboxypeptidase (CP) N/E-like subfamil 97.18
pfam0721086 DUF1416 Protein of unknown function (DUF1416). This fam 96.83
pfam0830871 PEGA PEGA domain. This domain is found in both archaea 96.52
cd03866376 M14_CPM Peptidase M14 Carboxypeptidase (CP) M (CPM) bel 96.47
pfam11589106 DUF3244 Protein of unknown function (DUF3244). This fam 92.2
>COG4932 Predicted outer membrane protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG4932 Predicted outer membrane protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1948 consensus Back     alignment and domain information
>KOG1948 consensus Back     alignment and domain information
>pfam05738 Cna_B Cna protein B-type domain Back     alignment and domain information
>pfam02369 Big_1 Bacterial Ig-like domain (group 1) Back     alignment and domain information
>pfam08400 phage_tail_N Prophage tail fibre N-terminal Back     alignment and domain information
>smart00634 BID_1 Bacterial Ig-like domain (group 1) Back     alignment and domain information
>pfam05738 Cna_B Cna protein B-type domain Back     alignment and domain information
>cd03864 M14_CPN Peptidase M14 Carboxypeptidase N (CPN, also known as kininase I, creatine kinase conversion factor, plasma carboxypeptidase B, arginine carboxypeptidase, and protaminase; EC 3 Back     alignment and domain information
>cd06245 M14_CPD_III The third carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3 Back     alignment and domain information
>cd03863 M14_CPD_II The second carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3 Back     alignment and domain information
>cd03865 M14_CPE_H Peptidase M14 Carboxypeptidase (CP) E (CPE, also known as carboxypeptidase H, and enkephalin convertase; EC 3 Back     alignment and domain information
>cd03869 M14_CPX_like Peptidase M14-like domain of carboxypeptidase (CP)-like protein X (CPX), CPX forms a distinct subgroup of the N/E subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd03858 M14_CP_N-E_like Carboxypeptidase (CP) N/E-like subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd03868 M14_CPD_I The first carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3 Back     alignment and domain information
>cd03867 M14_CPZ Peptidase M14-like domain of carboxypeptidase (CP) Z (CPZ), CPZ belongs to the N/E subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd03866 M14_CPM Peptidase M14 Carboxypeptidase (CP) M (CPM) belongs to the N/E subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>pfam08308 PEGA PEGA domain Back     alignment and domain information
>cd03863 M14_CPD_II The second carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3 Back     alignment and domain information
>cd03864 M14_CPN Peptidase M14 Carboxypeptidase N (CPN, also known as kininase I, creatine kinase conversion factor, plasma carboxypeptidase B, arginine carboxypeptidase, and protaminase; EC 3 Back     alignment and domain information
>cd03865 M14_CPE_H Peptidase M14 Carboxypeptidase (CP) E (CPE, also known as carboxypeptidase H, and enkephalin convertase; EC 3 Back     alignment and domain information
>cd06245 M14_CPD_III The third carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3 Back     alignment and domain information
>cd03868 M14_CPD_I The first carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3 Back     alignment and domain information
>cd03867 M14_CPZ Peptidase M14-like domain of carboxypeptidase (CP) Z (CPZ), CPZ belongs to the N/E subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>KOG2649 consensus Back     alignment and domain information
>cd03869 M14_CPX_like Peptidase M14-like domain of carboxypeptidase (CP)-like protein X (CPX), CPX forms a distinct subgroup of the N/E subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd03858 M14_CP_N-E_like Carboxypeptidase (CP) N/E-like subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>pfam07210 DUF1416 Protein of unknown function (DUF1416) Back     alignment and domain information
>pfam08308 PEGA PEGA domain Back     alignment and domain information
>cd03866 M14_CPM Peptidase M14 Carboxypeptidase (CP) M (CPM) belongs to the N/E subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>pfam11589 DUF3244 Protein of unknown function (DUF3244) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target298 hypothetical protein CLIBASIA_00215 [Candidatus Liberib
3phs_A249 Crystal Structure Of Gbs52, The Minor Pilin In Gram 0.001
2pz4_A239 Crystal Structure Of Spab (Gbs52), The Minor Pilin 0.001
3phs_A249 Crystal Structure Of Gbs52, The Minor Pilin In Gram 0.004
2x5p_A121 Crystal Structure Of The Streptococcus Pyogenes Fib 0.002
>gi|312208206|pdb|3PHS|A Chain A, Crystal Structure Of Gbs52, The Minor Pilin In Gram-Positive Pathogen Streptococcus Agalactiae Length = 249 Back     alignment and structure
 Score = 48.4 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 20/176 (11%), Positives = 46/176 (26%), Gaps = 30/176 (17%)

Query: 146 SIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQ 205
            +           T++    T  +L    Y   +          +   V+  +   +  +
Sbjct: 71  ELKKQAQQVFEATTNQQGKATFNQLPDGIYYGLAVKAGEKNRNVSAFLVDLSEDKVIYPK 130

Query: 206 NRAAKITFKL----VSEMGGEAVADTAWSILTASGDTV-------------------GES 242
              +     L    V     + +A   + +   +G T                     +S
Sbjct: 131 IIWSTGELDLLKVGVDGDTKKPLAGVVFELYEKNGRTPIRVKNGVHSQDIDAAKHLETDS 190

Query: 243 ANASPSMVLSEGDYTVIARNKERNYS-----REFSVLTGKSTIVEVLMRQKRMDKN 293
           +       L  GDY +     +  Y         ++   K+  V V +  K++   
Sbjct: 191 SGHIRISGLIHGDYVLKEIETQSGYQIGQAETAVTIEKSKT--VTVTIENKKVPTP 244


>gi|312208206|pdb|3PHS|A Chain A, Crystal Structure Of Gbs52, The Minor Pilin In Gram-Positive Pathogen Streptococcus Agalactiae Length = 249 Back     alignment and structure
>gi|305677624|pdb|2X5P|A Chain A, Crystal Structure Of The Streptococcus Pyogenes Fibronectin Binding Protein Fbab-B Length = 121 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target298 hypothetical protein CLIBASIA_00215 [Candidatus Liberib
3kpt_A355 Collagen adhesion protein; intramolecular amide bond, p 99.77
1d2p_A373 Collagen adhesin, CNA; IGG, IGSF, mscramm, structural p 98.7
1d2p_A373 Collagen adhesin, CNA; IGG, IGSF, mscramm, structural p 98.5
1cwv_A 492 Invasin; integrin-binding protein, INV gene, structural 97.79
2pz4_A239 Protein GBS052; SPAB, GRAM-positive pilins, adhesions, 99.64
2x9x_A444 RRGB, cell WALL surface anchor family protein; cell adh 97.86
1d2o_A187 Collagen adhesin, CNA; beta sandwich, IGG, IGSF, struct 90.1
2pz4_A239 Protein GBS052; SPAB, GRAM-positive pilins, adhesions, 99.6
2x9x_A444 RRGB, cell WALL surface anchor family protein; cell adh 98.92
3hr6_A436 SPAA, putative surface-anchored fimbrial subunit; multi 99.13
2ww8_A893 RRGA, cell WALL surface anchor family protein; IGG, pil 98.99
2x5p_A121 FBA2, fibronectin binding protein; protein binding; 1.6 98.81
1h8l_A380 Carboxypeptidase GP180 residues 503-882; hydrolase, zin 98.47
2nsm_A439 Carboxypeptidase N catalytic chain; caroxypeptidase, zi 98.18
2x9z_A262 RRGB, cell WALL surface anchor family protein; cell adh 97.69
3irp_X429 URO-adherence factor A; DEV-IGG fold, cell WALL, hemagg 97.46
3mn8_A435 LP15968P; catalytic domain of alpha/beta-hydrolase fold 97.13
1uwy_A426 Carboxypeptidase M; metallopeptidase, GPI-anchor, metal 97.03
1nkg_A 508 Rhamnogalacturonase B; polysaccharide lyase, carbohydra 96.38
3e8v_A82 Possible transglutaminase-family protein; structural ge 94.87
2ww8_A 893 RRGA, cell WALL surface anchor family protein; IGG, pil 98.99
2xi9_A 457 Ancillary protein 1; cell adhesion, GRAM positive pilus 98.76
3hr6_A 436 SPAA, putative surface-anchored fimbrial subunit; multi 97.62
2x5p_A121 FBA2, fibronectin binding protein; protein binding; 1.6 98.9
2xi9_A 457 Ancillary protein 1; cell adhesion, GRAM positive pilus 98.71
3kpt_A355 Collagen adhesion protein; intramolecular amide bond, p 98.36
2nsm_A439 Carboxypeptidase N catalytic chain; caroxypeptidase, zi 97.55
1h8l_A380 Carboxypeptidase GP180 residues 503-882; hydrolase, zin 97.23
1uwy_A426 Carboxypeptidase M; metallopeptidase, GPI-anchor, metal 96.12
2x9z_A262 RRGB, cell WALL surface anchor family protein; cell adh 97.37
3irp_X429 URO-adherence factor A; DEV-IGG fold, cell WALL, hemagg 97.21
1xpn_A170 Hypothetical protein PA1324; B-barrel, structural genom 93.24
1xpn_A170 Hypothetical protein PA1324; B-barrel, structural genom 94.76
>3kpt_A Collagen adhesion protein; intramolecular amide bond, pilin subunit, beta sheet; 2.10A {Bacillus cereus atcc 14579} Back     alignment and structure
Probab=99.77  E-value=1.8e-16  Score=123.13  Aligned_cols=248  Identities=9%  Similarity=0.060  Sum_probs=135.4

Q ss_pred             EEEEEEEECCCCCCCCCCEEEEEEECCCCCCCEEEEEEECCCCEEEECCCCCEEEEEEEECCCCCE-----EEEEEECCC
Q ss_conf             279999986887753467599999538887620588982468566302267218999961577752-----789980686
Q gi|254780160|r   38 RITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSSKE  112 (298)
Q Consensus        38 ~i~l~a~~~~~~~~~~~G~~~~vy~~~~~~~g~~~~tt~~~G~~~~~~L~pG~Y~v~~s~g~~~~~-----~~vtV~~~~  112 (298)
                      +|.|...  +..+..|+||+|+||+... .......+|+++|.+.+.+|+||+|.|+|...|.+|.     ..+++....
T Consensus         9 ~i~i~K~--d~~~~~L~Ga~f~l~~~~g-~~~~~~~tTd~~G~~~f~~L~~G~Y~v~E~~aP~GY~~~~~~~~~~v~~~~   85 (355)
T 3kpt_A            9 AVDLIKT--GVNEKAMAGAVFSLFKKDG-TEVKKELATDANGHIRVQGLEYGEYYFQETKAPKGYVIDPTKREFFVKNSG   85 (355)
T ss_dssp             EEEEEEE--CGGGCBCCSCEEEEEETTS-CEEEEEEECCTTSEEEEEEEESEEEEEEEEECCTTBCCCCCCEEEEECSCE
T ss_pred             EEEEEEE--CCCCCEECCCEEEEEECCC-CEEEEEEEECCCCEEEECCCCCEEEEEEEEECCCCCCCCCCCCCEEECCCC
T ss_conf             9999999--8999870895899998999-999787999999839999869632899999899982603442201651365


Q ss_pred             CEE----------EEEEECCCCEEEEEEEECCCC----CCCCCEEEEEEE------------------CCCCCE------
Q ss_conf             136----------787513664379998615788----777551899998------------------389743------
Q gi|254780160|r  113 KNQ----------KQVFILNAGGIRLYSIYKPGS----PIVDDELTFSIY------------------SNPNHK------  154 (298)
Q Consensus       113 ~~~----------~~~~~~~ag~~~~~~~~~~~~----~~~~~~~~f~i~------------------~~~~~~------  154 (298)
                      ...          ....+.......+........    ..+.....+.+.                  ......      
T Consensus        86 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  165 (355)
T 3kpt_A           86 TINEDGTITSGTVVKMEVKNNEEPTIDKKINGKLEALPINPLTNYNYDIKTLIPEDIKEYKKYVVTDTLDNRLVIQGKPI  165 (355)
T ss_dssp             EECTTSSCEEECEEEEEEECCBCCCEEEEETTTBSEEEECTTCCEEEEEEEECCTTGGGCSEEEEEEECCTTEEECSCCE
T ss_pred             EEEEECEECCCCEEEEEEEEECCCCCCCCCCCCEEEEEECCCCCEEEEEEECCCCCEECCEEEEEEECCCCCEEECCEEE
T ss_conf             03440115245305778720012110111245125543036754157876325420001347999982656378526046


Q ss_pred             ------------EEE----------EEECCCCCEEEEECCCCEEEEEEECCCCCEEEE--E--EEECCCCE-----EEEE
Q ss_conf             ------------566----------750567513521067617999961577854454--4--88428863-----7899
Q gi|254780160|r  155 ------------ALL----------ITDKVRSGTLVRLGTNNYQITSHYGKYNAIVST--V--VKVEPGKI-----IDVT  203 (298)
Q Consensus       155 ------------~~~----------~t~~~~~~~~~~L~~G~Y~v~et~a~~~~~~~~--~--i~V~~g~~-----~~~t  203 (298)
                                  ...          ............+..+.|.+++...|.++....  .  +.......     ....
T Consensus       166 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  245 (355)
T 3kpt_A          166 VKIDGAEVNANVVEVAIEGQKVTATVKDFTKMDGKKEFHLQIKSQVKEGVPSGSEILNTAKIHFTNKNDVIGEKESKPVV  245 (355)
T ss_dssp             EEETTEECCTTTEEEEEETTEEEEEECCSGGGTTCCEEEEEEEEEECTTCCTTCCEEECCEEEEECTTCCEEEEECCCEE
T ss_pred             EEECCCCCCEEEEEEECCCCEEEEEEEECCCCCCCCCCCCCCEEEEEEECCCCCEECCCCEEEEECCCCEEEEEEEEEEE
T ss_conf             77527653001588832686798986202333463234444127988733665030344307897357603555666678


Q ss_pred             EEECCCEEEEEEEECCCCCCCCCEEEEEECCCCCE----------EEECCCCEEECCCCCEEEEEEEECCCCEEEE----
Q ss_conf             99345238999983478863276089998389979----------7421252121244870289999538824677----
Q gi|254780160|r  204 IQNRAAKITFKLVSEMGGEAVADTAWSILTASGDT----------VGESANASPSMVLSEGDYTVIARNKERNYSR----  269 (298)
Q Consensus       204 v~~~~~~~~~~~v~~~~G~~l~ga~~~i~~~~g~~----------vt~~~G~~~~~~L~~G~Y~v~a~~~~~~y~~----  269 (298)
                      .....+.+.+.+++..++++|+||.|.|++.+|..          +++.+|.+.+.+|++|+|+|.+..+|.+|..    
T Consensus       246 ~~~~~g~~~~~K~d~~~~~~L~Ga~F~l~~~~g~~v~~~~~~~t~~Td~~G~~~~~~L~~G~Y~l~EtkaP~GY~~~~~~  325 (355)
T 3kpt_A          246 VIPTTGIIELTKIDSANKNKMKGAEFVLKDNNGKIVVVAGKEVTGVSDENGVIKWSNIPYGDYQIFETKAPTYTKEDGTK  325 (355)
T ss_dssp             EEECEEEEEEEEEETTTCCBCSCCEEEEEETTSCBCBSSSSBCEEECCTTSEEEEEEEESSEEEEEEEECCEEECTTCCE
T ss_pred             EEEECCCEEEEEECCCCCCCCCCCEEEEECCCCCEEEECCCEEEEEECCCCEEEECCCCCCEEEEEEEECCCCCCCCCCC
T ss_conf             86741524799974888830188589999179999950574768998999889989998935999999789974357764


Q ss_pred             --------EEEEEECCC-CEEEEEEECH
Q ss_conf             --------799972885-0489997410
Q gi|254780160|r  270 --------EFSVLTGKS-TIVEVLMRQK  288 (298)
Q Consensus       270 --------~ftV~~g~~-~~veV~~~~~  288 (298)
                              ++.|...++ ..+++.+.++
T Consensus       326 ~~y~~~~~~i~~~i~~~~~~~~~t~~n~  353 (355)
T 3kpt_A          326 TSYQLLKDPIDVKISENNQTVKLTIENN  353 (355)
T ss_dssp             EECCCCCSCEEEECBTTBCEEEEEEEEC
T ss_pred             CCEEECCCEEEEEEEECCEEEEEEEEEC
T ss_conf             4459749608999951992999999957



>1d2p_A Collagen adhesin, CNA; IGG, IGSF, mscramm, structural protein; 2.50A {Staphylococcus aureus} SCOP: b.3.5.1 b.3.5.1 b.3.5.1 b.3.5.1 Back     alignment and structure
>1d2p_A Collagen adhesin, CNA; IGG, IGSF, mscramm, structural protein; 2.50A {Staphylococcus aureus} SCOP: b.3.5.1 b.3.5.1 b.3.5.1 b.3.5.1 Back     alignment and structure
>1cwv_A Invasin; integrin-binding protein, INV gene, structural protein; HET: CIT; 2.30A {Yersinia pseudotuberculosis} SCOP: b.1.14.1 b.1.14.1 b.1.14.1 b.1.14.1 d.169.1.3 Back     alignment and structure
>2x9x_A RRGB, cell WALL surface anchor family protein; cell adhesion; 1.50A {Streptococcus pneumoniae} PDB: 2x9w_A 2x9y_A Back     alignment and structure
>1d2o_A Collagen adhesin, CNA; beta sandwich, IGG, IGSF, structural protein; 2.00A {Staphylococcus aureus} SCOP: b.3.5.1 b.3.5.1 Back     alignment and structure
>2x9x_A RRGB, cell WALL surface anchor family protein; cell adhesion; 1.50A {Streptococcus pneumoniae} PDB: 2x9w_A 2x9y_A Back     alignment and structure
>3hr6_A SPAA, putative surface-anchored fimbrial subunit; multiple IG-like domains, cell WALL, peptidoglycan-anchor, structural protein; 1.60A {Corynebacterium diphtheriae} PDB: 3htl_X* Back     alignment and structure
>2ww8_A RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae} Back     alignment and structure
>2x5p_A FBA2, fibronectin binding protein; protein binding; 1.60A {Streptococcus pyogenes} Back     alignment and structure
>1h8l_A Carboxypeptidase GP180 residues 503-882; hydrolase, zinc-dependent protease; HET: NAG BMA NDG GEM; 2.6A {Lophonetta specularioides} SCOP: b.3.2.1 c.56.5.1 PDB: 1qmu_A* Back     alignment and structure
>2nsm_A Carboxypeptidase N catalytic chain; caroxypeptidase, zinc peptidase, transthyretin-like domain, hormone processing, peptide modification; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>2x9z_A RRGB, cell WALL surface anchor family protein; cell adhesion; 1.30A {Streptococcus pneumoniae} Back     alignment and structure
>3irp_X URO-adherence factor A; DEV-IGG fold, cell WALL, hemagglutinin, peptidoglycan-anchor secreted, virulence, cell adhesion; 1.50A {Staphylococcus saprophyticus subsp} PDB: 3irz_A 3is0_X 3is1_X Back     alignment and structure
>3mn8_A LP15968P; catalytic domain of alpha/beta-hydrolase fold, C-terminal, A transthyretin-like domain, hydrolase; HET: NAG GEM; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1uwy_A Carboxypeptidase M; metallopeptidase, GPI-anchor, metalloprotease, zinc, lipoprotein, hydrolase, structural proteomics in europe, spine; HET: NAG; 3.0A {Homo sapiens} SCOP: b.3.2.1 c.56.5.1 Back     alignment and structure
>1nkg_A Rhamnogalacturonase B; polysaccharide lyase, carbohydrate active enzyme, pectin; 1.50A {Aspergillus aculeatus} SCOP: b.3.1.2 b.18.1.25 b.30.5.10 Back     alignment and structure
>3e8v_A Possible transglutaminase-family protein; structural genomics, unknown function, PSI-2, protein structure initiative; 2.40A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2ww8_A RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae} Back     alignment and structure
>2xi9_A Ancillary protein 1; cell adhesion, GRAM positive pilus, intramolecular isopeptid internal thioester; 1.90A {Streptococcus pyogenes} PDB: 2xic_A 2xid_A Back     alignment and structure
>3hr6_A SPAA, putative surface-anchored fimbrial subunit; multiple IG-like domains, cell WALL, peptidoglycan-anchor, structural protein; 1.60A {Corynebacterium diphtheriae} PDB: 3htl_X* Back     alignment and structure
>2x5p_A FBA2, fibronectin binding protein; protein binding; 1.60A {Streptococcus pyogenes} Back     alignment and structure
>2xi9_A Ancillary protein 1; cell adhesion, GRAM positive pilus, intramolecular isopeptid internal thioester; 1.90A {Streptococcus pyogenes} PDB: 2xic_A 2xid_A Back     alignment and structure
>3kpt_A Collagen adhesion protein; intramolecular amide bond, pilin subunit, beta sheet; 2.10A {Bacillus cereus atcc 14579} Back     alignment and structure
>2nsm_A Carboxypeptidase N catalytic chain; caroxypeptidase, zinc peptidase, transthyretin-like domain, hormone processing, peptide modification; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>1h8l_A Carboxypeptidase GP180 residues 503-882; hydrolase, zinc-dependent protease; HET: NAG BMA NDG GEM; 2.6A {Lophonetta specularioides} SCOP: b.3.2.1 c.56.5.1 PDB: 1qmu_A* Back     alignment and structure
>1uwy_A Carboxypeptidase M; metallopeptidase, GPI-anchor, metalloprotease, zinc, lipoprotein, hydrolase, structural proteomics in europe, spine; HET: NAG; 3.0A {Homo sapiens} SCOP: b.3.2.1 c.56.5.1 Back     alignment and structure
>2x9z_A RRGB, cell WALL surface anchor family protein; cell adhesion; 1.30A {Streptococcus pneumoniae} Back     alignment and structure
>3irp_X URO-adherence factor A; DEV-IGG fold, cell WALL, hemagglutinin, peptidoglycan-anchor secreted, virulence, cell adhesion; 1.50A {Staphylococcus saprophyticus subsp} PDB: 3irz_A 3is0_X 3is1_X Back     alignment and structure
>1xpn_A Hypothetical protein PA1324; B-barrel, structural genomics, northeast structural genomics consortium, NESG; NMR {Pseudomonas aeruginosa PAO1} SCOP: b.3.7.1 Back     alignment and structure
>1xpn_A Hypothetical protein PA1324; B-barrel, structural genomics, northeast structural genomics consortium, NESG; NMR {Pseudomonas aeruginosa PAO1} SCOP: b.3.7.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target298 hypothetical protein CLIBASIA_00215 [Candidatus Liberib
d1h8la179 Carboxypeptidase D C-terminal domain {Crested duck (Lop 98.45
d1nkga187 Rhamnogalacturonase B, RhgB, middle domain {Aspergillus 98.11
d1vlfn179 Transhydroxylase beta subunit, BthL, C-terminal domain 97.72
d1uwya1107 Carboxypeptidase M C-terminal domain {Human (Homo sapie 97.67
d1nkga187 Rhamnogalacturonase B, RhgB, middle domain {Aspergillus 97.56
d1h8la179 Carboxypeptidase D C-terminal domain {Crested duck (Lop 97.43
d1uwya1107 Carboxypeptidase M C-terminal domain {Human (Homo sapie 96.77
d1vlfn179 Transhydroxylase beta subunit, BthL, C-terminal domain 96.43
d1cwva194 Invasin {Yersinia pseudotuberculosis [TaxId: 633]} 95.62
d1xpna_170 Hypothetical protein PA1324 {Pseudomonas aeruginosa [Ta 94.07
>d1h8la1 b.3.2.1 (A:305-383) Carboxypeptidase D C-terminal domain {Crested duck (Lophonetta specularioides) [TaxId: 8836]} Back     information, alignment and structure
class: All beta proteins
fold: Prealbumin-like
superfamily: Carboxypeptidase regulatory domain-like
family: Carboxypeptidase regulatory domain
domain: Carboxypeptidase D C-terminal domain
species: Crested duck (Lophonetta specularioides) [TaxId: 8836]
Probab=98.45  E-value=2.5e-07  Score=62.44  Aligned_cols=75  Identities=13%  Similarity=0.123  Sum_probs=62.8

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCEEEECCCCEEECCCCCEEEEEEEECCCC-EEEEEEEEEECCCCEEEEEEE
Q ss_conf             8999983478863276089998389979742125212124487028999953882-467779997288504899974
Q gi|254780160|r  211 ITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKER-NYSREFSVLTGKSTIVEVLMR  286 (298)
Q Consensus       211 ~~~~~v~~~~G~~l~ga~~~i~~~~g~~vt~~~G~~~~~~L~~G~Y~v~a~~~~~-~y~~~ftV~~g~~~~veV~~~  286 (298)
                      +..++.+..+|+||++|.+.+.+....+.++.+|.|. ..|+||+|++.++..++ ...+.+.|..++...+++.|+
T Consensus         2 I~G~V~d~~tg~pi~~a~V~v~~~~~~~~Td~~G~f~-~~l~~G~y~l~vs~~Gy~~~~~~v~v~~~~~~~~~~~L~   77 (79)
T d1h8la1           2 IWGFVLDATDGRGILNATISVADINHPVTTYKDGDYW-RLLVQGTYKVTASARGYDPVTKTVEVDSKGGVQVNFTLS   77 (79)
T ss_dssp             EEEEEEETTTCSBCTTCEEEETTEEEEEECCTTSEEE-ECCCSEEEEEEEECTTBCCEEEEEEECSSCEEECCEEEC
T ss_pred             CEEEEEECCCCCCCCCEEEEEECCCCCEEECCCCCEE-EEEECCCEEEEEEEEEECCEEEEEEECCCCEEEEEEEEC
T ss_conf             5999997999998487299981750117956878799-996066189999997766399999997898599999986



>d1nkga1 b.3.1.2 (A:251-337) Rhamnogalacturonase B, RhgB, middle domain {Aspergillus aculeatus [TaxId: 5053]} Back     information, alignment and structure
>d1vlfn1 b.3.5.1 (N:196-274) Transhydroxylase beta subunit, BthL, C-terminal domain {Pelobacter acidigallici [TaxId: 35816]} Back     information, alignment and structure
>d1uwya1 b.3.2.1 (A:297-403) Carboxypeptidase M C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkga1 b.3.1.2 (A:251-337) Rhamnogalacturonase B, RhgB, middle domain {Aspergillus aculeatus [TaxId: 5053]} Back     information, alignment and structure
>d1h8la1 b.3.2.1 (A:305-383) Carboxypeptidase D C-terminal domain {Crested duck (Lophonetta specularioides) [TaxId: 8836]} Back     information, alignment and structure
>d1uwya1 b.3.2.1 (A:297-403) Carboxypeptidase M C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vlfn1 b.3.5.1 (N:196-274) Transhydroxylase beta subunit, BthL, C-terminal domain {Pelobacter acidigallici [TaxId: 35816]} Back     information, alignment and structure
>d1cwva1 b.1.14.1 (A:503-596) Invasin {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1xpna_ b.3.7.1 (A:) Hypothetical protein PA1324 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target298 hypothetical protein CLIBASIA_00215 [Candidatus Liberib
3kpt_A_1-107107 Collagen adhesion protein; intramolecular amide bo 98.64
2pz4_A_122-239118 Protein GBS052; SPAB, GRAM-positive pilins, adhesi 98.53
3e8v_A_82 Possible transglutaminase-family protein; structur 93.88
3kpt_A_251-355105 Collagen adhesion protein; intramolecular amide bo 98.63
2ww8_A_1-142_722-733154 RRGA, cell WALL surface anchor family protein; IGG 98.6
2pz4_A_122-239118 Protein GBS052; SPAB, GRAM-positive pilins, adhesi 98.51
1h8l_A_300-38081 Carboxypeptidase GP180 residues 503-882; hydrolase 98.44
1nkg_A_245-33793 Rhamnogalacturonase B; polysaccharide lyase, carbo 98.32
1ti6_B_194-27481 Pyrogallol hydroxytransferase small subunit; molyb 98.0
3hr6_A_290-436147 SPAA, putative surface-anchored fimbrial subunit; 97.92
3kcp_A_155-25298 Cellulosomal-scaffolding protein A; dockerin, X-mo 97.54
1uwy_A_295-426132 Carboxypeptidase M; metallopeptidase, GPI-anchor, 96.59
2nsm_A_320-439120 Carboxypeptidase N catalytic chain; caroxypeptidas 96.39
3e8v_A_82 Possible transglutaminase-family protein; structur 95.66
3kpt_A_1-107107 Collagen adhesion protein; intramolecular amide bo 98.62
2ww8_A_734-893160 RRGA, cell WALL surface anchor family protein; IGG 98.25
1ti6_B_194-27481 Pyrogallol hydroxytransferase small subunit; molyb 97.8
2nsm_A_320-439120 Carboxypeptidase N catalytic chain; caroxypeptidas 97.65
1uwy_A_295-426132 Carboxypeptidase M; metallopeptidase, GPI-anchor, 97.53
1nkg_A_245-33793 Rhamnogalacturonase B; polysaccharide lyase, carbo 97.48
1h8l_A_300-38081 Carboxypeptidase GP180 residues 503-882; hydrolase 96.82
1cwv_A_1-104104 Invasin; integrin-binding protein, INV gene, struc 95.77
3kcp_A_155-25298 Cellulosomal-scaffolding protein A; dockerin, X-mo 95.7
2ww8_A_734-893160 RRGA, cell WALL surface anchor family protein; IGG 98.61
3kpt_A_251-355105 Collagen adhesion protein; intramolecular amide bo 98.32
2ww8_A_1-142_722-733154 RRGA, cell WALL surface anchor family protein; IGG 98.25
1cwv_A_105-20298 Invasin; integrin-binding protein, INV gene, struc 94.94
2pz4_A_1-121121 Protein GBS052; SPAB, GRAM-positive pilins, adhesi 93.02
3csl_A_ 865 HASR protein; outer membrane protein, beta-barrel, 92.94
1cwv_A_203-30199 Invasin; integrin-binding protein, INV gene, struc 90.45
3hr6_A_290-436147 SPAA, putative surface-anchored fimbrial subunit; 98.03
3hr6_A_1-145145 SPAA, putative surface-anchored fimbrial subunit; 97.25
1xpn_A_170 Hypothetical protein PA1324; B-barrel, structural 95.49
3hr6_A_1-145145 SPAA, putative surface-anchored fimbrial subunit; 97.24
1xpn_A_170 Hypothetical protein PA1324; B-barrel, structural 95.53
>3kpt_A (A:1-107) Collagen adhesion protein; intramolecular amide bond, pilin subunit, beta sheet; 2.10A {Bacillus cereus atcc 14579} Back     alignment and structure
Probab=98.64  E-value=9.6e-08  Score=67.71  Aligned_cols=94  Identities=13%  Similarity=0.091  Sum_probs=58.2

Q ss_pred             CEEEEEEEECCCCCCCCCEEEEEEECCCCCE--EEEEEECCCCCEEEEECCCCEEEEEEECCCCCEEEE---EEEECCCC
Q ss_conf             4379998615788777551899998389743--566750567513521067617999961577854454---48842886
Q gi|254780160|r  124 GGIRLYSIYKPGSPIVDDELTFSIYSNPNHK--ALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVST---VVKVEPGK  198 (298)
Q Consensus       124 g~~~~~~~~~~~~~~~~~~~~f~i~~~~~~~--~~~~t~~~~~~~~~~L~~G~Y~v~et~a~~~~~~~~---~i~V~~g~  198 (298)
                      +.+.+.+++.++.  ++.+++|.|+..++..  ....++..|...+.+|++|.|+|+|+.+|.||.+..   .|+|..++
T Consensus         8 g~i~i~K~d~~g~--~l~GA~f~l~~~~~~~~~~~~tTd~~G~~~~~~l~~G~Y~l~E~~aP~GY~~~~~~~~~~v~~~~   85 (107)
T 3kpt_A            8 GAVDLIKTGVNEK--AXAGAVFSLFKKDGTEVKKELATDANGHIRVQGLEYGEYYFQETKAPKGYVIDPTKREFFVKNSG   85 (107)
T ss_dssp             EEEEEEEECGGGC--BCCSCEEEEEETTSCEEEEEEECCTTSEEEEEEEESEEEEEEEEECCTTBCCCCCCEEEEECSCE
T ss_pred             EEEEEEEECCCCC--CCCCCEEEEEECCCCEEEEEEEECCCCEEEECCCCCEEEEEEEEECCCCCCCCCCCCEEEECCCC
T ss_conf             8999999899998--21882899998999999788999999869999808657999999899996133344013651576


Q ss_pred             EEEEEEEECCCEEEEEEEECC
Q ss_conf             378999934523899998347
Q gi|254780160|r  199 IIDVTIQNRAAKITFKLVSEM  219 (298)
Q Consensus       199 ~~~~tv~~~~~~~~~~~v~~~  219 (298)
                      ...+++.+..+.+.+.+++.+
T Consensus        86 ~~~~~~~~~~~~i~i~K~d~~  106 (107)
T 3kpt_A           86 TINEDGTITSGTVVKXEVKNN  106 (107)
T ss_dssp             EECTTSSCEEECEEEEEEECC
T ss_pred             EEEEEEEECCCEEEEEEEEEC
T ss_conf             056521042550456775411



>3e8v_A (A:) Possible transglutaminase-family protein; structural genomics, unknown function, PSI-2, protein structure initiative; 2.40A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3kpt_A (A:251-355) Collagen adhesion protein; intramolecular amide bond, pilin subunit, beta sheet; 2.10A {Bacillus cereus atcc 14579} Back     alignment and structure
>2ww8_A (A:1-142,A:722-733) RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae} Back     alignment and structure
>1h8l_A (A:300-380) Carboxypeptidase GP180 residues 503-882; hydrolase, zinc-dependent protease; HET: NAG BMA NDG GEM; 2.6A {Lophonetta specularioides} Back     alignment and structure
>1nkg_A (A:245-337) Rhamnogalacturonase B; polysaccharide lyase, carbohydrate active enzyme, pectin; 1.50A {Aspergillus aculeatus} Back     alignment and structure
>1ti6_B (B:194-274) Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} Back     alignment and structure
>3hr6_A (A:290-436) SPAA, putative surface-anchored fimbrial subunit; multiple IG-like domains, cell WALL, peptidoglycan-anchor, structural protein; 1.60A {Corynebacterium diphtheriae} PDB: 3htl_X* Back     alignment and structure
>3kcp_A (A:155-252) Cellulosomal-scaffolding protein A; dockerin, X-module, carbohydrate metabolism, cell WALL biogenesis/degradation; 1.94A {Clostridium thermocellum atcc 27405} PDB: 2b59_B Back     alignment and structure
>1uwy_A (A:295-426) Carboxypeptidase M; metallopeptidase, GPI-anchor, metalloprotease, zinc, lipoprotein, hydrolase, structural proteomics in europe, spine; HET: NAG; 3.0A {Homo sapiens} Back     alignment and structure
>2nsm_A (A:320-439) Carboxypeptidase N catalytic chain; caroxypeptidase, zinc peptidase, transthyretin-like domain, hormone processing, peptide modification; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>3e8v_A (A:) Possible transglutaminase-family protein; structural genomics, unknown function, PSI-2, protein structure initiative; 2.40A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3kpt_A (A:1-107) Collagen adhesion protein; intramolecular amide bond, pilin subunit, beta sheet; 2.10A {Bacillus cereus atcc 14579} Back     alignment and structure
>2ww8_A (A:734-893) RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae} Back     alignment and structure
>1ti6_B (B:194-274) Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} Back     alignment and structure
>2nsm_A (A:320-439) Carboxypeptidase N catalytic chain; caroxypeptidase, zinc peptidase, transthyretin-like domain, hormone processing, peptide modification; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>1uwy_A (A:295-426) Carboxypeptidase M; metallopeptidase, GPI-anchor, metalloprotease, zinc, lipoprotein, hydrolase, structural proteomics in europe, spine; HET: NAG; 3.0A {Homo sapiens} Back     alignment and structure
>1nkg_A (A:245-337) Rhamnogalacturonase B; polysaccharide lyase, carbohydrate active enzyme, pectin; 1.50A {Aspergillus aculeatus} Back     alignment and structure
>1h8l_A (A:300-380) Carboxypeptidase GP180 residues 503-882; hydrolase, zinc-dependent protease; HET: NAG BMA NDG GEM; 2.6A {Lophonetta specularioides} Back     alignment and structure
>1cwv_A (A:1-104) Invasin; integrin-binding protein, INV gene, structural protein; HET: CIT; 2.30A {Yersinia pseudotuberculosis} Back     alignment and structure
>3kcp_A (A:155-252) Cellulosomal-scaffolding protein A; dockerin, X-module, carbohydrate metabolism, cell WALL biogenesis/degradation; 1.94A {Clostridium thermocellum atcc 27405} PDB: 2b59_B Back     alignment and structure
>2ww8_A (A:734-893) RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae} Back     alignment and structure
>3kpt_A (A:251-355) Collagen adhesion protein; intramolecular amide bond, pilin subunit, beta sheet; 2.10A {Bacillus cereus atcc 14579} Back     alignment and structure
>2ww8_A (A:1-142,A:722-733) RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae} Back     alignment and structure
>1cwv_A (A:105-202) Invasin; integrin-binding protein, INV gene, structural protein; HET: CIT; 2.30A {Yersinia pseudotuberculosis} Back     alignment and structure
>3csl_A (A:) HASR protein; outer membrane protein, beta-barrel, hemophore receptor, TONB BOX, heme, iron, metal-binding, secreted; HET: HEM; 2.70A {Serratia marcescens} PDB: 3csn_A 3ddr_A* Back     alignment and structure
>1cwv_A (A:203-301) Invasin; integrin-binding protein, INV gene, structural protein; HET: CIT; 2.30A {Yersinia pseudotuberculosis} Back     alignment and structure
>3hr6_A (A:290-436) SPAA, putative surface-anchored fimbrial subunit; multiple IG-like domains, cell WALL, peptidoglycan-anchor, structural protein; 1.60A {Corynebacterium diphtheriae} PDB: 3htl_X* Back     alignment and structure
>3hr6_A (A:1-145) SPAA, putative surface-anchored fimbrial subunit; multiple IG-like domains, cell WALL, peptidoglycan-anchor, structural protein; 1.60A {Corynebacterium diphtheriae} PDB: 3htl_X* Back     alignment and structure
>1xpn_A (A:) Hypothetical protein PA1324; B-barrel, structural genomics, northeast structural genomics consortium, NESG; NMR {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3hr6_A (A:1-145) SPAA, putative surface-anchored fimbrial subunit; multiple IG-like domains, cell WALL, peptidoglycan-anchor, structural protein; 1.60A {Corynebacterium diphtheriae} PDB: 3htl_X* Back     alignment and structure
>1xpn_A (A:) Hypothetical protein PA1324; B-barrel, structural genomics, northeast structural genomics consortium, NESG; NMR {Pseudomonas aeruginosa PAO1} Back     alignment and structure