254780163

254780163

ATP-dependent Clp protease ATP-binding subunit

GeneID in NCBI database:8209140Locus tag:CLIBASIA_00230
Protein GI in NCBI database:254780163Protein Accession:YP_003064576.1
Gene range:-(45136, 47532)Protein Length:798aa
Gene description:ATP-dependent Clp protease ATP-binding subunit
COG prediction:[O] ATPases with chaperone activity, ATP-binding subunit
KEGG prediction:ATP-dependent Clp protease ATP-binding subunit; K03694 ATP-dependent Clp protease ATP-binding subunit ClpA
SEED prediction:ATP-dependent Clp protease ATP-binding subunit ClpA
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Proteolysis in bacteria, ATP-dependent
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------80
MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNISLETEEKEVEDIKSDTDSLTIV
cccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHccccccccEEEEcccccHHHHHHHHHHHHHcccccccccccEEEEEEHHHHHHHcccccHHHHHHHHHHHHHHHcccEEEEEEcHHHHHccccccccHHHHHHHHHHHHccccEEEEEEccHHHHHHHHcccHHHHHcccEEEcccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccccEEEEEccccccHHHHHHHHHHHccccEEEEEcHHHccHHHHHHHcccccccccccHHHHHHHHHHcccccEEEEEcHHHccHHHHHHHHHHHHccEEccccccEEccccEEEEEcccccHHHHHHHccccccccHHHHHHHHHcccccHHHHHHcccEEEcccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccccccccccccccccccccHHHHHHHccccccccccc
ccccccHHHHHHHHHHHHHHHccEcEEcHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHcccccccccccccccEEcHHHHHHHHHHHHHHHHHccccccHHHHHHHHccccccHHHHHHHHccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccccEEEccccccHHHHHHHHHHHHHccccHHHHHccEEEEEcHHHHHHcccccccHHHHHHHHHHHHHHcccEEEEEEcEHHHEccccccccHHcHHHHHHHHHHcccEEEEccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHccHHHHHHHccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHcHEEEccHHHHHHHHHHHHHHHccccccccccEEEEEcccccccHHHHHHHHHHHcccEEEEEccHHHHHHccHHHHccccccccccccccccHHHHcccccEEEEHHHHHHHcHHHHHHHHHHHHccccccccccEEcEEEEEEEEEccccHHHHHHHccccccccccccHHHHHHHHccHHHHHHHHHEEEcccccHHHHHHHHHHHHHHHHHHHHHcccEEEEcHHHHHHHHHccccHHccccHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEcccccEEEEEEEccccccccccccccEEEcccccccccEEEc
MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLNyidndssnklkngfrveckptssfQRVVQRAVLHVQSTGRGIVTGANILVALfsepdshatyFLQEQEMTLYDAVNFISHGISKRKEFANFQSklnvdgssagsdgegfvndyqaktdlnlfpaLSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRrsknnplyvgdpgvgktAIAEGFAKQIVDGMVPDILLGARIFSLDmgnliagtryrGDFEERIKKIVKEIESYANAILYIDEIHTLvgagsasgisvdasnllkpalssgavrcigstTYSEYRQFFEKDKALVRRFQkidvsepsiEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHftsrklpdkAIDVIDEagasqilqplskrrkfiTEKDIKKTIASMNrsihttsfsrdddsVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARaglsdpnkpigcyvfsgptgvgktEISKQLAFALGVQLLRFDMSEYMERHAVSrligappgyvgfgqggiladsvdqnpysvVLLDEIEKSHPDVLNILLQIMDygiltdqsgkkisfRNVILIMTTNAGalemskarigfgssrnddaDKEALRNFLspeflnrldsiipffplssDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHgydvkmgarpLERIIKEHVkvpladeilfgklkkgggvvkvslnpdksasspiffeiensgsnisleteekevediksdtdsltiv
MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLNYIDndssnklkngfrveckptssfqrVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLNLFPALSAYCVDLTEKVKKGKvdilvgrheeinrtiqilcrrsknnplyVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFqkidvsepsiedAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEagasqilqplskrrkfitekdikktiasmnrsihttsfsrdddsvlSNLEKNLGTVVYGQEEAIKKLSSSIKIAraglsdpnkpiGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSlnpdksasspiffeiensgsnisleteekevediksdtdsltiv
MSFFSENLEKVLHQALVLANERNHEYATLEHlllaliddsdaaiVMLSCnvdlkvlknnllnYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFeerikkivkeieSYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPLADEILFgklkkgggvvkvSLNPDKSASSPIFFEIENSGSNISLETEEKEVEDIKSDTDSLTIV
****SENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLNYIDND**************PTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYDAVNFISHGISK******************************************AYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGA*****************DIKKTIASMNRSIHT**********LSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSK*******************NFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASS***********************************
MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNISLE*******************
***FSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYDAVNFISHGI***************************************FPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSN******EKEVE**KS*TDSLTI*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNISLETEEKEVEDIKSDTDSLTIV
MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNISLETEEKEVEDIKSDTDSLTIV
MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNISLETEEKEVEDIKSDTDSLTIV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target798 ATP-dependent Clp protease ATP-binding subunit [Candida
254780877853 ATP-dependent Clp protease, ATP-binding subunit pr 3e-77
254780877853 ATP-dependent Clp protease, ATP-binding subunit pr 3e-68
254780271424 ATP-dependent protease ATP-binding subunit ClpX [C 4e-06
254780271424 ATP-dependent protease ATP-binding subunit ClpX [C 0.022
254780270 820 ATP-dependent protease La [Candidatus Liberibacter 5e-04
254780270820 ATP-dependent protease La [Candidatus Liberibacter 0.002
254780829 437 ATP-dependent protease ATP-binding subunit [Candid 6e-04
254780721329 pilus component protein [Candidatus Liberibacter a 0.014
254780604401 5-aminolevulinate synthase [Candidatus Liberibacte 0.038
>gi|254780877|ref|YP_003065290.1| ATP-dependent Clp protease, ATP-binding subunit protein [Candidatus Liberibacter asiaticus str. psy62] Length = 853 Back     alignment
 Score =  281 bits (719), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 133/248 (53%), Positives = 183/248 (73%), Gaps = 2/248 (0%)

Query: 184 FPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAE 243
           F AL  YC DLTE+ + GK+D ++GR +E+ R IQ+L RR+KNNP+ +GDPGVGKTAI E
Sbjct: 158 FDALKKYCRDLTEEARNGKLDPVIGRDDEMRRAIQVLSRRTKNNPVLIGDPGVGKTAIIE 217

Query: 244 GFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESY-ANAILYI 302
           G A +I++G +P+ L G R+ +LDMG LIAG ++RG+FEER+K ++ EI S     IL+I
Sbjct: 218 GLASRIINGDIPESLKGKRLMALDMGALIAGAKFRGEFEERLKSLLCEIRSEDGEIILFI 277

Query: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362
           DE+H LVGAG   G ++DASNLLKP+L+ G + CIG+TT  EYR++ EKD AL RRFQ +
Sbjct: 278 DELHVLVGAGKTDG-AMDASNLLKPSLARGELHCIGATTLDEYRKYIEKDPALARRFQSL 336

Query: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422
            V EP++ D I I++G+K  +E+HH++R S  A+ +A  LS R+ T R LPDKAID++DE
Sbjct: 337 LVGEPTVTDTISILRGLKERYEQHHKVRISDSALVSAAVLSNRYITDRFLPDKAIDLMDE 396

Query: 423 AGASQILQ 430
           A A   +Q
Sbjct: 397 ASARVRMQ 404

>gi|254780877|ref|YP_003065290.1| ATP-dependent Clp protease, ATP-binding subunit protein [Candidatus Liberibacter asiaticus str. psy62] Length = 853 Back     alignment
 Score =  251 bits (641), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 127/283 (44%), Positives = 187/283 (66%), Gaps = 8/283 (2%)

Query: 471 LEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLA-- 528
           +E  +   V GQ  A++ +S++++  RAGL DP +P+G ++F GPTGVGKTE+ K LA  
Sbjct: 562 IETEISKSVIGQSAAVESVSNALRRFRAGLQDPQRPMGSFMFLGPTGVGKTELVKSLARL 621

Query: 529 -FALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEK 587
            F     ++R DMSEYME+H+VSRLIG+PPGYVG+ +GG L ++V ++PY VVL DEIEK
Sbjct: 622 LFDDENSMIRIDMSEYMEKHSVSRLIGSPPGYVGYEEGGALTEAVRRHPYQVVLFDEIEK 681

Query: 588 SHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDAD 647
           +H DV NILLQ++D G LTD  G+ + FRN ++IMT+N GA  +    I  G S +D   
Sbjct: 682 AHSDVHNILLQVLDDGRLTDSQGRTVDFRNTLIIMTSNLGAEYL----IEDGDSVHDKV- 736

Query: 648 KEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVIN 707
              +R+   PEFLNRLD II F  L  + + ++V   + ++   ++E+ IS  F ++VI+
Sbjct: 737 MGIVRSAFKPEFLNRLDEIILFEKLRKEDMAKIVRIQLGRVLSLIKERNISMDFDDQVID 796

Query: 708 WLVSHGYDVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGV 750
           WL   GYD   GARPL+R+I+ +++ PLA+ +L   +  G  +
Sbjct: 797 WLSCRGYDPSYGARPLKRVIQRYIQNPLAERVLSQTISDGDSI 839

>gi|254780271|ref|YP_003064684.1| ATP-dependent protease ATP-binding subunit ClpX [Candidatus Liberibacter asiaticus str. psy62] Length = 424 Back     alignment
 Score = 45.4 bits (106), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 82/346 (23%), Positives = 137/346 (39%), Gaps = 75/346 (21%)

Query: 487 KKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMER 546
           K+L+ S K +   L+  N      +  GPTG GKT +++ LA  + V     D +   E 
Sbjct: 98  KRLAHSSKSSNVELAKSN-----ILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTE- 151

Query: 547 HAVSRLIGAPPGYVGFGQGGIL------AD-SVDQNPYSVVLLDEIEK------------ 587
                      GYVG     I+      AD +V++    +V +DE++K            
Sbjct: 152 ----------AGYVGEDVENIILKLLQAADYNVERAQRGIVYIDEVDKISRKSDNPSITR 201

Query: 588 --SHPDVLNILLQIMDYGI--LTDQSGKKISFRNVILIMTTN-----AGAL--------- 629
             S   V   LL+IM+  I  +  Q G+K   +  + + TTN      GA          
Sbjct: 202 DVSGEGVQQALLKIMEGTIASVPPQGGRKHPQQEFLQVDTTNILFICGGAFAGLDRIISA 261

Query: 630 EMSKARIGFGSSRNDDADK---EALRNF---------LSPEFLNRLDSIIPFFPLSSD-- 675
              KA IGF +   D  ++   E LRN          L PEF+ RL  +     L  +  
Sbjct: 262 RGEKASIGFSAVVKDSDNRPVGEVLRNLESEDLVKFGLIPEFIGRLPVLATLEDLDENSL 321

Query: 676 --IIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKV 733
             I+ +  +  I + +     + +   F E+ +  +       K GAR L  I+++    
Sbjct: 322 IRILSEPKNALIKQYQCLFDMEDVELVFHEDALREIARCAIAHKTGARGLRSILEK---- 377

Query: 734 PLADEILFGKLKKGGGVVKVSLNPDKSASSP--IFFEIENSGSNIS 777
            L D +    + KG   V +S +  K  + P  ++ +  +  +N+S
Sbjct: 378 ILLDTMFELPMLKGVSSVIISDDVVKGKACPLNVYTDRRDEKANVS 423

>gi|254780271|ref|YP_003064684.1| ATP-dependent protease ATP-binding subunit ClpX [Candidatus Liberibacter asiaticus str. psy62] Length = 424 Back     alignment
 Score = 32.7 bits (73), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 48/104 (46%), Gaps = 16/104 (15%)

Query: 224 SKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRG-DFE 282
           +K+N L VG  G GKT +A+  A+ I+D  VP        F++     +    Y G D E
Sbjct: 112 AKSNILLVGPTGCGKTYLAQTLAR-IID--VP--------FTMADATTLTEAGYVGEDVE 160

Query: 283 ERIKKIVK----EIESYANAILYIDEIHTLVGAGSASGISVDAS 322
             I K+++     +E     I+YIDE+  +        I+ D S
Sbjct: 161 NIILKLLQAADYNVERAQRGIVYIDEVDKISRKSDNPSITRDVS 204

>gi|254780270|ref|YP_003064683.1| ATP-dependent protease La [Candidatus Liberibacter asiaticus str. psy62] Length = 820 Back     alignment
 Score = 38.1 bits (87), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 51/102 (50%), Gaps = 14/102 (13%)

Query: 507 IGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGG 566
           I C+V  GP GVGKT +++ +A A G Q +R  +    +   +    G    Y+G   G 
Sbjct: 368 ILCFV--GPPGVGKTSLAQSIAKATGRQYVRMSLGGVYDEADIR---GHRRTYIGSMPGR 422

Query: 567 I---LADSVDQNPYSVVLLDEIEKSHPDVLN----ILLQIMD 601
           I   L  +   NP  ++LLDEI+K   D+       LL+++D
Sbjct: 423 IIQSLKRAKRSNP--LLLLDEIDKMGSDLRGDPSAALLEVLD 462

>gi|254780270|ref|YP_003064683.1| ATP-dependent protease La [Candidatus Liberibacter asiaticus str. psy62] Length = 820 Back     alignment
 Score = 36.6 bits (83), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 75/174 (43%), Gaps = 29/174 (16%)

Query: 170 GFVNDYQAKTDLNLFPALSAYCVDL--TEKVKKGKVDILVGRHEEINRTIQILCRRSKNN 227
           G   D ++KT  NL  A+     D    EKVK+  ++ L  +   I     ILC      
Sbjct: 317 GVPWDKKSKTKKNLDFAIRILDQDHFGLEKVKERIIEYLAVQMRVIKNKGLILC------ 370

Query: 228 PLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNL-----IAGTR--YRGD 280
             +VG PGVGKT++A+  AK            G +   + +G +     I G R  Y G 
Sbjct: 371 --FVGPPGVGKTSLAQSIAKAT----------GRQYVRMSLGGVYDEADIRGHRRTYIGS 418

Query: 281 FEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAV 334
              RI + +K  +  +N +L +DEI  + G+      S     +L PA +S  V
Sbjct: 419 MPGRIIQSLKRAKR-SNPLLLLDEIDKM-GSDLRGDPSAALLEVLDPAQNSSFV 470

>gi|254780829|ref|YP_003065242.1| ATP-dependent protease ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 437 Back     alignment
 Score = 38.1 bits (87), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 11/60 (18%)

Query: 514 GPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVD 573
           GPTGVGKT IS++LA   G   ++ +++++ E            GYVG     I+ D VD
Sbjct: 60  GPTGVGKTAISRRLARLAGAPFIKVEVTKFTE-----------IGYVGRNVEQIIRDLVD 108

>gi|254780721|ref|YP_003065134.1| pilus component protein [Candidatus Liberibacter asiaticus str. psy62] Length = 329 Back     alignment
 Score = 33.5 bits (75), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 32/57 (56%), Gaps = 5/57 (8%)

Query: 558 GYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKIS 614
           GYVGF    +   ++ Q   S      I+++ PD L++LL  ++ GI  DQ+ ++++
Sbjct: 157 GYVGFCAPSVWISNLVQKRQS-----SIKRAWPDALDLLLICVESGISIDQALRRVA 208

>gi|254780604|ref|YP_003065017.1| 5-aminolevulinate synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 401 Back     alignment
 Score = 32.0 bits (71), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 76/174 (43%), Gaps = 26/174 (14%)

Query: 250 VDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLV 309
            D  +P I++   I+S+D           GD    IK+I    + Y NAI YIDE+H + 
Sbjct: 173 TDLSIPKIIIFESIYSMD-----------GDIAP-IKEICDLADQY-NAITYIDEVHAVG 219

Query: 310 GAGSA-SGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPS 368
             GS  +GIS     + +  + SG +   G  T+  Y    E     +R F    +   S
Sbjct: 220 IHGSCGAGISEREGIMNRITIISGTL-AKGFGTFGGYIAASENLCDFIRSFASGFIFSTS 278

Query: 369 IEDAI--EIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           +  AI    V  I+ Y ++H+  R  K+ +    QL  RH     L +KAI  I
Sbjct: 279 LPPAIASASVTSIQ-YIKQHYDER--KKYLERVKQL--RH----SLENKAIPCI 323

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target798 ATP-dependent Clp protease ATP-binding subunit [Candida
315122667796 ATP-dependent Clp protease ATP-binding subunit [Candida 1 0.0
222148870830 ATP-dependent Clp protease ATP-binding subunit [Agrobac 1 0.0
325292724838 ATP-dependent Clp protease, ATP-binding subunit ClpA [A 1 0.0
241204497830 ATP-dependent Clp protease, ATP-binding subunit clpA [R 1 0.0
222085851843 ATP-dependent Clp protease [Agrobacterium radiobacter K 1 0.0
116251969830 ATP-dependent Clp protease ATP-binding subunit [Rhizobi 1 0.0
86357528829 ATP-dependent Clp protease, ATP-binding subunit protein 1 0.0
190891597829 ATP-dependent Clp protease protein, ATP-binding subunit 1 0.0
209549171830 ATP-dependent Clp protease ATP-binding subunit clpA [Rh 1 0.0
114704885832 endopeptidase Clp ATP-binding chain A [Fulvimarina pela 1 0.0
>gi|315122667|ref|YP_004063156.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 796 Back     alignment and organism information
 Score = 1366 bits (3536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 659/798 (82%), Positives = 734/798 (91%), Gaps = 2/798 (0%)

Query: 1   MSFFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNL 60
           MSFFSENLEKVLHQALVLA E+N+EYATLEHLLLALIDDSDAA VMLSCNV+L VLK+NL
Sbjct: 1   MSFFSENLEKVLHQALVLATEKNNEYATLEHLLLALIDDSDAAAVMLSCNVNLAVLKDNL 60

Query: 61  LNYIDNDSSNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDS 120
           LNYIDNDSSNKLK+   VEC+PTSSFQRVVQRAV+HVQSTG+ +VTGANILVA F+EPDS
Sbjct: 61  LNYIDNDSSNKLKDDLHVECRPTSSFQRVVQRAVIHVQSTGKSVVTGANILVAFFAEPDS 120

Query: 121 HATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSAGSDGEGFVNDYQAKTD 180
           HATYFLQEQ+MTLYDAVNFISHGI K++EFANFQ  LN+ G+++GS  EGF  DY+ + +
Sbjct: 121 HATYFLQEQDMTLYDAVNFISHGIEKKREFANFQDSLNMGGATSGS--EGFGTDYKFQAN 178

Query: 181 LNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA 240
            N FPAL+AYC+DLTEK KKG +D+L+GR EEINRTIQILCRRSKNNPLYVGDPGVGKTA
Sbjct: 179 PNPFPALNAYCIDLTEKAKKGNIDVLIGRREEINRTIQILCRRSKNNPLYVGDPGVGKTA 238

Query: 241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAIL 300
           IAEGFAKQIVDGMVPD LLG R+FSLD+GNLIAGTRYRGDFEERIKK+VKEIE+   AIL
Sbjct: 239 IAEGFAKQIVDGMVPDSLLGTRVFSLDIGNLIAGTRYRGDFEERIKKMVKEIEACPGAIL 298

Query: 301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQ 360
           YIDEIHTLVG GS+SGISVDASNLLKPALSSG VRCIGSTTYSEYRQFFEKDKALVRRFQ
Sbjct: 299 YIDEIHTLVGTGSSSGISVDASNLLKPALSSGVVRCIGSTTYSEYRQFFEKDKALVRRFQ 358

Query: 361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420
           KID+ EPS ED IEI+KGIKPYFEEHHQLRYSKEAI+AAV LS+RHFTSRKLPDKAIDVI
Sbjct: 359 KIDIDEPSPEDTIEIIKGIKPYFEEHHQLRYSKEAIKAAVDLSIRHFTSRKLPDKAIDVI 418

Query: 421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY 480
           DEAGASQILQP SKRRKF+TEKDIK+T+ASMNRSIH+T+ S DDDS+LSNLE+NL  VVY
Sbjct: 419 DEAGASQILQPASKRRKFLTEKDIKRTVASMNRSIHSTNISNDDDSILSNLEENLERVVY 478

Query: 481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDM 540
           GQ EAIKKL  SIK+ARAGLS+P KPIGCYVFSGPTGVGKTEISKQLA  LG++LLRFDM
Sbjct: 479 GQSEAIKKLVCSIKLARAGLSNPQKPIGCYVFSGPTGVGKTEISKQLAVCLGIRLLRFDM 538

Query: 541 SEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIM 600
           SEY+ERHAV+RLIGAPPGYVGF QGG+L+DSVDQNPYS+VLLDEIEK+HPDV+NILLQIM
Sbjct: 539 SEYIERHAVARLIGAPPGYVGFDQGGLLSDSVDQNPYSLVLLDEIEKAHPDVVNILLQIM 598

Query: 601 DYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL 660
           DYG+LTDQ+G+K+SFRNVILIMTTNAGALE S+A+IGFGSSRN+DADKEALRNF SPEFL
Sbjct: 599 DYGMLTDQNGRKVSFRNVILIMTTNAGALEASRAKIGFGSSRNEDADKEALRNFFSPEFL 658

Query: 661 NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGA 720
           NRLDSI+PF PLS +++RQVV KFIM+L+ QLQEKGISFHFSEEVI+WLV HGYDVKMGA
Sbjct: 659 NRLDSIVPFSPLSPEVMRQVVRKFIMQLDAQLQEKGISFHFSEEVISWLVKHGYDVKMGA 718

Query: 721 RPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSPIFFEIENSGSNISLET 780
           RPLERIIKE++K+PLADEILFGKLKKGGG+VKV LNPDK+   PI FEIENS SNI+ E 
Sbjct: 719 RPLERIIKEYIKIPLADEILFGKLKKGGGIVKVFLNPDKNPLVPICFEIENSSSNIAFEA 778

Query: 781 EEKEVEDIKSDTDSLTIV 798
           EEKE EDIK+ TD LT++
Sbjct: 779 EEKEAEDIKNQTDPLTVI 796


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222148870|ref|YP_002549827.1| ATP-dependent Clp protease ATP-binding subunit [Agrobacterium vitis S4] Length = 830 Back     alignment and organism information
>gi|325292724|ref|YP_004278588.1| ATP-dependent Clp protease, ATP-binding subunit ClpA [Agrobacterium sp. H13-3] Length = 838 Back     alignment and organism information
>gi|241204497|ref|YP_002975593.1| ATP-dependent Clp protease, ATP-binding subunit clpA [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 830 Back     alignment and organism information
>gi|222085851|ref|YP_002544382.1| ATP-dependent Clp protease [Agrobacterium radiobacter K84] Length = 843 Back     alignment and organism information
>gi|116251969|ref|YP_767807.1| ATP-dependent Clp protease ATP-binding subunit [Rhizobium leguminosarum bv. viciae 3841] Length = 830 Back     alignment and organism information
>gi|86357528|ref|YP_469420.1| ATP-dependent Clp protease, ATP-binding subunit protein [Rhizobium etli CFN 42] Length = 829 Back     alignment and organism information
>gi|190891597|ref|YP_001978139.1| ATP-dependent Clp protease protein, ATP-binding subunit [Rhizobium etli CIAT 652] Length = 829 Back     alignment and organism information
>gi|209549171|ref|YP_002281088.1| ATP-dependent Clp protease ATP-binding subunit clpA [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 830 Back     alignment and organism information
>gi|114704885|ref|ZP_01437793.1| endopeptidase Clp ATP-binding chain A [Fulvimarina pelagi HTCC2506] Length = 832 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target798 ATP-dependent Clp protease ATP-binding subunit [Candida
TIGR02639731 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding 0.0
PRK11034758 PRK11034, clpA, ATP-dependent Clp protease ATP-binding 0.0
CHL00095821 CHL00095, clpC, Clp protease ATP binding subunit 1e-179
COG0542786 COG0542, ClpA, ATPases with chaperone activity, ATP-bin 0.0
TIGR03346852 TIGR03346, chaperone_ClpB, ATP-dependent chaperone ClpB 1e-100
TIGR03345852 TIGR03345, VI_ClpV1, type VI secretion ATPase, ClpV1 fa 7e-95
KOG1051 898 KOG1051, KOG1051, KOG1051, Chaperone HSP104 and related 5e-64
TIGR03346852 TIGR03346, chaperone_ClpB, ATP-dependent chaperone ClpB 3e-86
PRK10865857 PRK10865, PRK10865, protein disaggregation chaperone; P 2e-73
TIGR03345852 TIGR03345, VI_ClpV1, type VI secretion ATPase, ClpV1 fa 1e-71
COG1219408 COG1219, ClpX, ATP-dependent protease Clp, ATPase subun 1e-06
TIGR00382413 TIGR00382, clpX, endopeptidase Clp ATP-binding regulato 1e-05
PRK10865857 PRK10865, PRK10865, protein disaggregation chaperone; P 8e-84
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [ 1e-04
COG0714329 COG0714, COG0714, MoxR-like ATPases [General function p 8e-04
KOG1051898 KOG1051, KOG1051, KOG1051, Chaperone HSP104 and related 9e-59
pfam07724168 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) 1e-58
COG5271 4600 COG5271, MDN1, AAA ATPase containing von Willebrand fac 3e-04
pfam1043189 pfam10431, ClpB_D2-small, C-terminal, D2-small domain, 1e-22
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a wide 2e-16
pfam00004131 pfam00004, AAA, ATPase family associated with various c 1e-12
smart00382148 smart00382, AAA, ATPases associated with a variety of c 2e-06
KOG0740428 KOG0740, KOG0740, KOG0740, AAA+-type ATPase [Posttransl 0.001
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a wide 3e-12
smart00382148 smart00382, AAA, ATPases associated with a variety of c 1e-07
KOG2004 906 KOG2004, KOG2004, KOG2004, Mitochondrial ATP-dependent 2e-05
COG0466 782 COG0466, Lon, ATP-dependent Lon protease, bacterial typ 2e-04
TIGR00763 775 TIGR00763, lon, ATP-dependent protease La 2e-04
TIGR02902 531 TIGR02902, spore_lonB, ATP-dependent protease LonB 8e-04
KOG2170344 KOG2170, KOG2170, KOG2170, ATPase of the AAA+ superfami 1e-11
COG0714329 COG0714, COG0714, MoxR-like ATPases [General function p 2e-10
pfam00004131 pfam00004, AAA, ATPase family associated with various c 5e-08
pfam07728139 pfam07728, AAA_5, AAA domain (dynein-related subfamily) 2e-07
KOG0730693 KOG0730, KOG0730, KOG0730, AAA+-type ATPase [Posttransl 2e-07
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslat 5e-07
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily 4e-06
pfam0286153 pfam02861, Clp_N, Clp amino terminal domain 6e-06
KOG0738491 KOG0738, KOG0738, KOG0738, AAA+-type ATPase [Posttransl 2e-04
KOG0733802 KOG0733, KOG0733, KOG0733, Nuclear AAA ATPase (VCP subf 3e-04
KOG0745564 KOG0745, KOG0745, KOG0745, Putative ATP-dependent Clp-t 0.001
>gnl|CDD|162958 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>gnl|CDD|182917 PRK11034, clpA, ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|177027 CHL00095, clpC, Clp protease ATP binding subunit Back     alignment and domain information
>gnl|CDD|30888 COG0542, ClpA, ATPases with chaperone activity, ATP-binding subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|163223 TIGR03346, chaperone_ClpB, ATP-dependent chaperone ClpB Back     alignment and domain information
>gnl|CDD|163222 TIGR03345, VI_ClpV1, type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>gnl|CDD|36269 KOG1051, KOG1051, KOG1051, Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|163223 TIGR03346, chaperone_ClpB, ATP-dependent chaperone ClpB Back     alignment and domain information
>gnl|CDD|182791 PRK10865, PRK10865, protein disaggregation chaperone; Provisional Back     alignment and domain information
>gnl|CDD|163222 TIGR03345, VI_ClpV1, type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>gnl|CDD|31412 COG1219, ClpX, ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|161849 TIGR00382, clpX, endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>gnl|CDD|182791 PRK10865, PRK10865, protein disaggregation chaperone; Provisional Back     alignment and domain information
>gnl|CDD|31416 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|31058 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|36269 KOG1051, KOG1051, KOG1051, Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|116338 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) Back     alignment and domain information
>gnl|CDD|34868 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|151009 pfam10431, ClpB_D2-small, C-terminal, D2-small domain, of ClpB protein Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|143797 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|128665 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|35959 KOG0740, KOG0740, KOG0740, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|128665 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|37215 KOG2004, KOG2004, KOG2004, Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|30814 COG0466, Lon, ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|162028 TIGR00763, lon, ATP-dependent protease La Back     alignment and domain information
>gnl|CDD|131948 TIGR02902, spore_lonB, ATP-dependent protease LonB Back     alignment and domain information
>gnl|CDD|37381 KOG2170, KOG2170, KOG2170, ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|31058 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|143797 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|149019 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|35949 KOG0730, KOG0730, KOG0730, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|30812 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|162267 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|145814 pfam02861, Clp_N, Clp amino terminal domain Back     alignment and domain information
>gnl|CDD|35957 KOG0738, KOG0738, KOG0738, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35952 KOG0733, KOG0733, KOG0733, Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35964 KOG0745, KOG0745, KOG0745, Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 798 ATP-dependent Clp protease ATP-binding subunit [Candida
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 100.0
CHL00095823 clpC Clp protease ATP binding subunit 100.0
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 100.0
PRK10865857 protein disaggregation chaperone; Provisional 100.0
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 100.0
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 100.0
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 100.0
KOG1051898 consensus 100.0
pfam07724168 AAA_2 AAA domain (Cdc48 subfamily). This Pfam entry inc 100.0
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 99.43
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subunit [P 99.32
pfam00004131 AAA ATPase family associated with various cellular acti 99.28
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor type A 99.1
KOG0727408 consensus 98.83
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor type A 98.75
KOG0728404 consensus 98.52
COG1484254 DnaC DNA replication protein [DNA replication, recombin 98.41
KOG0744423 consensus 98.32
KOG0726440 consensus 98.1
KOG0742630 consensus 97.86
KOG0652424 consensus 97.82
KOG3595 1395 consensus 97.69
TIGR00678216 holB DNA polymerase III, delta' subunit; InterPro: IPR0 97.6
pfam01637223 Arch_ATPase Archaeal ATPase. This family contain a cons 97.52
KOG3347176 consensus 96.9
COG1936180 Predicted nucleotide kinase (related to CMP and AMP kin 95.98
TIGR00455187 apsK adenylylsulfate kinase; InterPro: IPR002891 Enzyme 95.55
PRK05342411 clpX ATP-dependent protease ATP-binding subunit ClpX; P 99.97
TIGR00382452 clpX ATP-dependent Clp protease, ATP-binding subunit Cl 99.96
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [Posttr 99.94
PRK05201442 hslU ATP-dependent protease ATP-binding subunit; Provis 99.93
TIGR00390463 hslU heat shock protein HslVU, ATPase subunit HslU; Int 99.67
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subun 99.65
PRK03992390 proteasome-activating nucleotidase; Provisional 99.51
CHL00181287 cbbX CbbX; Provisional 99.43
COG1223368 Predicted ATPase (AAA+ superfamily) [General function p 99.23
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.16
CHL00081347 chlI Mg-protoporyphyrin IX chelatase 99.04
COG3604550 FhlA Transcriptional regulator containing GAF, AAA-type 99.04
TIGR01817574 nifA Nif-specific regulatory protein; InterPro: IPR0101 98.87
COG1241682 MCM2 Predicted ATPase involved in replication control, 98.54
TIGR02974349 phageshock_pspF psp operon transcriptional activator Ps 98.52
PRK00149447 dnaA chromosomal replication initiation protein; Review 98.3
TIGR02880284 cbbX_cfxQ CbbX protein; InterPro: IPR000470 Proteins in 98.23
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 98.09
TIGR02881261 spore_V_K stage V sporulation protein K; InterPro: IPR0 98.05
KOG0478804 consensus 97.94
TIGR01818471 ntrC nitrogen regulation protein NR(I); InterPro: IPR01 97.92
COG0593408 DnaA ATPase involved in DNA replication initiation [DNA 97.76
KOG0482721 consensus 96.0
KOG0730693 consensus 99.91
KOG0733802 consensus 99.9
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 99.77
KOG0735952 consensus 99.73
KOG0736953 consensus 99.7
KOG0745564 consensus 99.9
PRK11331459 5-methylcytosine-specific restriction enzyme subunit Mc 98.35
PRK08903227 hypothetical protein; Validated 98.28
PRK09087226 hypothetical protein; Validated 98.16
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 96.25
TIGR02533495 type_II_gspE general secretory pathway protein E; Inter 95.88
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 99.86
TIGR00763 941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 99.86
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Posttra 99.8
KOG2004 906 consensus 99.65
TIGR01243 980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 99.85
PRK13342417 recombination factor protein RarA; Reviewed 99.77
COG2256436 MGS1 ATPase related to the helicase subunit of the Holl 99.54
TIGR01241505 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: 99.42
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.28
TIGR00635305 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR 99.13
PRK08770663 DNA polymerase III subunits gamma and tau; Validated 98.68
PRK13531498 regulatory ATPase RavA; Provisional 98.51
CHL00195491 ycf46 Ycf46; Provisional 99.76
KOG0741744 consensus 99.72
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational modi 98.97
KOG2170344 consensus 99.7
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 99.58
PRK13342 417 recombination factor protein RarA; Reviewed 99.51
PRK11608325 pspF phage shock protein operon transcriptional activat 99.51
PRK05022510 anaerobic nitric oxide reductase transcription regulato 99.46
PRK11388639 DNA-binding transcriptional regulator DhaR; Provisional 99.45
PRK10820513 DNA-binding transcriptional regulator TyrR; Provisional 99.39
CHL00176 631 ftsH cell division protein; Validated 99.32
COG1221403 PspF Transcriptional regulators containing an AAA-type 99.3
PRK00440318 rfc replication factor C small subunit; Reviewed 99.27
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.25
COG2256 436 MGS1 ATPase related to the helicase subunit of the Holl 99.23
TIGR02902 532 spore_lonB ATP-dependent protease LonB; InterPro: IPR01 99.22
PRK12402337 replication factor C small subunit 2; Reviewed 99.2
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.2
PRK04195 403 replication factor C large subunit; Provisional 99.17
PRK09862506 putative ATP-dependent protease; Provisional 99.07
COG0606490 Predicted ATPase with chaperone activity [Posttranslati 98.89
COG2255332 RuvB Holliday junction resolvasome, helicase subunit [D 98.88
TIGR00635305 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR 98.84
COG3829560 RocR Transcriptional regulator containing PAS, AAA-type 98.83
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 98.79
TIGR02928383 TIGR02928 orc1/cdc6 family replication initiation prote 98.79
pfam00493327 MCM MCM2/3/5 family. 98.77
PRK08116262 hypothetical protein; Validated 98.56
PRK05642234 DNA replication initiation factor; Validated 98.52
TIGR00368505 TIGR00368 Mg chelatase homolog; InterPro: IPR004482 Thi 98.46
COG3284606 AcoR Transcriptional activator of acetoin/glycerol meta 98.44
COG3283511 TyrR Transcriptional regulator of aromatic amino acids 98.35
smart00350509 MCM minichromosome maintenance proteins. 98.31
KOG0989346 consensus 98.3
TIGR02915451 PEP_resp_reg putative PEP-CTERM system response regulat 98.3
PRK08084235 DNA replication initiation factor; Provisional 98.29
PRK12422455 chromosomal replication initiation protein; Provisional 98.16
KOG0743457 consensus 98.07
pfam05673248 DUF815 Protein of unknown function (DUF815). This famil 97.99
KOG0739439 consensus 97.89
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] 97.88
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639 774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 97.74
COG4650531 RtcR Sigma54-dependent transcription regulator containi 97.22
PTZ00112650 origin recognition complex 1 protein; Provisional 96.86
COG2607287 Predicted ATPase (AAA+ superfamily) [General function p 96.09
TIGR02329658 propionate_PrpR propionate catabolism operon regulatory 95.82
KOG0480764 consensus 95.76
PRK13341 726 recombination factor protein RarA/unknown domain fusion 99.69
CHL00181287 cbbX CbbX; Provisional 99.61
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 99.54
PRK12402337 replication factor C small subunit 2; Reviewed 99.4
PRK04195403 replication factor C large subunit; Provisional 99.34
PRK06647560 DNA polymerase III subunits gamma and tau; Validated 99.32
PRK00440318 rfc replication factor C small subunit; Reviewed 99.31
PRK07270557 DNA polymerase III subunits gamma and tau; Validated 99.3
PRK06674563 DNA polymerase III subunits gamma and tau; Validated 99.3
PRK05896613 DNA polymerase III subunits gamma and tau; Validated 99.3
PRK06305462 DNA polymerase III subunits gamma and tau; Validated 99.3
PRK08451523 DNA polymerase III subunits gamma and tau; Validated 99.23
PRK05563541 DNA polymerase III subunits gamma and tau; Validated 99.22
PRK07764 775 DNA polymerase III subunits gamma and tau; Validated 99.19
KOG0740428 consensus 99.18
PRK08853 717 DNA polymerase III subunits gamma and tau; Validated 99.14
PRK07133 718 DNA polymerase III subunits gamma and tau; Validated 99.13
PRK06645507 DNA polymerase III subunits gamma and tau; Validated 99.13
PRK08691 704 DNA polymerase III subunits gamma and tau; Validated 99.06
PRK07994643 DNA polymerase III subunits gamma and tau; Validated 99.05
PRK07003 816 DNA polymerase III subunits gamma and tau; Validated 99.05
pfam05621302 TniB Bacterial TniB protein. This family consists of se 99.02
PRK09111600 DNA polymerase III subunits gamma and tau; Validated 99.01
COG2255332 RuvB Holliday junction resolvasome, helicase subunit [D 98.98
KOG0989346 consensus 98.95
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 98.95
PRK05342411 clpX ATP-dependent protease ATP-binding subunit ClpX; P 98.91
PRK12323 721 DNA polymerase III subunits gamma and tau; Provisional 98.91
pfam01637223 Arch_ATPase Archaeal ATPase. This family contain a cons 98.89
PRK00149447 dnaA chromosomal replication initiation protein; Review 98.81
PRK12422455 chromosomal replication initiation protein; Provisional 98.75
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 98.74
PRK05648 705 DNA polymerase III subunits gamma and tau; Reviewed 98.71
TIGR00763941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 98.7
PRK08084235 DNA replication initiation factor; Provisional 98.64
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA replic 98.63
pfam00308219 Bac_DnaA Bacterial dnaA protein. 98.62
PRK06872696 DNA polymerase III subunits gamma and tau; Provisional 98.62
PRK05642234 DNA replication initiation factor; Validated 98.55
PRK05564313 DNA polymerase III subunit delta'; Validated 98.55
TIGR02397363 dnaX_nterm DNA polymerase III, subunits gamma and tau; 98.53
PRK08769319 DNA polymerase III subunit delta'; Validated 98.47
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Posttra 98.45
COG0470325 HolB ATPase involved in DNA replication [DNA replicatio 98.38
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [Posttr 98.33
KOG2004906 consensus 98.32
PRK09112352 DNA polymerase III subunit delta'; Validated 98.25
PRK07399314 DNA polymerase III subunit delta'; Validated 98.2
PRK07471363 DNA polymerase III subunit delta'; Validated 98.17
pfam00493327 MCM MCM2/3/5 family. 98.15
KOG1969877 consensus 98.14
PRK11388639 DNA-binding transcriptional regulator DhaR; Provisional 98.09
PRK10820513 DNA-binding transcriptional regulator TyrR; Provisional 98.0
TIGR02881261 spore_V_K stage V sporulation protein K; InterPro: IPR0 97.99
PRK00131175 aroK shikimate kinase; Reviewed 97.91
PRK05707328 DNA polymerase III subunit delta'; Validated 97.91
smart00350509 MCM minichromosome maintenance proteins. 97.86
KOG0991333 consensus 97.86
PRK05057172 aroK shikimate kinase I; Reviewed 97.8
PRK06871324 DNA polymerase III subunit delta'; Validated 97.69
PRK10365441 transcriptional regulatory protein ZraR; Provisional 97.61
PRK08058329 DNA polymerase III subunit delta'; Validated 97.53
PRK13406584 bchD magnesium chelatase subunit D; Provisional 97.47
PRK07993334 DNA polymerase III subunit delta'; Validated 97.46
TIGR02442688 Cob-chelat-sub cobaltochelatase subunit; InterPro: IPR0 97.39
COG3829560 RocR Transcriptional regulator containing PAS, AAA-type 97.24
PRK06090319 DNA polymerase III subunit delta'; Validated 97.21
TIGR02640265 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR0 97.0
KOG2227529 consensus 96.92
KOG2035351 consensus 96.74
PRK11823454 DNA repair protein RadA; Provisional 96.63
TIGR01818471 ntrC nitrogen regulation protein NR(I); InterPro: IPR01 96.49
PRK05917290 DNA polymerase III subunit delta'; Validated 96.29
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This prote 96.26
COG1373398 Predicted ATPase (AAA+ superfamily) [General function p 96.01
COG1066456 Sms Predicted ATP-dependent serine protease [Posttransl 95.81
PRK10923469 glnG nitrogen regulation protein NR(I); Provisional 99.68
PRK11361457 acetoacetate metabolism regulatory protein AtoC; Provis 99.66
PRK10365441 transcriptional regulatory protein ZraR; Provisional 99.62
COG2204464 AtoC Response regulator containing CheY-like receiver, 99.49
pfam1043189 ClpB_D2-small C-terminal, D2-small domain, of ClpB prot 99.62
PRK03992390 proteasome-activating nucleotidase; Provisional 99.6
CHL00195491 ycf46 Ycf46; Provisional 99.6
CHL00176631 ftsH cell division protein; Validated 99.53
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 99.52
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 99.39
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.32
KOG0738491 consensus 99.2
KOG0730693 consensus 99.16
TIGR02903616 spore_lon_C ATP-dependent protease, Lon family; InterPr 99.15
TIGR02902532 spore_lonB ATP-dependent protease LonB; InterPro: IPR01 99.11
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subunit [P 99.09
TIGR01242364 26Sp45 26S proteasome subunit P45 family; InterPro: IPR 99.02
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 99.01
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 98.83
COG1223368 Predicted ATPase (AAA+ superfamily) [General function p 98.8
PRK13407334 bchI magnesium chelatase subunit I; Provisional 98.73
COG0593408 DnaA ATPase involved in DNA replication initiation [DNA 98.65
CHL00081347 chlI Mg-protoporyphyrin IX chelatase 98.64
KOG0728404 consensus 98.46
PRK08727233 hypothetical protein; Validated 98.41
KOG0727408 consensus 97.78
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] 97.37
PRK09087226 hypothetical protein; Validated 97.17
KOG1514767 consensus 96.57
pfam07728139 AAA_5 AAA domain (dynein-related subfamily). This Pfam 99.57
pfam07726131 AAA_3 ATPase family associated with various cellular ac 99.33
KOG0736 953 consensus 99.11
smart00382148 AAA ATPases associated with a variety of cellular activ 98.73
KOG0735 952 consensus 98.69
PRK09183258 transposase/IS protein; Provisional 98.42
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 98.32
PRK06526254 transposase; Provisional 97.94
PRK08181269 transposase; Validated 97.89
PRK06871324 DNA polymerase III subunit delta'; Validated 97.57
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 97.56
pfam00910105 RNA_helicase RNA helicase. This family includes RNA hel 97.53
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 97.53
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.42
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 97.36
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucleotide 97.35
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway is th 97.1
PRK06090319 DNA polymerase III subunit delta'; Validated 97.03
PRK13900332 type IV secretion system ATPase VirB11; Provisional 97.0
PRK05707328 DNA polymerase III subunit delta'; Validated 96.99
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 96.93
PRK07993334 DNA polymerase III subunit delta'; Validated 96.93
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pilus a 96.75
COG1485367 Predicted ATPase [General function prediction only] 96.72
PRK10436461 hypothetical protein; Provisional 96.55
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 96.28
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 96.2
PRK13851343 type IV secretion system protein VirB11; Provisional 95.93
CHL00026 2286 ycf2 Ycf2 95.6
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 95.59
COG0714329 MoxR-like ATPases [General function prediction only] 99.47
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 99.32
TIGR02640265 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR0 99.24
TIGR02397363 dnaX_nterm DNA polymerase III, subunits gamma and tau; 99.06
PRK06305 462 DNA polymerase III subunits gamma and tau; Validated 98.97
KOG0731 774 consensus 98.94
PRK08451 523 DNA polymerase III subunits gamma and tau; Validated 98.9
PRK06645 507 DNA polymerase III subunits gamma and tau; Validated 98.87
PRK06647 560 DNA polymerase III subunits gamma and tau; Validated 98.84
PRK05896 613 DNA polymerase III subunits gamma and tau; Validated 98.8
TIGR01242364 26Sp45 26S proteasome subunit P45 family; InterPro: IPR 98.75
PRK12377248 putative replication protein; Provisional 98.63
PRK07764 775 DNA polymerase III subunits gamma and tau; Validated 98.63
KOG0738491 consensus 98.58
PRK13531 498 regulatory ATPase RavA; Provisional 98.43
PRK07952242 DNA replication protein DnaC; Validated 98.4
PRK06835330 DNA replication protein DnaC; Validated 98.21
PRK08769319 DNA polymerase III subunit delta'; Validated 98.18
COG0470325 HolB ATPase involved in DNA replication [DNA replicatio 98.15
KOG0740428 consensus 98.11
KOG0729435 consensus 98.09
PRK08939306 primosomal protein DnaI; Reviewed 98.07
PRK05917290 DNA polymerase III subunit delta'; Validated 98.0
KOG0651388 consensus 97.71
PRK07276290 DNA polymerase III subunit delta'; Validated 97.69
PRK07132303 DNA polymerase III subunit delta'; Validated 97.22
KOG0991333 consensus 96.24
pfam00931285 NB-ARC NB-ARC domain. 96.24
KOG1808 1856 consensus 96.18
KOG0477854 consensus 95.94
TIGR02903 616 spore_lon_C ATP-dependent protease, Lon family; InterPr 99.46
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 99.43
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 99.38
PRK10865 857 protein disaggregation chaperone; Provisional 99.33
CHL00095 823 clpC Clp protease ATP binding subunit 99.27
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 99.09
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 99.04
pfam0286153 Clp_N Clp amino terminal domain. This short domain is f 97.62
PRK13341726 recombination factor protein RarA/unknown domain fusion 99.41
pfam00004131 AAA ATPase family associated with various cellular acti 99.35
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 99.19
KOG0731774 consensus 99.02
COG0714329 MoxR-like ATPases [General function prediction only] 98.93
KOG0739439 consensus 98.79
KOG0737386 consensus 98.76
KOG0733802 consensus 98.76
pfam07728139 AAA_5 AAA domain (dynein-related subfamily). This Pfam 98.64
KOG0732 1080 consensus 98.6
KOG0729435 consensus 98.58
KOG0651388 consensus 98.4
pfam07726131 AAA_3 ATPase family associated with various cellular ac 98.39
smart00382148 AAA ATPases associated with a variety of cellular activ 98.37
KOG0726440 consensus 98.24
pfam01078207 Mg_chelatase Magnesium chelatase, subunit ChlI. Magnesi 98.19
PRK11331459 5-methylcytosine-specific restriction enzyme subunit Mc 98.18
COG3854308 SpoIIIAA ncharacterized protein conserved in bacteria [ 98.17
PRK09183258 transposase/IS protein; Provisional 98.08
KOG0652424 consensus 98.01
COG1484254 DnaC DNA replication protein [DNA replication, recombin 97.96
PRK12377248 putative replication protein; Provisional 97.96
PRK06964342 DNA polymerase III subunit delta'; Validated 97.94
pfam00158168 Sigma54_activat Sigma-54 interaction domain. 97.93
PRK09862506 putative ATP-dependent protease; Provisional 97.89
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 97.84
COG2204464 AtoC Response regulator containing CheY-like receiver, 97.64
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 97.62
PRK08116262 hypothetical protein; Validated 97.6
KOG1970634 consensus 97.59
PRK05022510 anaerobic nitric oxide reductase transcription regulato 97.55
pfam03266168 DUF265 Protein of unknown function, DUF265. 97.52
KOG0744423 consensus 97.47
KOG0743457 consensus 97.3
TIGR02915451 PEP_resp_reg putative PEP-CTERM system response regulat 97.27
COG0606490 Predicted ATPase with chaperone activity [Posttranslati 97.22
pfam03969361 AFG1_ATPase AFG1-like ATPase. This family of proteins c 97.19
PRK07940395 DNA polymerase III subunit delta'; Validated 97.17
TIGR02858282 spore_III_AA stage III sporulation protein AA; InterPro 97.1
pfam00931285 NB-ARC NB-ARC domain. 97.09
PRK13947171 shikimate kinase; Provisional 97.03
PRK13695174 putative NTPase; Provisional 97.03
PRK06835330 DNA replication protein DnaC; Validated 96.94
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombinatio 96.86
TIGR00678216 holB DNA polymerase III, delta' subunit; InterPro: IPR0 96.67
PRK08939306 primosomal protein DnaI; Reviewed 96.57
cd03227162 ABC_Class2 ABC-type Class 2 contains systems involved i 96.05
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily conserv 95.85
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The MutS 95.8
COG3604550 FhlA Transcriptional regulator containing GAF, AAA-type 95.64
KOG2028554 consensus 99.28
pfam01078207 Mg_chelatase Magnesium chelatase, subunit ChlI. Magnesi 99.27
PRK07940395 DNA polymerase III subunit delta'; Validated 99.27
pfam00158168 Sigma54_activat Sigma-54 interaction domain. 99.26
PRK09112352 DNA polymerase III subunit delta'; Validated 99.24
PRK07471363 DNA polymerase III subunit delta'; Validated 99.19
PRK05564313 DNA polymerase III subunit delta'; Validated 99.18
PRK07399314 DNA polymerase III subunit delta'; Validated 99.07
TIGR01241 505 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: 99.0
PTZ00111 916 DNA replication licensing factor MCM4; Provisional 97.67
TIGR02928383 TIGR02928 orc1/cdc6 family replication initiation prote 99.26
PTZ00112650 origin recognition complex 1 protein; Provisional 97.29
PRK05563541 DNA polymerase III subunits gamma and tau; Validated 99.04
PRK07270557 DNA polymerase III subunits gamma and tau; Validated 98.98
PRK06674563 DNA polymerase III subunits gamma and tau; Validated 98.87
PRK08691704 DNA polymerase III subunits gamma and tau; Validated 98.81
PRK07133718 DNA polymerase III subunits gamma and tau; Validated 98.8
PRK05648705 DNA polymerase III subunits gamma and tau; Reviewed 98.65
PRK08770663 DNA polymerase III subunits gamma and tau; Validated 98.6
PRK07994643 DNA polymerase III subunits gamma and tau; Validated 98.58
PRK12323721 DNA polymerase III subunits gamma and tau; Provisional 98.56
PRK09111600 DNA polymerase III subunits gamma and tau; Validated 98.53
PRK06872696 DNA polymerase III subunits gamma and tau; Provisional 98.53
KOG0734752 consensus 98.97
pfam05673248 DUF815 Protein of unknown function (DUF815). This famil 98.57
PRK10923469 glnG nitrogen regulation protein NR(I); Provisional 98.27
PRK11608325 pspF phage shock protein operon transcriptional activat 98.21
PRK11361457 acetoacetate metabolism regulatory protein AtoC; Provis 98.12
COG2607287 Predicted ATPase (AAA+ superfamily) [General function p 98.06
COG1221403 PspF Transcriptional regulators containing an AAA-type 97.92
PRK13946195 shikimate kinase; Provisional 97.66
KOG0742630 consensus 97.65
PRK03731172 aroL shikimate kinase II; Reviewed 97.31
TIGR02880284 cbbX_cfxQ CbbX protein; InterPro: IPR000470 Proteins in 97.27
PRK13948182 shikimate kinase; Provisional 96.86
COG0703172 AroK Shikimate kinase [Amino acid transport and metabol 96.77
TIGR02782315 TrbB_P P-type conjugative transfer ATPase TrbB; InterPr 95.91
PRK08058329 DNA polymerase III subunit delta'; Validated 98.93
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA replic 97.54
PRK06696227 uridine kinase; Validated 96.62
pfam02562205 PhoH PhoH-like protein. PhoH is a cytoplasmic protein a 96.2
PRK04220306 2-phosphoglycerate kinase; Provisional 95.9
pfam06414191 Zeta_toxin Zeta toxin. This family consists of several 95.57
PRK08853717 DNA polymerase III subunits gamma and tau; Validated 98.9
PRK07003816 DNA polymerase III subunits gamma and tau; Validated 98.88
pfam06068395 TIP49 TIP49 C-terminus. This family consists of the C-t 98.79
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein [Tran 98.48
pfam08298358 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 98.35
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 98.01
pfam07693301 KAP_NTPase KAP family P-loop domain. The KAP (after Kid 97.01
KOG1942456 consensus 95.83
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 98.78
pfam00308219 Bac_DnaA Bacterial dnaA protein. 98.72
PRK08727233 hypothetical protein; Validated 98.42
PRK06893229 DNA replication initiation factor; Validated 98.28
PHA02244383 ATPase-like protein 98.0
PRK06620214 hypothetical protein; Validated 97.7
KOG1514767 consensus 97.41
KOG1969 877 consensus 96.95
pfam06309127 Torsin Torsin. This family consists of several eukaryot 98.72
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational modi 98.4
KOG0734 752 consensus 98.35
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 97.27
pfam05621302 TniB Bacterial TniB protein. This family consists of se 95.81
KOG2028 554 consensus 98.64
KOG0737386 consensus 98.62
PRK13765637 ATP-dependent protease Lon; Provisional 98.58
PRK08903227 hypothetical protein; Validated 98.56
PRK06893229 DNA replication initiation factor; Validated 98.31
PRK13765637 ATP-dependent protease Lon; Provisional 98.55
PRK04132 863 replication factor C small subunit; Provisional 98.5
COG3899 849 Predicted ATPase [General function prediction only] 97.69
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 96.98
PRK00091304 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 96.3
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are memb 96.11
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 95.92
PTZ00133182 ADP-ribosylation factor; Provisional 95.86
pfam00025174 Arf ADP-ribosylation factor family. Pfam combines a num 95.85
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) and Ar 95.83
PRK13833323 conjugal transfer protein TrbB; Provisional 95.58
TIGR01243980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 98.52
PRK08181269 transposase; Validated 98.5
PRK06526254 transposase; Provisional 98.41
PRK05201442 hslU ATP-dependent protease ATP-binding subunit; Provis 98.4
TIGR00382452 clpX ATP-dependent Clp protease, ATP-binding subunit Cl 98.38
KOG0745564 consensus 97.9
PRK06921265 hypothetical protein; Provisional 97.19
PRK07952242 DNA replication protein DnaC; Validated 96.33
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. subt 96.16
PRK13949169 shikimate kinase; Provisional 96.13
pfam04851103 ResIII Type III restriction enzyme, res subunit. 95.82
TIGR00174307 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 95.78
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase 95.71
PRK03839180 putative kinase; Provisional 95.63
PRK07132303 DNA polymerase III subunit delta'; Validated 98.39
pfam0286153 Clp_N Clp amino terminal domain. This short domain is f 98.28
KOG1051898 consensus 97.61
pfam03215490 Rad17 Rad17 cell cycle checkpoint protein. 98.25
TIGR00368505 TIGR00368 Mg chelatase homolog; InterPro: IPR004482 Thi 96.6
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein [Tran 98.23
pfam06068395 TIP49 TIP49 C-terminus. This family consists of the C-t 97.94
PRK08699325 DNA polymerase III subunit delta'; Validated 97.85
PRK13894320 conjugal transfer ATPase TrbB; Provisional 96.69
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a subfamil 96.45
PRK00771433 signal recognition particle protein Srp54; Provisional 96.32
PRK10867453 signal recognition particle protein; Provisional 96.25
cd03115173 SRP The signal recognition particle (SRP) mediates the 96.11
pfam01745232 IPT Isopentenyl transferase. Isopentenyl transferase / 96.06
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.05
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.95
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 95.92
KOG0055 1228 consensus 95.8
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.67
pfam00625182 Guanylate_kin Guanylate kinase. 95.58
KOG0732 1080 consensus 98.17
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.84
KOG1808 1856 consensus 97.74
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 97.59
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 97.52
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 97.47
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 96.93
KOG00551228 consensus 96.92
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 96.68
TIGR01846703 type_I_sec_HlyB type I secretion system ATPase; InterPr 96.67
cd03246173 ABCC_Protease_Secretion This family represents the ABC 96.48
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 96.32
TIGR00958770 3a01208 antigen peptide transporter 2; InterPro: IPR005 96.09
TIGR02538577 type_IV_pilB type IV-A pilus assembly ATPase PilB; Inte 95.58
pfam07724168 AAA_2 AAA domain (Cdc48 subfamily). This Pfam entry inc 98.08
PRK06921265 hypothetical protein; Provisional 97.65
cd03115173 SRP The signal recognition particle (SRP) mediates the 97.28
KOG0741 744 consensus 97.02
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 97.01
TIGR01842556 type_I_sec_PrtD type I secretion system ATPase; InterPr 96.94
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleotide e 96.88
smart00487201 DEXDc DEAD-like helicases superfamily. 96.66
PRK10938490 putative molybdenum transport ATP-binding protein ModF; 96.62
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 96.59
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 96.57
PRK03846198 adenylylsulfate kinase; Provisional 96.24