254780164

254780164

ATP-dependent Clp protease adaptor protein ClpS

GeneID in NCBI database:8209141Locus tag:CLIBASIA_00235
Protein GI in NCBI database:254780164Protein Accession:YP_003064577.1
Gene range:-(47543, 47959)Protein Length:138aa
Gene description:ATP-dependent Clp protease adaptor protein ClpS
COG prediction:[S] Uncharacterized conserved protein
KEGG prediction:ATP-dependent Clp protease adaptor protein ClpS; K06891 ATP-dependent Clp protease adaptor protein ClpS
SEED prediction:ATP-dependent Clp protease adaptor protein ClpS
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Proteolysis in bacteria, ATP-dependent
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MYLFDDGSMYHRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK
cEEEEccHHHHHHccccHHHHHHHHHHcccccccccccccccccccccccHHHccccccEEEEEEccccccHHHHHHHHHHHHcccHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHHHcccccEEEEEEcc
ccHHHHHccHccccccccHHHHHHHcHHHHHcccccccccccccEEEEEcccccccccEEEEEEEccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHcEEEEEEEEHHHHHHHHHHHHHHHHHcccccEEEEEEc
mylfddgsmyhrVKRDGILALMSFIFMADSRmnkkgiaefdncldsevrfsskvrvpKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMnysrqhqyplqcimeqk
mylfddgsmyhrVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDsevrfsskvrvpklyRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHqyplqcimeqk
MYLFDDGSMYHRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK
*YL****SMYH***********************************************LYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIME**
MYLFDDGSMYHRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK
MYLFDDGSMYHRVKRDGILALMSFIFMADSRMNKKGIAE*DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYLFDDGSMYHRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK
MYLFDDGSMYHRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK
MYLFDDGSMYHRVKRDGILALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target138 ATP-dependent Clp protease adaptor protein ClpS [Candid
315122668120 ATP-dependent Clp protease adaptor protein ClpS [Candid 1 5e-49
298291485123 ATP-dependent Clp protease adaptor protein ClpS [Starke 1 4e-31
209884899179 ATP-dependent Clp protease adaptor protein ClpS [Oligot 1 4e-31
110633725133 ATP-dependent Clp protease adaptor protein ClpS [Mesorh 1 5e-31
241204496118 ATP-dependent Clp protease adaptor protein ClpS [Rhizob 1 1e-30
150396335117 ATP-dependent Clp protease adaptor protein ClpS [Sinorh 1 1e-30
190891596117 ATP-dependent Clp protease adaptor protein [Rhizobium e 1 2e-30
86357527117 ATP-dependent Clp protease adaptor protein ClpS [Rhizob 1 2e-30
116251968109 ATP-dependent Clp protease adaptor protein ClpS [Rhizob 1 2e-30
209549170116 ATP-dependent Clp protease adaptor protein ClpS [Rhizob 1 2e-30
>gi|315122668|ref|YP_004063157.1| ATP-dependent Clp protease adaptor protein ClpS [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 120 Back     alignment and organism information
 Score =  197 bits (500), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 107/120 (89%)

Query: 19  LALMSFIFMADSRMNKKGIAEFDNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHV 78
           +  +SF+FMA + MN+KG+A  D+C++++   SSKVR P+LYRVLLVND+YTPMEFVIHV
Sbjct: 1   MVAISFVFMAKNHMNEKGVARTDSCINTKEEISSKVRAPRLYRVLLVNDDYTPMEFVIHV 60

Query: 79  LQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQCIMEQK 138
           LQ FF+KDHE++K IMLK+HHQGIGECGVYAYEIAEMKVNQVMNYSRQ+Q+PLQCIME K
Sbjct: 61  LQKFFHKDHESSKSIMLKIHHQGIGECGVYAYEIAEMKVNQVMNYSRQNQHPLQCIMEHK 120


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|298291485|ref|YP_003693424.1| ATP-dependent Clp protease adaptor protein ClpS [Starkeya novella DSM 506] Length = 123 Back     alignment and organism information
>gi|209884899|ref|YP_002288756.1| ATP-dependent Clp protease adaptor protein ClpS [Oligotropha carboxidovorans OM5] Length = 179 Back     alignment and organism information
>gi|110633725|ref|YP_673933.1| ATP-dependent Clp protease adaptor protein ClpS [Mesorhizobium sp. BNC1] Length = 133 Back     alignment and organism information
>gi|241204496|ref|YP_002975592.1| ATP-dependent Clp protease adaptor protein ClpS [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 118 Back     alignment and organism information
>gi|150396335|ref|YP_001326802.1| ATP-dependent Clp protease adaptor protein ClpS [Sinorhizobium medicae WSM419] Length = 117 Back     alignment and organism information
>gi|190891596|ref|YP_001978138.1| ATP-dependent Clp protease adaptor protein [Rhizobium etli CIAT 652] Length = 117 Back     alignment and organism information
>gi|86357527|ref|YP_469419.1| ATP-dependent Clp protease adaptor protein ClpS [Rhizobium etli CFN 42] Length = 117 Back     alignment and organism information
>gi|116251968|ref|YP_767806.1| ATP-dependent Clp protease adaptor protein ClpS [Rhizobium leguminosarum bv. viciae 3841] Length = 109 Back     alignment and organism information
>gi|209549170|ref|YP_002281087.1| ATP-dependent Clp protease adaptor protein ClpS [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 116 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target138 ATP-dependent Clp protease adaptor protein ClpS [Candid
PRK00033100 PRK00033, clpS, ATP-dependent Clp protease adaptor prot 8e-26
pfam0261778 pfam02617, ClpS, ATP-dependent Clp protease adaptor pro 6e-24
PRK1301994 PRK13019, clpS, ATP-dependent Clp protease adaptor; Rev 2e-09
COG2127107 COG2127, COG2127, Uncharacterized conserved protein [Fu 1e-27
>gnl|CDD|178809 PRK00033, clpS, ATP-dependent Clp protease adaptor protein ClpS; Reviewed Back     alignment and domain information
>gnl|CDD|145654 pfam02617, ClpS, ATP-dependent Clp protease adaptor protein ClpS Back     alignment and domain information
>gnl|CDD|183845 PRK13019, clpS, ATP-dependent Clp protease adaptor; Reviewed Back     alignment and domain information
>gnl|CDD|32310 COG2127, COG2127, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 138 ATP-dependent Clp protease adaptor protein ClpS [Candid
COG2127107 Uncharacterized conserved protein [Function unknown] 100.0
PRK0003383 clpS ATP-dependent Clp protease adaptor protein ClpS; R 99.97
PRK1301996 clpS ATP-dependent Clp protease adaptor; Reviewed 99.96
pfam0261778 ClpS ATP-dependent Clp protease adaptor protein ClpS. I 99.95
>COG2127 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK00033 clpS ATP-dependent Clp protease adaptor protein ClpS; Reviewed Back     alignment and domain information
>PRK13019 clpS ATP-dependent Clp protease adaptor; Reviewed Back     alignment and domain information
>pfam02617 ClpS ATP-dependent Clp protease adaptor protein ClpS Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target138 ATP-dependent Clp protease adaptor protein ClpS [Candid
3dnj_A85 The Structure Of The Caulobacter Crescentus Clps Pr 4e-32
3g1b_A85 The Structure Of The M53a Mutant Of Caulobacter Cre 1e-31
2w9r_A108 Structural Basis Of N-End Rule Substrate Recognitio 1e-30
2wa8_A107 Structural Basis Of N-End Rule Substrate Recognitio 2e-30
1mbu_C106 Crystal Structure Analysis Of Clpsn Heterodimer Len 3e-30
1lzw_A106 Structural Basis Of Clps-Mediated Switch In Clpa Su 1e-28
>gi|213424208|pdb|3DNJ|A Chain A, The Structure Of The Caulobacter Crescentus Clps Protease Adaptor Protein In Complex With A N-End Rule Peptide Length = 85 Back     alignment and structure
 Score =  141 bits (355), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 50/85 (58%), Positives = 65/85 (76%)

Query: 54  VRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIA 113
            + P LYRVL++ND+YTPMEFV++VL+ FF K  E A  IML VH  G+G CGVY YE+A
Sbjct: 1   TQKPSLYRVLILNDDYTPMEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCGVYTYEVA 60

Query: 114 EMKVNQVMNYSRQHQYPLQCIMEQK 138
           E KV QV++ +R+HQ+PLQC ME+ 
Sbjct: 61  ETKVAQVIDSARRHQHPLQCTMEKD 85


>gi|228312133|pdb|3G1B|A Chain A, The Structure Of The M53a Mutant Of Caulobacter Crescentus Clps Protease Adaptor Protein In Complex With Wlfvqrdske Peptide Length = 85 Back     alignment and structure
>gi|228311827|pdb|2W9R|A Chain A, Structural Basis Of N-End Rule Substrate Recognition In Escherichia Coli By The Clpap Adaptor Protein Clps Length = 108 Back     alignment and structure
>gi|228311830|pdb|2WA8|A Chain A, Structural Basis Of N-End Rule Substrate Recognition In Escherichia Coli By The Clpap Adaptor Protein Clps - The Phe Peptide Structure Length = 107 Back     alignment and structure
gi|27573865|pdb|1MBU|C Chain C, Crystal Structure Analysis Of Clpsn Heterodimer Length = 106 Back     alignment and structure
>gi|27065491|pdb|1LZW|A Chain A, Structural Basis Of Clps-Mediated Switch In Clpa Substrate Recognition Length = 106 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target138 ATP-dependent Clp protease adaptor protein ClpS [Candid
3dnj_A85 ATP-dependent CLP protease adapter protein CLPS; adapto 2e-29
2w9r_A108 YLJA, ATP-dependent CLP protease adapter protein CLPS; 3e-28
>3dnj_A ATP-dependent CLP protease adapter protein CLPS; adaptor, protein-peptide complex, peptide binding protein; 1.15A {Caulobacter vibrioides} PDB: 3g19_A 3gq0_A 3gq1_A 3gw1_A 3g1b_A Length = 85 Back     alignment and structure
 Score =  122 bits (309), Expect = 2e-29
 Identities = 50/81 (61%), Positives = 64/81 (79%)

Query: 57  PKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMK 116
           P LYRVL++ND+YTPMEFV++VL+ FF K  E A  IML VH  G+G CGVY YE+AE K
Sbjct: 4   PSLYRVLILNDDYTPMEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCGVYTYEVAETK 63

Query: 117 VNQVMNYSRQHQYPLQCIMEQ 137
           V QV++ +R+HQ+PLQC ME+
Sbjct: 64  VAQVIDSARRHQHPLQCTMEK 84


>2w9r_A YLJA, ATP-dependent CLP protease adapter protein CLPS; chaperone, adaptor protein, DNA condensation, iron, CLPS, CLPA, cytoplasm, N-END RULE; HET: DNA; 1.70A {Escherichia coli} PDB: 2wa9_A 1mbx_C* 1mbv_B 1mbu_C* 1r6o_C* 1r6q_C* 2wa8_A 1mg9_A* 1lzw_A* Length = 108 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target138 ATP-dependent Clp protease adaptor protein ClpS [Candid
2w9r_A108 YLJA, ATP-dependent CLP protease adapter protein CLPS; 100.0
3dnj_A85 ATP-dependent CLP protease adapter protein CLPS; adapto 100.0
>2w9r_A YLJA, ATP-dependent CLP protease adapter protein CLPS; chaperone, adaptor protein, DNA condensation, iron, CLPS, CLPA, cytoplasm, N-END RULE; HET: DNA; 1.70A {Escherichia coli} PDB: 2wa9_A 1mbx_C* 1mbv_B 1mbu_C* 1r6o_C* 1r6q_C* 2wa8_A 1mg9_A* 1lzw_A* Back     alignment and structure
Probab=100.00  E-value=3.4e-35  Score=220.60  Aligned_cols=98  Identities=47%  Similarity=0.768  Sum_probs=91.8

Q ss_pred             CCCCCHHHHHHHCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHH
Q ss_conf             65321010001002689974899971898848999999999829998999999999823796899963899999999999
Q gi|254780164|r   41 DNCLDSEVRFSSKVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQV  120 (138)
Q Consensus        41 d~~~~~~~~~~~k~k~P~~YkVIL~NDd~ttmefVi~vL~~vf~~~~e~A~~iml~vH~~G~avvgv~~~E~AE~k~~qv  120 (138)
                      |.+...+.+.+.++++||+|+|||||||+|||||||.+|++||+++.++|.++|++||++|+|+||+|++|+||+|+.++
T Consensus         9 ~~~~~~~e~~~~~~k~p~~y~ViL~NDd~~t~e~Vi~~L~~v~~~s~~~A~~~~~~vh~~G~avv~~~~~E~AE~k~~~~   88 (108)
T 2w9r_A            9 DFDQLAEEKVRDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKAICGVFTAEVAETKVAMV   88 (108)
T ss_dssp             ---CHHHHHHHHTCCCCCEEEEEEECCSSSBHHHHHHHHHHHHCCCHHHHHHHHHHHHHHSEEEEEEEEHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEEEECHHHHHHHHHHH
T ss_conf             52021366766413799853899977999989999999999959999999999999844698899997799999999999


Q ss_pred             HHHHHHCCCCEEEEEECC
Q ss_conf             999997599817986119
Q gi|254780164|r  121 MNYSRQHQYPLQCIMEQK  138 (138)
Q Consensus       121 ~~~Ar~~~~PL~~~iE~e  138 (138)
                      +++||.+||||+|+||+.
T Consensus        89 ~~~ar~~g~PL~~tiE~a  106 (108)
T 2w9r_A           89 NKYARENEHPLLCTLEKA  106 (108)
T ss_dssp             HHHHHHTTCCCEEEEEEC
T ss_pred             HHHHHHCCCCCEEEEEEC
T ss_conf             999997399818999858



>3dnj_A ATP-dependent CLP protease adapter protein CLPS; adaptor, protein-peptide complex, peptide binding protein; 1.15A {Caulobacter vibrioides} PDB: 3g19_A 3gq0_A 3gq1_A 3gw1_A 3g1b_A 3g3p_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 138 ATP-dependent Clp protease adaptor protein ClpS [Candid
d1r6oc187 d.45.1.2 (C:20-106) Adaptor protein ClpS (YljA) {Escher 7e-29
>d1r6oc1 d.45.1.2 (C:20-106) Adaptor protein ClpS (YljA) {Escherichia coli [TaxId: 562]} Length = 87 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: ClpS-like
superfamily: ClpS-like
family: Adaptor protein ClpS (YljA)
domain: Adaptor protein ClpS (YljA)
species: Escherichia coli [TaxId: 562]
 Score =  119 bits (301), Expect = 7e-29
 Identities = 44/85 (51%), Positives = 61/85 (71%)

Query: 53  KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEI 112
            ++ P +Y+V+LVND+YTPMEFVI VLQ FF  D E A  +ML VH+QG   CGV+  E+
Sbjct: 2   ALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKAICGVFTAEV 61

Query: 113 AEMKVNQVMNYSRQHQYPLQCIMEQ 137
           AE KV  V  Y+R++++PL C +E+
Sbjct: 62  AETKVAMVNKYARENEHPLLCTLEK 86


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target138 ATP-dependent Clp protease adaptor protein ClpS [Candid
d1r6oc187 Adaptor protein ClpS (YljA) {Escherichia coli [TaxId: 5 100.0
>d1r6oc1 d.45.1.2 (C:20-106) Adaptor protein ClpS (YljA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: ClpS-like
superfamily: ClpS-like
family: Adaptor protein ClpS (YljA)
domain: Adaptor protein ClpS (YljA)
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=4.7e-35  Score=218.44  Aligned_cols=85  Identities=52%  Similarity=0.891  Sum_probs=83.7

Q ss_pred             CCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHCCCCEE
Q ss_conf             02689974899971898848999999999829998999999999823796899963899999999999999997599817
Q gi|254780164|r   53 KVRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQ  132 (138)
Q Consensus        53 k~k~P~~YkVIL~NDd~ttmefVi~vL~~vf~~~~e~A~~iml~vH~~G~avvgv~~~E~AE~k~~qv~~~Ar~~~~PL~  132 (138)
                      ++|+||+|+|||||||+|||||||.+|+++|+++.++|.++|++||++|+|+||+|++|+||+|+.|++++||++||||+
T Consensus         2 ~lk~P~~y~ViL~NDd~~t~e~Vi~~L~~v~~~~~~~A~~~~~~vH~~G~avv~~~~~E~AE~k~~~~~~~ar~~g~PL~   81 (87)
T d1r6oc1           2 ALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKAICGVFTAEVAETKVAMVNKYARENEHPLL   81 (87)
T ss_dssp             CCCCCCEEEEEEECCSSSCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHSEEEEEEEEHHHHHHHHHHHHHHHHHTTCCCE
T ss_pred             CCCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCEEEEEECHHHHHHHHHHHHHHHHHCCCCCE
T ss_conf             87889843899987999978999999999979599999999999555893899996699999999999999997399936


Q ss_pred             EEEEC
Q ss_conf             98611
Q gi|254780164|r  133 CIMEQ  137 (138)
Q Consensus       133 ~~iE~  137 (138)
                      |++|+
T Consensus        82 ~t~E~   86 (87)
T d1r6oc1          82 CTLEK   86 (87)
T ss_dssp             EEEEE
T ss_pred             EEEEE
T ss_conf             99876



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 138 ATP-dependent Clp protease adaptor protein ClpS [C
2w9r_A_24-10885 (A:24-108) YLJA, ATP-dependent CLP protease adapte 3e-26
3dnj_A_85 (A:) ATP-dependent CLP protease adapter protein CL 1e-25
>2w9r_A (A:24-108) YLJA, ATP-dependent CLP protease adapter protein CLPS; chaperone, adaptor protein, DNA condensation, iron, CLPS, CLPA, cytoplasm, N-END RULE; HET: DNA; 1.70A {Escherichia coli} PDB: 2wa9_A 1mbx_C* 1mbv_B 1mbu_C* 1r6o_C* 1r6q_C* 2wa8_A 1mg9_A* 1lzw_A*Length = 85 Back     alignment and structure
 Score =  111 bits (280), Expect = 3e-26
 Identities = 44/81 (54%), Positives = 59/81 (72%)

Query: 57  PKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMK 116
           P +Y+V+LVND+YTPMEFVI VLQ FF  D E A  +ML VH+QG   CGV+  E+AE K
Sbjct: 2   PSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKAICGVFTAEVAETK 61

Query: 117 VNQVMNYSRQHQYPLQCIMEQ 137
           V  V  Y+R++++PL C +E+
Sbjct: 62  VAMVNKYARENEHPLLCTLEK 82


>3dnj_A (A:) ATP-dependent CLP protease adapter protein CLPS; adaptor, protein-peptide complex, peptide binding protein; 1.15A {Caulobacter vibrioides} PDB: 3g19_A 3gq0_A 3gq1_A 3gw1_A 3g1b_ALength = 85 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target138 ATP-dependent Clp protease adaptor protein ClpS [Candid
3dnj_A_85 ATP-dependent CLP protease adapter protein CLPS; a 100.0
2w9r_A_24-10885 YLJA, ATP-dependent CLP protease adapter protein C 99.97
>3dnj_A (A:) ATP-dependent CLP protease adapter protein CLPS; adaptor, protein-peptide complex, peptide binding protein; 1.15A {Caulobacter vibrioides} PDB: 3g19_A 3gq0_A 3gq1_A 3gw1_A 3g1b_A Back     alignment and structure
Probab=100.00  E-value=2.4e-33  Score=210.85  Aligned_cols=85  Identities=59%  Similarity=1.044  Sum_probs=83.7

Q ss_pred             CCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             26899748999718988489999999998299989999999998237968999638999999999999999975998179
Q gi|254780164|r   54 VRVPKLYRVLLVNDNYTPMEFVIHVLQNFFYKDHETAKCIMLKVHHQGIGECGVYAYEIAEMKVNQVMNYSRQHQYPLQC  133 (138)
Q Consensus        54 ~k~P~~YkVIL~NDd~ttmefVi~vL~~vf~~~~e~A~~iml~vH~~G~avvgv~~~E~AE~k~~qv~~~Ar~~~~PL~~  133 (138)
                      +|+||+|+|||||||+|||||||.+|+++|+++.++|.++|++||++|+|+||+|++|+||+|+.+++++||.+||||+|
T Consensus         1 tk~~~~y~ViL~NDd~~t~e~Vi~vL~~v~~~s~~~A~~~~~~vH~~G~avv~~~~~e~Ae~~~~~~~~~ar~~~~pL~~   80 (85)
T 3dnj_A            1 TQKPSLYRVLILNDDYTPMEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCGVYTYEVAETKVAQVIDSARRHQHPLQC   80 (85)
T ss_dssp             -----CEEEEEECCSSSBHHHHHHHHHHHHCCCHHHHHHHHHHHHHHSEEEEEEECHHHHHHHHHHHHHHHHHTTCCCCE
T ss_pred             CCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCEEEEEECHHHHHHHHHHHHHHHHHCCCCCEE
T ss_conf             99998438999879999889999999999593999999999996569958999987999999999999999974999769


Q ss_pred             EEECC
Q ss_conf             86119
Q gi|254780164|r  134 IMEQK  138 (138)
Q Consensus       134 ~iE~e  138 (138)
                      +||+|
T Consensus        81 ~ie~~   85 (85)
T 3dnj_A           81 TMEKD   85 (85)
T ss_dssp             EEEEC
T ss_pred             EECCC
T ss_conf             97039



>2w9r_A (A:24-108) YLJA, ATP-dependent CLP protease adapter protein CLPS; chaperone, adaptor protein, DNA condensation, iron, CLPS, CLPA, cytoplasm, N-END RULE; HET: DNA; 1.70A {Escherichia coli} PDB: 2wa9_A 1mbx_C* 1mbv_B 1mbu_C* 1r6o_C* 1r6q_C* 2wa8_A 1mg9_A* 1lzw_A* Back     alignment and structure