254780165

254780165

hypothetical protein CLIBASIA_00240

GeneID in NCBI database:8209142Locus tag:CLIBASIA_00240
Protein GI in NCBI database:254780165Protein Accession:YP_003064578.1
Gene range:-(48061, 48276)Protein Length:71aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70-
MEVRMRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDMSILEDDL
ccEEEcHHHHHHHHHHHHHHcccccEEEEccccccEEEEEEccEEEEEEEEccccccEEEEEEEEEEEEcc
cEEEEcHHHHHHHHHHHHHHHcccEEEEccccccccEEEEEcccEEEEEEEccccccEEEEEEEEEEEccc
MEVRMRADEIKKLERYLKRVFGSgiavqsrenqsDSVEVLMNSEFIglvyrnddeeeisyhfDMSILEDDL
MEVRMRADEIKKLERYLKRVfgsgiavqsrenqsdsveVLMNSEFIGLVYRNDDEEEISYHFDMSILEDDL
MEVRMRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDMSILEDDL
**********KKLERYLKRVFGSGI***********VEVLMNSEFIGLVYRNDDEEEISYHFDMSILEDDL
********EIKKLERYLKRVFGSGIA**********VEVLMNSEFIGLVYRNDDEEEISYHFDMSILEDDL
MEVRMRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDMSILEDDL
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEVRMRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDMSILEDDL
MEVRMRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDMSILEDDL
MEVRMRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDMSILEDDL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target71 hypothetical protein CLIBASIA_00240 [Candidatus Liberib
31512266967 hypothetical protein CKC_04605 [Candidatus Liberibacter 1 2e-22
24085064570 hypothetical protein Bgr_10980 [Bartonella grahamii as4 1 6e-13
222148873111 hypothetical protein Avi_2541 [Agrobacterium vitis S4] 1 3e-12
15300925768 hypothetical protein Oant_1927 [Ochrobactrum anthropi A 1 1e-11
16386831087 hypothetical protein Btr_1152 [Bartonella tribocorum CI 1 1e-11
12160216470 hypothetical protein BARBAKC583_0831 [Bartonella bacill 1 2e-11
31211381070 hypothetical protein Rvan_1033 [Rhodomicrobium vannieli 1 2e-11
31940855170 conserved hypothetical protein [Bartonella schoenbuchen 1 3e-11
49474230112 hypothetical protein BQ06250 [Bartonella quintana str. 1 3e-11
16376030569 hypothetical protein HPDFL43_08584 [Hoeflea phototrophi 1 1e-10
>gi|315122669|ref|YP_004063158.1| hypothetical protein CKC_04605 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 67 Back     alignment and organism information
 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 52/67 (77%), Positives = 59/67 (88%)

Query: 5  MRADEIKKLERYLKRVFGSGIAVQSRENQSDSVEVLMNSEFIGLVYRNDDEEEISYHFDM 64
          M  DEIKK+  YLK++FGSGI+VQ R NQSDSVEVLMNSEFIGL+YRN+DE EISYHF M
Sbjct: 1  MSPDEIKKISAYLKKMFGSGISVQLRANQSDSVEVLMNSEFIGLIYRNNDEGEISYHFAM 60

Query: 65 SILEDDL 71
          SILE+DL
Sbjct: 61 SILEEDL 67


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|240850645|ref|YP_002972045.1| hypothetical protein Bgr_10980 [Bartonella grahamii as4aup] Length = 70 Back     alignment and organism information
>gi|222148873|ref|YP_002549830.1| hypothetical protein Avi_2541 [Agrobacterium vitis S4] Length = 111 Back     alignment and organism information
>gi|153009257|ref|YP_001370472.1| hypothetical protein Oant_1927 [Ochrobactrum anthropi ATCC 49188] Length = 68 Back     alignment and organism information
>gi|163868310|ref|YP_001609519.1| hypothetical protein Btr_1152 [Bartonella tribocorum CIP 105476] Length = 87 Back     alignment and organism information
>gi|121602164|ref|YP_989119.1| hypothetical protein BARBAKC583_0831 [Bartonella bacilliformis KC583] Length = 70 Back     alignment and organism information
>gi|312113810|ref|YP_004011406.1| hypothetical protein Rvan_1033 [Rhodomicrobium vannielii ATCC 17100] Length = 70 Back     alignment and organism information
>gi|319408551|emb|CBI82204.1| conserved hypothetical protein [Bartonella schoenbuchensis R1] Length = 70 Back     alignment and organism information
>gi|49474230|ref|YP_032272.1| hypothetical protein BQ06250 [Bartonella quintana str. Toulouse] Length = 112 Back     alignment and organism information
>gi|163760305|ref|ZP_02167388.1| hypothetical protein HPDFL43_08584 [Hoeflea phototrophica DFL-43] Length = 69 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target71 hypothetical protein CLIBASIA_00240 [Candidatus Liberib
pfam1132463 pfam11324, DUF3126, Protein of unknown function (DUF312 7e-15
>gnl|CDD|151765 pfam11324, DUF3126, Protein of unknown function (DUF3126) Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 71 hypothetical protein CLIBASIA_00240 [Candidatus Liberib
pfam1132463 DUF3126 Protein of unknown function (DUF3126). This fam 99.96
>pfam11324 DUF3126 Protein of unknown function (DUF3126) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00