254780167

254780167

hypothetical protein CLIBASIA_00250

GeneID in NCBI database:8209144Locus tag:CLIBASIA_00250
Protein GI in NCBI database:254780167Protein Accession:YP_003064580.1
Gene range:+(49434, 49670)Protein Length:78aa
Gene description:hypothetical protein
COG prediction:[S] Uncharacterized protein conserved in bacteria
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------
MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSLDSKETLPVGCLLSL
ccccccccEEcccccEEEEEccEEEEEEcccccccccEEEEEEcccccEEcccccEEEEEccccccccccccccEEEc
ccccccccccccccccEEEEEEEEEEEEccccccccccEEEEccccccccccccccHEEEcccccccccccccEEEcc
mvdhpiphfqndrghsrikIGVKkfmcagtsppldhphvfinmgeenekhcpycstlyhfdssldsketlpvgcllsl
mvdhpiphfqndrghsrIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFdssldsketlpvgcllsl
MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSLDSKETLPVGCLLSL
***HPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSLDSKETLPVGCLLSL
MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSLDSKETLPVGCLLSL
****PIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSLDSKETLPVGCLLS*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSLDSKETLPVGCLLSL
MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSLDSKETLPVGCLLSL
MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSLDSKETLPVGCLLSL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target78 hypothetical protein CLIBASIA_00250 [Candidatus Liberib
31512267178 hypothetical protein CKC_04615 [Candidatus Liberibacter 1 5e-30
16376031081 hypothetical protein HPDFL43_08609 [Hoeflea phototrophi 1 8e-24
15300987284 hypothetical protein Oant_2545 [Ochrobactrum anthropi A 1 2e-23
239831575126 Hypothetical protein, conserved [Ochrobactrum intermedi 1 2e-23
25468901284 hypothetical protein Babob68_02286 [Brucella abortus bv 1 3e-23
15039633081 hypothetical protein Smed_1111 [Sinorhizobium medicae W 1 3e-23
1798748984 putative cytoplasmic protein [Brucella melitensis bv. 1 1 4e-23
1596523481 hypothetical protein SMc02115 [Sinorhizobium meliloti 1 1 6e-23
2350163484 hypothetical protein BR0747 [Brucella suis 1330] Length 1 6e-23
227821883140 hypothetical protein NGR_c13200 [Sinorhizobium fredii N 1 7e-23
>gi|315122671|ref|YP_004063160.1| hypothetical protein CKC_04615 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 78 Back     alignment and organism information
 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 69/78 (88%)

Query: 1  MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60
          M +H I HFQND+GHS IKIGVK+FMCAG SPPLDHPHVFINMG +N+K+CPYCSTLYHF
Sbjct: 1  MANHRILHFQNDKGHSSIKIGVKEFMCAGASPPLDHPHVFINMGSDNKKYCPYCSTLYHF 60

Query: 61 DSSLDSKETLPVGCLLSL 78
          D+SLDS+ETLP GC L L
Sbjct: 61 DASLDSEETLPSGCFLPL 78


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|163760310|ref|ZP_02167393.1| hypothetical protein HPDFL43_08609 [Hoeflea phototrophica DFL-43] Length = 81 Back     alignment and organism information
>gi|153009872|ref|YP_001371087.1| hypothetical protein Oant_2545 [Ochrobactrum anthropi ATCC 49188] Length = 84 Back     alignment and organism information
>gi|239831575|ref|ZP_04679904.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301] Length = 126 Back     alignment and organism information
>gi|254689012|ref|ZP_05152266.1| hypothetical protein Babob68_02286 [Brucella abortus bv. 6 str. 870] Length = 84 Back     alignment and organism information
>gi|150396330|ref|YP_001326797.1| hypothetical protein Smed_1111 [Sinorhizobium medicae WSM419] Length = 81 Back     alignment and organism information
>gi|17987489|ref|NP_540123.1| putative cytoplasmic protein [Brucella melitensis bv. 1 str. 16M] Length = 84 Back     alignment and organism information
>gi|15965234|ref|NP_385587.1| hypothetical protein SMc02115 [Sinorhizobium meliloti 1021] Length = 81 Back     alignment and organism information
>gi|23501634|ref|NP_697761.1| hypothetical protein BR0747 [Brucella suis 1330] Length = 84 Back     alignment and organism information
>gi|227821883|ref|YP_002825853.1| hypothetical protein NGR_c13200 [Sinorhizobium fredii NGR234] Length = 140 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target78 hypothetical protein CLIBASIA_00250 [Candidatus Liberib
pfam1027640 pfam10276, zf-CHCC, Zinc-finger domain 3e-09
COG439162 COG4391, COG4391, Uncharacterized protein conserved in 3e-15
>gnl|CDD|150882 pfam10276, zf-CHCC, Zinc-finger domain Back     alignment and domain information
>gnl|CDD|34098 COG4391, COG4391, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 78 hypothetical protein CLIBASIA_00250 [Candidatus Liberib
COG439162 Uncharacterized protein conserved in bacteria [Function 99.85
pfam1008947 consensus 99.72
KOG3456120 consensus 99.71
pfam1027640 zf-CHCC Zinc-finger domain. This is a short zinc-finger 99.7
pfam0121599 COX5B Cytochrome c oxidase subunit Vb. 95.95
cd0092497 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb. Cytoc 94.54
KOG3352153 consensus 94.53
pfam09538104 FYDLN_acid Protein of unknown function (FYDLN_acid). Me 94.0
TIGR02300 157 FYDLN_acid conserved hypothetical protein TIGR02300; In 91.45
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam10089 consensus Back     alignment and domain information
>KOG3456 consensus Back     alignment and domain information
>pfam10276 zf-CHCC Zinc-finger domain Back     alignment and domain information
>pfam01215 COX5B Cytochrome c oxidase subunit Vb Back     alignment and domain information
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb Back     alignment and domain information
>KOG3352 consensus Back     alignment and domain information
>pfam09538 FYDLN_acid Protein of unknown function (FYDLN_acid) Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300; InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target78 hypothetical protein CLIBASIA_00250 [Candidatus Liberib
2jz8_A87 Solution Nmr Structure Of Bh09830 From Bartonella H 1e-21
2jvm_A80 Solution Nmr Structure Of Rhodobacter Sphaeroides P 1e-10
2jrr_A67 Solution Nmr Structure Of Q5lls5 From Silicibacter 2e-09
>gi|165760869|pdb|2JZ8|A Chain A, Solution Nmr Structure Of Bh09830 From Bartonella Henselae Modeled With One Zn+2 Bound. Northeast Structural Genomics Consortium Target Bnr55 Length = 87 Back     alignment and structure
 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 46/77 (59%), Positives = 57/77 (74%)

Query: 1  MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60
          M D+ IPHFQND G+  I+IGVK+FMC G + P DHPH+FI+MG  +EK CPYCSTLY +
Sbjct: 1  MADYNIPHFQNDLGYKIIEIGVKEFMCVGATQPFDHPHIFIDMGSTDEKICPYCSTLYRY 60

Query: 61 DSSLDSKETLPVGCLLS 77
          D SL   +T P GCL +
Sbjct: 61 DPSLSYNQTNPTGCLYN 77


>gi|158429098|pdb|2JVM|A Chain A, Solution Nmr Structure Of Rhodobacter Sphaeroides Protein Rhos4_26430. Northeast Structural Genomics Consortium Target Rhr95 Length = 80 Back     alignment and structure
>gi|152149167|pdb|2JRR|A Chain A, Solution Nmr Structure Of Q5lls5 From Silicibacter Pomeroyi. Northeast Structural Genomics Consortium Target Sir90 Length = 67 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target78 hypothetical protein CLIBASIA_00250 [Candidatus Liberib
2jz8_A87 Uncharacterized protein BH09830; zinc binding, structur 6e-24
2jvm_A80 Uncharacterized protein; alpha+beta, structural genomic 3e-08
2jrr_A67 Uncharacterized protein; solution structure, SIR90, str 3e-07
>2jz8_A Uncharacterized protein BH09830; zinc binding, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Bartonella henselae str} Length = 87 Back     alignment and structure
 Score =  104 bits (260), Expect = 6e-24
 Identities = 46/77 (59%), Positives = 57/77 (74%)

Query: 1  MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60
          M D+ IPHFQND G+  I+IGVK+FMC G + P DHPH+FI+MG  +EK CPYCSTLY +
Sbjct: 1  MADYNIPHFQNDLGYKIIEIGVKEFMCVGATQPFDHPHIFIDMGSTDEKICPYCSTLYRY 60

Query: 61 DSSLDSKETLPVGCLLS 77
          D SL   +T P GCL +
Sbjct: 61 DPSLSYNQTNPTGCLYN 77


>2jvm_A Uncharacterized protein; alpha+beta, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Rhodobacter sphaeroides 2} Length = 80 Back     alignment and structure
>2jrr_A Uncharacterized protein; solution structure, SIR90, structural genomics, PSI-2, protein structure initiative; NMR {Silicibacter pomeroyi} Length = 67 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target78 hypothetical protein CLIBASIA_00250 [Candidatus Liberib
2jz8_A87 Uncharacterized protein BH09830; zinc binding, structur 100.0
2jvm_A80 Uncharacterized protein; alpha+beta, structural genomic 99.8
2jrr_A67 Uncharacterized protein; solution structure, SIR90, str 99.79
1v54_F98 VI, cytochrome C oxidase polypeptide VB; oxidoreductase 95.84
2odx_A80 Cytochrome C oxidase polypeptide IV; all beta-protein, 95.47
>2jz8_A Uncharacterized protein BH09830; zinc binding, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Bartonella henselae str} Back     alignment and structure
Probab=100.00  E-value=2.6e-35  Score=212.69  Aligned_cols=77  Identities=60%  Similarity=1.158  Sum_probs=76.1

Q ss_pred             CCCCCCCCEECCCCCCEEEECCEEEEEECCCCCCCCCEEEEECCCCCEEECCCCCCEEEECCCCCCCCCCCCCCEEE
Q ss_conf             97557864112479851994654999937899889867999959998899888882136546768444688002461
Q gi|254780167|r    1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSLDSKETLPVGCLLS   77 (78)
Q Consensus         1 Ma~~~~P~f~nd~g~~~I~v~~~~v~CdGg~g~lgHP~V~l~l~~~~~v~C~YC~~~fv~~~~l~~~es~P~~c~~~   77 (78)
                      ||++.+|||+||.|+++|+|++++|+||||++|||||+|||+|+++++++|||||++|+|+++++++||+|++|+|.
T Consensus         1 ma~~~~P~f~nd~gv~~I~V~~~~v~CdGg~~~lgHP~Vyl~~~~~~~v~CpYC~~~fv~~~~l~~~ea~P~~c~~~   77 (87)
T 2jz8_A            1 MADYNIPHFQNDLGYKIIEIGVKEFMCVGATQPFDHPHIFIDMGSTDEKICPYCSTLYRYDPSLSYNQTNPTGCLYN   77 (87)
T ss_dssp             CCSSCCCCBCCSSCCSEEECSCSEEECCCSSCSSSSSSCEEECTTCCEECCTTTCCEEECCTTSCTTCCCSSCCBCC
T ss_pred             CCCCCCCCCCCCCCCCEEEECCEEEEECCCCCCCCCCEEEEECCCCCEEECCCCCCEEEECCCCCCCCCCCCCCEEC
T ss_conf             98766864116689873897984999749999999998978869999798889998888377777676489765722



>2jvm_A Uncharacterized protein; alpha+beta, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Rhodobacter sphaeroides 2} Back     alignment and structure
>2jrr_A Uncharacterized protein; solution structure, SIR90, structural genomics, PSI-2, protein structure initiative; NMR {Silicibacter pomeroyi} Back     alignment and structure
>1v54_F VI, cytochrome C oxidase polypeptide VB; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: g.41.5.3 PDB: 1oco_F* 1occ_F* 1ocz_F* 1ocr_F* 1v55_F* 2dyr_F* 2dys_F* 2eij_F* 2eik_F* 2eil_F* 2eim_F* 2ein_F* 2occ_F* 2zxw_F* 3abk_F* 3abl_F* 3abm_F* 3ag1_F* 3ag2_F* 3ag3_F* ... Back     alignment and structure
>2odx_A Cytochrome C oxidase polypeptide IV; all beta-protein, metallo-protein, oxidoreductase; NMR {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target78 hypothetical protein CLIBASIA_00250 [Candidatus Liberib
d1v54f_98 Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId 96.1
d1wjpa226 Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [ 90.49
>d1v54f_ g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Small proteins
fold: Rubredoxin-like
superfamily: Rubredoxin-like
family: Cytochrome c oxidase Subunit F
domain: Cytochrome c oxidase Subunit F
species: Cow (Bos taurus) [TaxId: 9913]
Probab=96.10  E-value=0.0034  Score=35.91  Aligned_cols=46  Identities=13%  Similarity=0.319  Sum_probs=37.5

Q ss_pred             CEEEE----CCEEEEEECCCCCCCCCEEEEECCCCCEEECCCCCCEEEECCC
Q ss_conf             51994----6549999378998898679999599988998888821365467
Q gi|254780167|r   16 SRIKI----GVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSS   63 (78)
Q Consensus        16 ~~I~v----~~~~v~CdGg~g~lgHP~V~l~l~~~~~v~C~YC~~~fv~~~~   63 (78)
                      .++.|    +.|.|-|.|  ++-.|..+|+.+.++....|+.||.-|++...
T Consensus        45 ~P~lVpS~~~~RiVGC~~--~~D~h~v~W~~l~~g~p~RC~eCG~~fkL~~~   94 (98)
T d1v54f_          45 DPNLVPSITNKRIVGCIC--EEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPH   94 (98)
T ss_dssp             SCEEEECSSSEEEEEECC--STTCSCCEEEEEESSSCEECTTTCCEEEEECC
T ss_pred             CCCEECCCCCCEEEEECC--CCCCCEEEEEEEECCCCCCCCCCCCEEEEEEC
T ss_conf             986804779864886517--88776337889757998616778868998314



>d1wjpa2 g.37.1.1 (A:43-66) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 78 hypothetical protein CLIBASIA_00250 [Candidatus Li
2jz8_A_87 (A:) Uncharacterized protein BH09830; zinc binding 9e-31
2jvm_A_80 (A:) Uncharacterized protein; alpha+beta, structur 0.003
>2jz8_A (A:) Uncharacterized protein BH09830; zinc binding, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Bartonella henselae str}Length = 87 Back     alignment and structure
 Score =  126 bits (319), Expect = 9e-31
 Identities = 46/77 (59%), Positives = 57/77 (74%)

Query: 1  MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHF 60
          M D+ IPHFQND G+  I+IGVK+FMC G + P DHPH+FI+MG  +EK CPYCSTLY +
Sbjct: 1  MADYNIPHFQNDLGYKIIEIGVKEFMCVGATQPFDHPHIFIDMGSTDEKICPYCSTLYRY 60

Query: 61 DSSLDSKETLPVGCLLS 77
          D SL   +T P GCL +
Sbjct: 61 DPSLSYNQTNPTGCLYN 77


>2jvm_A (A:) Uncharacterized protein; alpha+beta, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Rhodobacter sphaeroides 2}Length = 80 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target78 hypothetical protein CLIBASIA_00250 [Candidatus Liberib
2jz8_A_87 Uncharacterized protein BH09830; zinc binding, str 100.0
2jvm_A_80 Uncharacterized protein; alpha+beta, structural ge 99.86
2jrr_A_67 Uncharacterized protein; solution structure, SIR90 99.85
1v54_F_37-9862 VI, cytochrome C oxidase polypeptide VB; oxidoredu 95.51
2odx_A_80 Cytochrome C oxidase polypeptide IV; all beta-prot 94.23
>2jz8_A (A:) Uncharacterized protein BH09830; zinc binding, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Bartonella henselae str} Back     alignment and structure
Probab=100.00  E-value=5.3e-34  Score=206.39  Aligned_cols=77  Identities=60%  Similarity=1.158  Sum_probs=76.3

Q ss_pred             CCCCCCCCEECCCCCCEEEECCEEEEEECCCCCCCCCEEEEECCCCCEEECCCCCCEEEECCCCCCCCCCCCCCEEE
Q ss_conf             97557864112479851994654999937899889867999959998899888882136546768444688002461
Q gi|254780167|r    1 MVDHPIPHFQNDRGHSRIKIGVKKFMCAGTSPPLDHPHVFINMGEENEKHCPYCSTLYHFDSSLDSKETLPVGCLLS   77 (78)
Q Consensus         1 Ma~~~~P~f~nd~g~~~I~v~~~~v~CdGg~g~lgHP~V~l~l~~~~~v~C~YC~~~fv~~~~l~~~es~P~~c~~~   77 (78)
                      ||+|.+|||+||.|+++|+|++|+|||.|+.+|++||+|||+||++++++|||||++|+|+++|+++|++|++|+|+
T Consensus         1 MA~h~iPHF~Nd~G~~~I~iGvkEFMCvGA~pPfDHPHvFlDMG~d~E~iCpYCSTLYry~~~L~~~~t~P~~C~~~   77 (87)
T 2jz8_A            1 MADYNIPHFQNDLGYKIIEIGVKEFMCVGATQPFDHPHIFIDMGSTDEKICPYCSTLYRYDPSLSYNQTNPTGCLYN   77 (87)
T ss_dssp             CCSSCCCCBCCSSCCSEEECSCSEEECCCSSCSSSSSSCEEECTTCCEECCTTTCCEEECCTTSCTTCCCSSCCBCC
T ss_pred             CCCCCCCCCCCCCCCCEEEECCEEEEECCCCCCCCCCEEEEECCCCCEEECCCCCCEEEECCCCCCCCCCCCCCEEC
T ss_conf             98766876435789765996983999719999899988989759999798889998878477777675389876714



>2jvm_A (A:) Uncharacterized protein; alpha+beta, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Rhodobacter sphaeroides 2} Back     alignment and structure
>2jrr_A (A:) Uncharacterized protein; solution structure, SIR90, structural genomics, PSI-2, protein structure initiative; NMR {Silicibacter pomeroyi} Back     alignment and structure
>1v54_F (F:37-98) VI, cytochrome C oxidase polypeptide VB; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} Back     alignment and structure
>2odx_A (A:) Cytochrome C oxidase polypeptide IV; all beta-protein, metallo-protein, oxidoreductase; NMR {Saccharomyces cerevisiae} Back     alignment and structure