254780168

254780168

monooxygenase FAD-binding protein

GeneID in NCBI database:8209145Locus tag:CLIBASIA_00255
Protein GI in NCBI database:254780168Protein Accession:YP_003064581.1
Gene range:+(49722, 50864)Protein Length:380aa
Gene description:monooxygenase FAD-binding protein
COG prediction:[H] [C] 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases
KEGG prediction:monooxygenase FAD-binding protein; K00480 salicylate hydroxylase [EC:1.14.13.1]
SEED prediction:Salicylate hydroxylase (EC 1.14.13.1)
Pathway involved in KEGG:Dioxin degradation
Naphthalene degradation [PATH:las00626]
Polycyclic aromatic hydrocarbon degradation [PATH:las00624]
Subsystem involved in SEED:Salicylate ester degradation;
Salicylate and gentisate catabolism
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380
MIIGAGISGLTLAASLGHRGIQSCVLEKKDQLSDSGFGIQISPNASRILKRIGILDQLEDIWIEPEDFVFRSGSTLKELSRFSCKNYSRNNWGGIYGVVKRHTLQKILLNHIQTQPLARLHLSTHITHPDCTQISKINNQKPDLLVGADGLNSNIRHYIDTQPITFSGDVVLRCLIPQNNAPEFIDFQSVNIFFGPDSHLVTYPLREDNTINMVFVSSKHTLKDISFLKRSEIHKEWFVKHLTNWHQEIIQLILQINDTHLYPLFECECKHWHNKKNAVLIGDAAHTLLPFAAQGANMAIEDAYALSYLLGKKTIPAAISAYQKVRAVRVKRIRYRTKLNQLLFHMHRPASLFRNAGLRLGIHKPLHKSLDWIYQYKIPE
cEEccHHHHHHHHHHHHHcccEEEEEEccccccccccEEEEcccHHHHHHHcccHHHHHHccccccEEEEEcccccccccccccccccccccccEEEEEEHHHHHHHHHHHHHHccccEEEEEEEEEEcccEEEEEccEEEccEEEEcccccHHHHHHcccccccccccEEEEEEEEcccccccccccEEEEEEccccEEEEEEcccccEEEEEEEEcccccccccccccHHHHHHHHHHHHHHccHHHHHHHHccccccEEEEEEcccccccccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHccccHHHcccccc
ccccccHHHHHHHHHHHHccccEEEEEccHHHHHccccccccHHHHHHHHHcccHHHHHHHccccccEEEEEcccccEEEEEcccHHHHHHccccEEEEEHHHHHHHHHHHccccccHHccEEEEEEcccEEEEccccEEEEEEEEEcccHHHHHHHHccccccccccEEEEEEEEccHccccccccccEEEEEccccEEEEEEcccccEEEEEEEEcccccccccccccccccHHHHHHHHccccHHHHHHHHHccccccccHHccccccccccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHccccHHHHHHHHHHHHccHHHHHHHHHHHHcccccc
MIIGAGISGLTLAASLGHrgiqscvlekkdqlsdsgfgiqispNASRILKRIGILdqlediwiepedfvfrsgstlkelsrfscknysrnnwggiYGVVKRHTLQKILLNHIqtqplarlhlsthithpdctqiskinnqkpdllvgadglnsnirhyidtqpitfsgdvvlrclipqnnapefidfqsvniffgpdshlvtyplredntinMVFVSskhtlkdisflkRSEIHKEWFVKHLTNWHQEIIQLILQIndthlyplfececkhwhnkknaVLIGdaahtllpfaaQGANMAIEDAYALSYLLGKKTIPAAISAYQKVRAVRVKRIRYRTKLNQLLFHmhrpaslfrnaglrlgihkplhkSLDWIYQYKIPE
MIIGAGISGLTLAASLGHRGIQSCVLEKKDQLSDSGFGIQISPNASRILKRIGILDQLEDIWIEPEDFVFRSGSTLKELsrfscknysrnnwGGIYGVVKRHTLQKILLNHIQTQPLARLHLSTHITHPDCTQISKINNQKPDLLVGADGLNSNIRHYIDTQPITFSGDVVLRCLIPQNNAPEFIDFQSVNIFFGPDSHLVTYPLREDNTINMVFVSSKHTLKDISFLKRSEIHKEWFVKHLTNWHQEIIQLILQINDTHLYPLFECECKHWHNKKNAVLIGDAAHTLLPFAAQGANMAIEDAYALSYLLGKKTIPAAISAYQKVRAVRVKRIRYRTKLNQLLFHMHRPASLFRNAGLRLGIHKplhksldwiyqykipe
MIIGAGISGLTLAASLGHRGIQSCVLEKKDQLSDSGFGIQISPNASRILKRIGILDQLEDIWIEPEDFVFRSGSTLKELSRFSCKNYSRNNWGGIYGVVKRHTLQKILLNHIQTQPLARLHLSTHITHPDCTQISKINNQKPDLLVGADGLNSNIRHYIDTQPITFSGDVVLRCLIPQNNAPEFIDFQSVNIFFGPDSHLVTYPLREDNTINMVFVSSKHTLKDISFLKRSEIHKEWFVKHLTNWHQEIIQLILQINDTHLYPLFECECKHWHNKKNAVLIGDAAHTLLPFAAQGANMAIEDAYALSYLLGKKTIPAAISAYQKVRAVRVKRIRYRTKLNQLLFHMHRPASLFRNAGLRLGIHKPLHKSLDWIYQYKIPE
MIIGAGISGLTLAASLGHRGIQSCVLEKKDQLSDSGFGIQISPNASRILKRIGILDQLEDIWIEPEDFVFRSGSTLKELSRFSCKNYSRNNWGGIYGVVKRHTLQKILLNHIQTQPLARLHLSTHITHPDCTQISKINNQKPDLLVGADGLNSNIRHYIDTQPITFSGDVVLRCLIPQNNAPEFIDFQSVNIFFGPDSHLVTYPLREDNTINMVFVSSKHTL*********EIHKEWFVKHLTNWHQEIIQLILQINDTHLYPLFECECKHWHNKKNAVLIGDAAHTLLPFAAQGANMAIEDAYALSYLLGKKTIPAAISAYQKVRAVRVKRIRYRTKLNQLLFHMHRPASLFRNAGLRLGIHKPLHKSLDWIYQYKIP*
MIIGAGISGLTLAASLGHRGIQSCVLEKKDQLSDSGFGIQISPNASRILKRIGILDQLEDIWIEPEDFVFRSGSTLKELSRFSCKNYSRNNWGGIYGVVKRHTLQKILLNHIQTQPLARLHLSTHITHPDCTQISKINNQKPDLLVGADGLNSNIRHYIDTQPITFSGDVVLRCLIPQNNAPEFIDFQSVNIFFGPDSHLVTYPLREDNTINMVFVSSKHTLKDISFLKRSEIHKEWFVKHLTNWHQEIIQLILQINDTHLYPLFECECKHWHNKKNAVLIGDAAHTLLPFAAQGANMAIEDAYALSYLLGKKTIPAAISAYQKVRAVRVKRIRYRTKLNQLLFHMHRPASLFRNAGLRLGIHKPLHKSLDWIYQYKIPE
MIIGAGISGLTLAASLGHRGIQSCVLEKKDQLSDSGFGIQISPNASRILKRIGILDQLEDIWIEPEDFVFRSGSTLKELSRFSCKNYSRNNWGGIYGVVKRHTLQKILLNHIQTQPLARLHLSTHITHPDCTQISKINNQKPDLLVGADGLNSNIRHYIDTQPITFSGDVVLRCLIPQNNAPEFIDFQSVNIFFGPDSHLVTYPLREDNTINMVFVSSKHTLKDISFLKRSEIHKEWFVKHLTNWHQEIIQLILQINDTHLYPLFECECKHWHNKKNAVLIGDAAHTLLPFAAQGANMAIEDAYALSYLLGKKTIPAAISAYQKVRAVRVKRIRYRTKLNQLLFHMHRPASLFRNAGLRLGIHKPLHKSLDWIYQYKIP*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
HHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIIGAGISGLTLAASLGHRGIQSCVLEKKDQLSDSGFGIQISPNASRILKRIGILDQLEDIWIEPEDFVFRSGSTLKELSRFSCKNYSRNNWGGIYGVVKRHTLQKILLNHIQTQPLARLHLSTHITHPDCTQISKINNQKPDLLVGADGLNSNIRHYIDTQPITFSGDVVLRCLIPQNNAPEFIDFQSVNIFFGPDSHLVTYPLREDNTINMVFVSSKHTLKDISFLKRSEIHKEWFVKHLTNWHQEIIQLILQINDTHLYPLFECECKHWHNKKNAVLIGDAAHTLLPFAAQGANMAIEDAYALSYLLGKKTIPAAISAYQKVRAVRVKRIRYRTKLNQLLFHMHRPASLFRNAGLRLGIHKPLHKSLDWIYQYKIPE
MIIGAGISGLTLAASLGHRGIQSCVLEKKDQLSDSGFGIQISPNASRILKRIGILDQLEDIWIEPEDFVFRSGSTLKELSRFSCKNYSRNNWGGIYGVVKRHTLQKILLNHIQTQPLARLHLSTHITHPDCTQISKINNQKPDLLVGADGLNSNIRHYIDTQPITFSGDVVLRCLIPQNNAPEFIDFQSVNIFFGPDSHLVTYPLREDNTINMVFVSSKHTLKDISFLKRSEIHKEWFVKHLTNWHQEIIQLILQINDTHLYPLFECECKHWHNKKNAVLIGDAAHTLLPFAAQGANMAIEDAYALSYLLGKKTIPAAISAYQKVRAVRVKRIRYRTKLNQLLFHMHRPASLFRNAGLRLGIHKPLHKSLDWIYQYKIPE
MIIGAGISGLTLAASLGHRGIQSCVLEKKDQLSDSGFGIQISPNASRILKRIGILDQLEDIWIEPEDFVFRSGSTLKELSRFSCKNYSRNNWGGIYGVVKRHTLQKILLNHIQTQPLARLHLSTHITHPDCTQISKINNQKPDLLVGADGLNSNIRHYIDTQPITFSGDVVLRCLIPQNNAPEFIDFQSVNIFFGPDSHLVTYPLREDNTINMVFVSSKHTLKDISFLKRSEIHKEWFVKHLTNWHQEIIQLILQINDTHLYPLFECECKHWHNKKNAVLIGDAAHTLLPFAAQGANMAIEDAYALSYLLGKKTIPAAISAYQKVRAVRVKRIRYRTKLNQLLFHMHRPASLFRNAGLRLGIHKPLHKSLDWIYQYKIPE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target380 monooxygenase FAD-binding protein [Candidatus Liberibac
254780842384 2-octaprenyl-6-methoxyphenyl hydroxylase [Candidat 9e-08
>gi|254780842|ref|YP_003065255.1| 2-octaprenyl-6-methoxyphenyl hydroxylase [Candidatus Liberibacter asiaticus str. psy62] Length = 384 Back     alignment
 Score = 49.7 bits (117), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 83/376 (22%), Positives = 141/376 (37%), Gaps = 35/376 (9%)

Query: 1   MIIGAGISGLTLAASLGHRGIQSCVLEKKDQLSDSGFGIQISPNASRILKRIGILDQLED 60
           +IIG+G++G   A     +G  + ++  +  L D    + +       LK I + D L+D
Sbjct: 7   IIIGSGLAGSVAAIGAAKKGFLTALVSPRSFLQDLRTTMLMGEGID-FLKEINVWDFLQD 65

Query: 61  I--------WIEPEDFVFRSGSTLKELSRFSCKNYSRNNWGGIYGVVKRHTLQKILLNHI 112
           I         ++  D +  +   +   S      +  N        +  H L +     I
Sbjct: 66  IAEPVSSFRLVDITDRLITAPDAIFHSSEIGLDAFGYN--------IPNHVLMESFAEKI 117

Query: 113 QTQPLAR----LHLSTHITHPDCTQISKINNQ-KPDLLVGADGLNSNIRHYIDTQPITFS 167
              PL      L     I   + T +     Q     L+G+DG NS++R  +      +S
Sbjct: 118 SQDPLIHCFDALANEIQIGEEEVTILLSTGQQIVGQFLIGSDGRNSSVRRQMGYGENKWS 177

Query: 168 GDVVLRCLIPQNNAPEFIDFQSVNIFFGPDSHLVTYPLREDNTINMVFVSSKHTLKDISF 227
                  L  Q++ P   + + V  F      +   PLRE N  ++V++           
Sbjct: 178 YPQKALVLNFQHSMPH--NGRCVE-FHKSLGTITQIPLRE-NFSSLVWIMESQEADFYYK 233

Query: 228 LKRSEIHKEWFVKHLTNWHQEIIQLILQINDTHLYPLFECECKHWHNKKNAVLIGDAAHT 287
           L  +EI      + L  +   +I  I  + D  ++ L      H   KK  VL+G+AAH 
Sbjct: 234 LPVNEI-----ARRLEQYLYPVIGKIEVVTDVQIFQL-SGMISHCFGKKRVVLVGEAAHA 287

Query: 288 LLPFAAQGANMAIEDAYALSYLLGKK--TIPAAISAYQKV-RAVRVKRIRYRTKLNQLLF 344
           L P   QG N+++ D   L  L   +  +  A  + Y  + R   +KRI      N+ LF
Sbjct: 288 LPPICGQGLNLSMRDVIILLNLFQSEHMSFRAIGNRYHAMRRGDIIKRIVGTDLFNRSLF 347

Query: 345 HMHRPASLFRNAGLRL 360
             +    + R     L
Sbjct: 348 SRYPLLQILRAGTFHL 363

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target380 monooxygenase FAD-binding protein [Candidatus Liberibac
315122672394 monooxygenase FAD-binding protein [Candidatus Liberibac 1 1e-151
209549164384 monooxygenase FAD-binding [Rhizobium leguminosarum bv. 1 2e-77
116251962384 salicylate hydroxylase [Rhizobium leguminosarum bv. vic 1 6e-77
218663452382 salicylate hydroxylase protein [Rhizobium etli IE4771] 1 1e-76
327190788382 salicylate hydroxylase protein [Rhizobium etli CNPAF512 1 3e-76
241204490384 monooxygenase FAD-binding [Rhizobium leguminosarum bv. 1 1e-75
227821882393 salicylate hydroxylase [Sinorhizobium fredii NGR234] Le 1 7e-74
86357521384 salicylate hydroxylase protein [Rhizobium etli CFN 42] 1 2e-72
218673185382 salicylate hydroxylase protein [Rhizobium etli GR56] Le 1 5e-72
15965233387 putative salicylate hydroxylase protein [Sinorhizobium 1 5e-70
>gi|315122672|ref|YP_004063161.1| monooxygenase FAD-binding protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 394 Back     alignment and organism information
 Score =  540 bits (1392), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 260/384 (67%), Positives = 311/384 (80%), Gaps = 5/384 (1%)

Query: 2   IIGAGISGLTLAASLGHRGIQSCVLEKKDQLSDSGFGIQISPNASRILKRIGILDQLEDI 61
           I+GAGISGLTLA SL + GIQS +LEKKDQLS  GFGIQISPNASRILK+IG+L+QLED+
Sbjct: 9   IVGAGISGLTLALSLCNHGIQSHILEKKDQLSGQGFGIQISPNASRILKKIGVLNQLEDL 68

Query: 62  WIEPEDFVFRSGSTLKELSRFSCKNYSRNNWGGIYGVVKRHTLQKILLNHIQTQPLARLH 121
           WIEP+DFVF SGSTL EL R  C  ++RNNWGG YGV+KR TLQKILL+++Q QPLA+LH
Sbjct: 69  WIEPKDFVFHSGSTLTELRRIPCGYHARNNWGGAYGVLKRDTLQKILLSNLQEQPLAKLH 128

Query: 122 LSTHITHPDCTQISKINNQKPDLLVGADGLNSNIRHYIDTQPITFSGDVVLRCLIPQNNA 181
           LSTHIT PD   IS+  +QKPDLLVGADGL+S+IR Y+D QP TFSG++VLRC+IPQN+ 
Sbjct: 129 LSTHITQPDFATISQTTSQKPDLLVGADGLHSSIRQYVDKQPATFSGNIVLRCIIPQNDV 188

Query: 182 PEFIDFQSVNIFFGPDSHLVTYPLREDNTINMVFVSSKHTLKDISFLKRS-----EIHKE 236
           PEFID QSVN+FFGP+SHLV YPLREDNTIN+V  S KH LK+I FL++        HK+
Sbjct: 189 PEFIDPQSVNLFFGPNSHLVAYPLREDNTINIVITSDKHLLKNIPFLQKGHSSYHNSHKK 248

Query: 237 WFVKHLTNWHQEIIQLILQINDTHLYPLFECECKHWHNKKNAVLIGDAAHTLLPFAAQGA 296
           WF+KHL  WH+EI +LI + N T++YPLFEC+C  WHN ++ VLIGDAAHTLLPFAAQGA
Sbjct: 249 WFLKHLAGWHREIRELIERTNKTYIYPLFECKCTRWHNHQDTVLIGDAAHTLLPFAAQGA 308

Query: 297 NMAIEDAYALSYLLGKKTIPAAISAYQKVRAVRVKRIRYRTKLNQLLFHMHRPASLFRNA 356
           N+AIEDAY LS LL +K I  AIS YQ +R  R+  IR RTKLNQ LFHM   AS+ R+ 
Sbjct: 309 NLAIEDAYILSKLLSEKKISEAISTYQYIRTTRINMIRARTKLNQKLFHMRNVASICRDI 368

Query: 357 GLRLGIHKPLHKSLDWIYQYKIPE 380
           GLRLG  K L+K+LDWIY+Y++PE
Sbjct: 369 GLRLGHSKLLYKNLDWIYKYEVPE 392


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|209549164|ref|YP_002281081.1| monooxygenase FAD-binding [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 384 Back     alignment and organism information
>gi|116251962|ref|YP_767800.1| salicylate hydroxylase [Rhizobium leguminosarum bv. viciae 3841] Length = 384 Back     alignment and organism information
>gi|218663452|ref|ZP_03519382.1| salicylate hydroxylase protein [Rhizobium etli IE4771] Length = 382 Back     alignment and organism information
>gi|327190788|gb|EGE57856.1| salicylate hydroxylase protein [Rhizobium etli CNPAF512] Length = 382 Back     alignment and organism information
>gi|241204490|ref|YP_002975586.1| monooxygenase FAD-binding [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 384 Back     alignment and organism information
>gi|227821882|ref|YP_002825852.1| salicylate hydroxylase [Sinorhizobium fredii NGR234] Length = 393 Back     alignment and organism information
>gi|86357521|ref|YP_469413.1| salicylate hydroxylase protein [Rhizobium etli CFN 42] Length = 384 Back     alignment and organism information
>gi|218673185|ref|ZP_03522854.1| salicylate hydroxylase protein [Rhizobium etli GR56] Length = 382 Back     alignment and organism information
>gi|15965233|ref|NP_385586.1| putative salicylate hydroxylase protein [Sinorhizobium meliloti 1021] Length = 387 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target380 monooxygenase FAD-binding protein [Candidatus Liberibac
PRK06475400 PRK06475, PRK06475, salicylate hydroxylase; Provisional 3e-58
PRK08163396 PRK08163, PRK08163, salicylate hydroxylase; Provisional 1e-42
PRK06753373 PRK06753, PRK06753, hypothetical protein; Provisional 1e-24
TIGR03219414 TIGR03219, salicylate_mono, salicylate 1-monooxygenase 1e-24
TIGR01988385 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hydroxyl 8e-24
TIGR01984382 TIGR01984, UbiH, 2-polyprenyl-6-methoxyphenol 4-hydroxy 5e-19
PRK07045388 PRK07045, PRK07045, putative monooxygenase; Reviewed 4e-14
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy p 2e-10
KOG3855481 KOG3855, KOG3855, KOG3855, Monooxygenase involved in co 1e-08
PRK08849384 PRK08849, PRK08849, 2-octaprenyl-3-methyl-6-methoxy-1,4 1e-07
PRK05714405 PRK05714, PRK05714, 2-octaprenyl-3-methyl-6-methoxy-1,4 3e-07
PLN02927 668 PLN02927, PLN02927, antheraxanthin epoxidase/zeaxanthin 3e-06
COG0654387 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase 3e-48
KOG2614420 KOG2614, KOG2614, KOG2614, Kynurenine 3-monooxygenase a 5e-33
PRK06847375 PRK06847, PRK06847, hypothetical protein; Provisional 5e-30
PRK07538413 PRK07538, PRK07538, hypothetical protein; Provisional 4e-20
pfam01494349 pfam01494, FAD_binding_3, FAD binding domain 2e-15
PRK06126 545 PRK06126, PRK06126, hypothetical protein; Provisional 5e-14
PRK06617374 PRK06617, PRK06617, 2-octaprenyl-6-methoxyphenyl hydrox 1e-13
PRK07588391 PRK07588, PRK07588, hypothetical protein; Provisional 1e-12
TIGR01989437 TIGR01989, COQ6, Ubiquinone biosynthesis mono0xygenase 2e-10
PRK08850405 PRK08850, PRK08850, 2-octaprenyl-6-methoxyphenol hydrox 1e-09
PRK05868372 PRK05868, PRK05868, hypothetical protein; Validated 2e-06
TIGR02032295 TIGR02032, GG-red-SF, geranylgeranyl reductase family 4e-05
PRK08255 765 PRK08255, PRK08255, salicylyl-CoA 5-hydroxylase; Review 2e-10
PRK06185407 PRK06185, PRK06185, hypothetical protein; Provisional 6e-08
PRK07236386 PRK07236, PRK07236, hypothetical protein; Provisional 4e-09
PRK07608388 PRK07608, PRK07608, ubiquinone biosynthesis hydroxylase 6e-08
PRK07494388 PRK07494, PRK07494, 2-octaprenyl-6-methoxyphenyl hydrox 1e-05
PRK05732395 PRK05732, PRK05732, 2-octaprenyl-6-methoxyphenyl hydrox 1e-04
PRK08132 547 PRK08132, PRK08132, FAD-dependent oxidoreductase; Provi 5e-04
PRK07364415 PRK07364, PRK07364, 2-octaprenyl-6-methoxyphenyl hydrox 7e-04
PRK06183 538 PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydroxyla 8e-07
PRK09126392 PRK09126, PRK09126, hypothetical protein; Provisional 3e-06
PRK07364415 PRK07364, PRK07364, 2-octaprenyl-6-methoxyphenyl hydrox 1e-05
PRK11445351 PRK11445, PRK11445, putative oxidoreductase; Provisiona 1e-05
PRK08132 547 PRK08132, PRK08132, FAD-dependent oxidoreductase; Provi 2e-05
PRK06184 502 PRK06184, PRK06184, hypothetical protein; Provisional 1e-04
KOG1298509 KOG1298, KOG1298, KOG1298, Squalene monooxygenase [Lipi 2e-04
COG1233487 COG1233, COG1233, Phytoene dehydrogenase and related pr 5e-04
PRK06185407 PRK06185, PRK06185, hypothetical protein; Provisional 5e-04
PRK01747662 PRK01747, mnmC, bifunctional tRNA (mnm(5)s(2)U34)-methy 0.001
TIGR02734 502 TIGR02734, crtI_fam, phytoene desaturase 0.001
pfam01266309 pfam01266, DAO, FAD dependent oxidoreductase 0.003
TIGR02733 492 TIGR02733, desat_CrtD, C-3',4' desaturase CrtD 0.003
PRK08243392 PRK08243, PRK08243, 4-hydroxybenzoate 3-monooxygenase; 0.003
PRK04176257 PRK04176, PRK04176, ribulose-1,5-biphosphate synthetase 0.003
PRK07233434 PRK07233, PRK07233, hypothetical protein; Provisional 0.004
PRK07333403 PRK07333, PRK07333, 2-octaprenyl-6-methoxyphenyl hydrox 3e-04
PRK08020391 PRK08020, ubiF, 2-octaprenyl-3-methyl-6-methoxy-1,4-ben 4e-04
PRK06183 538 PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydroxyla 7e-04
PRK06996398 PRK06996, PRK06996, hypothetical protein; Provisional 8e-04
PRK06184 502 PRK06184, PRK06184, hypothetical protein; Provisional 0.001
PRK08013400 PRK08013, PRK08013, oxidoreductase; Provisional 0.002
PRK07236386 PRK07236, PRK07236, hypothetical protein; Provisional 0.004
>gnl|CDD|180582 PRK06475, PRK06475, salicylate hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|181262 PRK08163, PRK08163, salicylate hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|168661 PRK06753, PRK06753, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|132263 TIGR03219, salicylate_mono, salicylate 1-monooxygenase Back     alignment and domain information
>gnl|CDD|162642 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>gnl|CDD|162640 TIGR01984, UbiH, 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>gnl|CDD|136171 PRK07045, PRK07045, putative monooxygenase; Reviewed Back     alignment and domain information
>gnl|CDD|30989 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|39059 KOG3855, KOG3855, KOG3855, Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism, Energy production and conversion] Back     alignment and domain information
>gnl|CDD|181564 PRK08849, PRK08849, 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|168201 PRK05714, PRK05714, 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|178515 PLN02927, PLN02927, antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>gnl|CDD|30999 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|37825 KOG2614, KOG2614, KOG2614, Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion, General function prediction only] Back     alignment and domain information
>gnl|CDD|180727 PRK06847, PRK06847, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181023 PRK07538, PRK07538, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|144912 pfam01494, FAD_binding_3, FAD binding domain Back     alignment and domain information
>gnl|CDD|168408 PRK06126, PRK06126, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|168629 PRK06617, PRK06617, 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|169028 PRK07588, PRK07588, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|162643 TIGR01989, COQ6, Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>gnl|CDD|181565 PRK08850, PRK08850, 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|180297 PRK05868, PRK05868, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|162668 TIGR02032, GG-red-SF, geranylgeranyl reductase family Back     alignment and domain information
>gnl|CDD|181326 PRK08255, PRK08255, salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>gnl|CDD|180451 PRK06185, PRK06185, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180902 PRK07236, PRK07236, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181057 PRK07608, PRK07608, ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>gnl|CDD|181001 PRK07494, PRK07494, 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|180227 PRK05732, PRK05732, 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|181243 PRK08132, PRK08132, FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|180946 PRK07364, PRK07364, 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|180449 PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|181663 PRK09126, PRK09126, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180946 PRK07364, PRK07364, 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|183139 PRK11445, PRK11445, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|181243 PRK08132, PRK08132, FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|180450 PRK06184, PRK06184, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|36512 KOG1298, KOG1298, KOG1298, Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|31426 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|180451 PRK06185, PRK06185, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|179330 PRK01747, mnmC, bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>gnl|CDD|162991 TIGR02734, crtI_fam, phytoene desaturase Back     alignment and domain information
>gnl|CDD|144747 pfam01266, DAO, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|162990 TIGR02733, desat_CrtD, C-3',4' desaturase CrtD Back     alignment and domain information
>gnl|CDD|181316 PRK08243, PRK08243, 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>gnl|CDD|179767 PRK04176, PRK04176, ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|180899 PRK07233, PRK07233, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180935 PRK07333, PRK07333, 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|181199 PRK08020, ubiF, 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>gnl|CDD|180449 PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|180788 PRK06996, PRK06996, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180450 PRK06184, PRK06184, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181197 PRK08013, PRK08013, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|180902 PRK07236, PRK07236, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 380 monooxygenase FAD-binding protein [Candidatus Liberibac
PRK06475400 salicylate hydroxylase; Provisional 100.0
PRK08163396 salicylate hydroxylase; Provisional 100.0
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Members of 100.0
PRK06753373 hypothetical protein; Provisional 100.0
PRK07588391 hypothetical protein; Provisional 100.0
PRK06847375 hypothetical protein; Provisional 100.0
PRK07045388 putative monooxygenase; Reviewed 100.0
PRK09126392 hypothetical protein; Provisional 100.0
PRK07494386 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 100.0
TIGR01988445 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/Ub 100.0
PRK07608389 hypothetical protein; Provisional 100.0
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 100.0
PRK07364413 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 100.0
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and relat 100.0
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 100.0
PRK08948392 consensus 100.0
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 100.0
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 100.0
PRK08013400 hypothetical protein; Provisional 100.0
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 100.0
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 100.0
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validated 100.0
PRK06183 554 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validat 100.0
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 100.0
PRK08774402 consensus 100.0
PRK06185409 hypothetical protein; Provisional 100.0
PRK06996397 hypothetical protein; Provisional 100.0
PRK08244 494 hypothetical protein; Provisional 100.0
PRK08132 549 hypothetical protein; Provisional 100.0
TIGR01984425 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase; InterP 100.0
PRK06834 488 hypothetical protein; Provisional 100.0
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 100.0
TIGR01989481 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6; InterP 100.0
PRK08255 770 salicylyl-CoA 5-hydroxylase; Reviewed 100.0
KOG3855481 consensus 99.96
TIGR02023408 BchP-ChlP geranylgeranyl reductase; InterPro: IPR010253 99.95
TIGR02028401 ChlP geranylgeranyl reductase; InterPro: IPR011774 This 99.85
PRK07538413 hypothetical protein; Provisional 100.0
PRK07236386 hypothetical protein; Provisional 100.0
PRK05868372 hypothetical protein; Validated 100.0
pfam01494349 FAD_binding_3 FAD binding domain. This domain is involv 100.0
PRK06184 503 hypothetical protein; Provisional 100.0
PRK06126 545 hypothetical protein; Provisional 100.0
PRK07190480 hypothetical protein; Provisional 100.0
PRK08294 634 phenol 2-monooxygenase; Provisional 100.0
KOG2614420 consensus 100.0
TIGR02360393 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase; Inter 99.97
PRK11445348 putative oxidoreductase; Provisional 99.96
KOG1298509 consensus 99.95
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy production 99.95
PRK10157428 putative oxidoreductase FixC; Provisional 99.95
PRK10015429 hypothetical protein; Provisional 99.93
pfam04820457 Trp_halogenase Tryptophan halogenase. Tryptophan haloge 99.76
TIGR01790419 carotene-cycl lycopene cyclase family protein; InterPro 99.62
TIGR01789392 lycopene_cycl lycopene cyclase; InterPro: IPR008461 Thi 99.09
TIGR02032343 GG-red-SF geranylgeranyl reductase family; InterPro: IP 99.95
pfam05834374 Lycopene_cycl Lycopene cyclase protein. This family con 99.68
pfam08491276 SE Squalene epoxidase. This domain is found in squalene 99.64
PRK12409410 D-amino acid dehydrogenase small subunit; Provisional 99.17
PRK00711416 D-amino acid dehydrogenase small subunit; Validated 99.11
PRK01747660 mnmC 5-methylaminomethyl-2-thiouridine methyltransferas 99.11
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreductase. T 98.67
TIGR02733499 desat_CrtD C-3',4' desaturase CrtD; InterPro: IPR014104 98.59
TIGR03467430 HpnE squalene-associated FAD-dependent desaturase. The 98.56
PRK13369 503 glycerol-3-phosphate dehydrogenase; Provisional 98.54
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRP 98.49
PRK12771560 putative glutamate synthase (NADPH) small subunit; Prov 98.44
pfam07992277 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreducta 98.43
PRK12814652 putative NADPH-dependent glutamate synthase small subun 98.43
PRK12810472 gltD glutamate synthase subunit beta; Reviewed 98.43
PRK11749460 putative oxidoreductase; Provisional 98.42
PRK12831464 putative oxidoreductase; Provisional 98.41
PRK13984604 putative oxidoreductase; Provisional 98.4
PRK12809639 putative oxidoreductase Fe-S binding subunit; Reviewed 98.39
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. Memb 98.37
PRK098531032 putative selenate reductase subunit YgfK; Provisional 98.36
PRK12769654 putative oxidoreductase Fe-S binding subunit; Reviewed 98.36
PRK07208474 hypothetical protein; Provisional 98.34
pfam01593444 Amino_oxidase Flavin containing amine oxidoreductase. T 98.34
COG2072443 TrkA Predicted flavoprotein involved in K+ transport [I 98.34
COG0578 532 GlpA Glycerol-3-phosphate dehydrogenase [Energy product 98.34
PRK12778760 putative bifunctional 2-polyprenylphenol hydroxylase/gl 98.32
PRK12266 503 glpD glycerol-3-phosphate dehydrogenase; Reviewed 98.32
COG1233 487 Phytoene dehydrogenase and related proteins [Secondary 98.31
TIGR01316462 gltA glutamate synthase (NADPH), homotetrameric; InterP 98.27
PRK05249465 soluble pyridine nucleotide transhydrogenase; Provision 98.22
PRK12770350 putative glutamate synthase subunit beta; Provisional 98.15
COG3349485 Uncharacterized conserved protein [Function unknown] 98.14
PRK11101 545 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; P 98.14
COG0492305 TrxB Thioredoxin reductase [Posttranslational modificat 98.13
PRK06292460 dihydrolipoamide dehydrogenase; Validated 98.12
TIGR01318480 gltD_gamma_fam glutamate synthase, small subunit; Inter 98.11
PRK12775 993 putative trifunctional 2-polyprenylphenol hydroxylase/g 98.08
KOG0029 501 consensus 98.07
PRK05976464 dihydrolipoamide dehydrogenase; Validated 98.07
PRK12779 944 putative bifunctional glutamate synthase subunit beta/2 98.06
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductase F s 98.05
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 97.99
PRK10262321 thioredoxin reductase; Provisional 97.98
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 97.93
COG1148 622 HdrA Heterodisulfide reductase, subunit A and related p 97.88
PRK04965378 nitric oxide reductase; Provisional 97.86
TIGR00031390 UDP-GALP_mutase UDP-galactopyranose mutase; InterPro: I 97.85
PRK06370459 mercuric reductase; Validated 97.84
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [General fun 97.82
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Provision 97.82
PRK06467472 dihydrolipoamide dehydrogenase; Reviewed 97.78
PRK09077 535 L-aspartate oxidase; Provisional 97.76
PRK06327475 dihydrolipoamide dehydrogenase; Validated 97.74
PRK07843 560 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.74
PRK07845467 flavoprotein disulfide reductase; Reviewed 97.71
KOG2853509 consensus 97.69
TIGR01372 1026 soxA sarcosine oxidase, alpha subunit family; InterPro: 97.69
PRK12839 574 hypothetical protein; Provisional 97.68
PRK12844 552 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.67
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 97.67
PRK12845 566 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.65
PRK12842 567 putative succinate dehydrogenase; Reviewed 97.64
pfam00890401 FAD_binding_2 FAD binding domain. This family includes 97.63
PRK06134 579 putative FAD-binding dehydrogenase; Reviewed 97.63
PRK07818467 dihydrolipoamide dehydrogenase; Reviewed 97.63
PRK06481506 fumarate reductase flavoprotein subunit; Validated 97.62
PRK06116450 glutathione reductase; Validated 97.61
COG0493457 GltD NADPH-dependent glutamate synthase beta chain and 97.61
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Provision 97.6
PRK12843 576 putative FAD-binding dehydrogenase; Reviewed 97.6
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.6
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 97.59
PRK07121491 hypothetical protein; Validated 97.57
COG1231450 Monoamine oxidase [Amino acid transport and metabolism] 97.56
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biogenesi 97.55
PTZ00139 622 succinate dehydrogenase (flavoprotein) subunit; Provisi 97.52
PRK08274456 tricarballylate dehydrogenase; Validated 97.5
PRK12837 515 3-ketosteroid-delta-1-dehydrogenase; Provisional 97.48
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, ana 97.47
PRK05329425 anaerobic glycerol-3-phosphate dehydrogenase subunit B; 97.44
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; Revi 97.44
PRK07512 507 L-aspartate oxidase; Provisional 97.43
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; Revi 97.42
PRK09754400 phenylpropionate dioxygenase ferredoxin reductase subun 97.41
PRK08626 657 fumarate reductase flavoprotein subunit; Provisional 97.41
PRK07804 533 L-aspartate oxidase; Provisional 97.41
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 97.4
PRK07803 631 sdhA succinate dehydrogenase flavoprotein subunit; Revi 97.39
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; Revi 97.38
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; Revi 97.38
pfam0007082 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 97.38
TIGR01813 487 flavo_cyto_c flavocytochrome c; InterPro: IPR010960 Thi 97.36
PRK02106 555 choline dehydrogenase; Validated 97.35
PRK13748561 putative mercuric reductase; Provisional 97.32
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; Revi 97.31
PRK09564443 coenzyme A disulfide reductase; Reviewed 97.31
PTZ00052 541 thioredoxin reductase; Provisional 97.28
PRK07573 638 sdhA succinate dehydrogenase flavoprotein subunit; Revi 97.24
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of this 97.24
PRK08401464 L-aspartate oxidase; Provisional 97.2
PRK08275 554 putative oxidoreductase; Provisional 97.18
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 97.15
PRK07845467 flavoprotein disulfide reductase; Reviewed 97.14
COG1053 562 SdhA Succinate dehydrogenase/fumarate reductase, flavop 97.12
PRK06854 610 adenylylsulfate reductase; Validated 97.08
KOG2665453 consensus 97.06
PRK06069 582 sdhA succinate dehydrogenase flavoprotein subunit; Revi 97.03
PRK09754400 phenylpropionate dioxygenase ferredoxin reductase subun 96.98
KOG0685498 consensus 96.98
COG2303 542 BetA Choline dehydrogenase and related flavoproteins [A 96.97
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amin 96.96
PRK09564443 coenzyme A disulfide reductase; Reviewed 96.93
COG2907447 Predicted NAD/FAD-binding protein [General function pre 96.92
PRK13512438 coenzyme A disulfide reductase; Provisional 96.9
TIGR01350481 lipoamide_DH dihydrolipoamide dehydrogenase; InterPro: 96.88
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; Revi 96.86
KOG03992142 consensus 96.86
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases 96.78
KOG1335506 consensus 96.75
PRK05976464 dihydrolipoamide dehydrogenase; Validated 96.74
PRK13512438 coenzyme A disulfide reductase; Provisional 96.72
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Provision 96.71
TIGR02730 506 carot_isom carotene isomerase; InterPro: IPR014101 Memb 96.71
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 96.71
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a gluta 96.7
COG0569225 TrkA K+ transport systems, NAD-binding component [Inorg 96.69
PRK06263 539 sdhA succinate dehydrogenase flavoprotein subunit; Revi 96.66
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihy 96.65
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; Revi 96.63
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 96.62
PRK07818467 dihydrolipoamide dehydrogenase; Reviewed 96.62
PRK08071 510 L-aspartate oxidase; Provisional 96.62
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Provision 96.61
PRK06327475 dihydrolipoamide dehydrogenase; Validated 96.61
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreduct 96.6
PRK07846453 mycothione/glutathione reductase; Reviewed 96.6
COG3573 552 Predicted oxidoreductase [General function prediction o 96.6
KOG1800468 consensus 96.54
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 96.53
PRK06370459 mercuric reductase; Validated 96.49
COG4529474 Uncharacterized protein conserved in bacteria [Function 96.48
PTZ00188506 adrenodoxin reductase; Provisional 96.42
PRK06292460 dihydrolipoamide dehydrogenase; Validated 96.38
PRK06467472 dihydrolipoamide dehydrogenase; Reviewed 96.38
TIGR01811 620 sdhA_Bsu succinate dehydrogenase or fumarate reductase, 96.37
PRK13800 894 putative oxidoreductase/HEAT repeat-containing protein; 96.35
PRK07846453 mycothione/glutathione reductase; Reviewed 96.23
PRK09496455 trkA potassium transporter peripheral membrane componen 96.1
pfam02737180 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding do 96.03
PRK01438481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.87
PRK07531 489 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioestera 95.8
PTZ00318 514 NADH dehydrogenase; Provisional 95.79
TIGR01438 513 TGR thioredoxin and glutathione reductase; InterPro: IP 95.71
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 95.7
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.6
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.51
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.48
PRK08293288 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.45
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 95.45
PRK04965378 nitric oxide reductase; Provisional 95.45
PRK07660283 consensus 95.33
KOG1238 623 consensus 95.3
KOG2404477 consensus 95.28
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.26
PRK07819284 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.24
PRK06130310 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.22
PRK09260289 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.21
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.21
PRK02006 501 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.21
pfam03721185 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase fa 95.2
PRK09117282 consensus 95.14
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [Energy 95.11
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.93
PRK06522307 2-dehydropantoate 2-reductase; Reviewed 94.88
TIGR02053494 MerA mercuric reductase; InterPro: IPR011796 This entry 94.87
PTZ00153673 lipoamide dehydrogenase; Provisional 94.81
pfam02558150 ApbA Ketopantoate reductase PanE/ApbA. This is a family 94.75
KOG4254 561 consensus 94.71
PRK00141476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.58
KOG2311 679 consensus 94.57
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All of the 94.46
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit [Post 94.43
PRK02472450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.43
PRK05708305 2-dehydropantoate 2-reductase; Provisional 94.39
pfam01210159 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehyd 94.39
PRK08268 503 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.32
PRK03369487 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.28
TIGR02061 651 aprA adenylylsulfate reductase, alpha subunit; InterPro 94.27
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisio 94.26
PRK08229341 2-dehydropantoate 2-reductase; Provisional 94.19
pfam02254115 TrkA_N TrkA-N domain. This domain is found in a wide va 94.17
pfam01262150 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domai 94.13
PRK03806438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.04
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.97
PRK01390457 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.61
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelop 93.44
PRK12921306 2-dehydropantoate 2-reductase; Provisional 93.41
PRK13977 577 myosin-cross-reactive antigen; Provisional 93.39
KOG2960328 consensus 93.38
pfam06100 500 Strep_67kDa_ant Streptococcal 67 kDa myosin-cross-react 93.3
PRK07417280 arogenate dehydrogenase; Reviewed 93.27
PRK06249313 2-dehydropantoate 2-reductase; Provisional 93.07
TIGR01763308 MalateDH_bact malate dehydrogenase, NAD-dependent; Inte 93.02
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.88
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductase F s 92.79
pfam00996439 GDI GDP dissociation inhibitor. 92.72
PRK09424510 pntA NAD(P) transhydrogenase subunit alpha; Provisional 92.61
PRK11730715 fadB multifunctional fatty acid oxidation complex subun 92.31
COG1748389 LYS9 Saccharopine dehydrogenase and related proteins [A 91.84
COG5044434 MRS6 RAB proteins geranylgeranyltransferase component A 91.71
TIGR00745332 apbA_panE 2-dehydropantoate 2-reductase; InterPro: IPR0 91.69
TIGR01810 540 betA choline dehydrogenase; InterPro: IPR011533 Choline 91.66
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-lactate 91.5
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Ce 91.27
PRK06567 1048 putative bifunctional glutamate synthase subunit beta/2 91.26
KOG0042 680 consensus 91.0
PRK08507275 prephenate dehydrogenase; Validated 90.91
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogena 90.72
pfam03446163 NAD_binding_2 NAD binding domain of 6-phosphogluconate 90.71
PRK06545357 prephenate dehydrogenase; Validated 90.71
PRK08306296 dipicolinate synthase subunit A; Reviewed 90.62
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transport and 90.62
KOG0405478 consensus 90.55
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate dehydr 90.38
pfam10727111 Rossmann-like Rossmann-like domain. This family of prot 90.22
PRK11259377 solA N-methyltryptophan oxidase; Provisional 99.08
pfam01946229 Thi4 Thi4 family. This family includes a putative thiam 98.82
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.8
PRK11728400 hypothetical protein; Provisional 98.79
pfam01266309 DAO FAD dependent oxidoreductase. This family includes 98.76
COG2081408 Predicted flavoproteins [General function prediction on 98.75
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [Amino 98.69
TIGR00292283 TIGR00292 thiazole biosynthesis enzyme; InterPro: IPR00 98.68
pfam03486405 HI0933_like HI0933-like protein. 98.66
pfam00743 532 FMO-like Flavin-binding monooxygenase-like. This family 98.63
KOG2415 621 consensus 98.6
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR03364. T 98.57
COG0579429 Predicted dehydrogenase [General function prediction on 98.52
KOG1399448 consensus 98.45
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. This enz 98.34
pfam01134391 GIDA Glucose inhibited division protein A. 98.31
KOG2820399 consensus 98.16
TIGR01292321 TRX_reduct thioredoxin-disulfide reductase; InterPro: I 97.92
PRK06175433 L-aspartate oxidase; Provisional 97.85
KOG2852380 consensus 97.82
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihy 97.79
TIGR01350 481 lipoamide_DH dihydrolipoamide dehydrogenase; InterPro: 97.7
PRK05192 621 tRNA uridine 5-carboxymethylaminomethyl modification en 97.7
PRK07395 556 L-aspartate oxidase; Provisional 97.57
TIGR02485467 CobZ_N-term precorrin 3B synthase CobZ; InterPro: IPR01 97.47
TIGR02374 813 nitri_red_nirB nitrite reductase [NAD(P)H], large subun 97.32
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a gluta 97.26
PRK13339497 malate:quinone oxidoreductase; Reviewed 97.0
pfam06039489 Mqo Malate:quinone oxidoreductase (Mqo). This family co 96.98
PRK09897 535 hypothetical protein; Provisional 96.9
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethylamino 96.73
KOG2844 856 consensus 96.54
TIGR00551 546 nadB L-aspartate oxidase; InterPro: IPR005288 L-asparta 96.48
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 96.21
TIGR01320487 mal_quin_oxido malate:quinone-oxidoreductase; InterPro: 95.78
TIGR01373407 soxB sarcosine oxidase, beta subunit family; InterPro: 95.73
PRK05257499 malate:quinone oxidoreductase; Validated 94.95
COG2509486 Uncharacterized FAD-dependent dehydrogenases [General f 94.18
KOG0404322 consensus 92.11
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary metabo 91.12
TIGR02352357 thiamin_ThiO glycine oxidase ThiO; InterPro: IPR012727 98.94
KOG3923342 consensus 97.75
PRK07233430 hypothetical protein; Provisional 98.58
TIGR02734 526 crtI_fam phytoene desaturase; InterPro: IPR014105 Phyto 98.47
PRK11883452 protoporphyrinogen oxidase; Reviewed 98.43
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] 98.24
PRK12416466 protoporphyrinogen oxidase; Provisional 98.11
KOG1276491 consensus 97.27
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase; InterPro: IPR0 96.56
PTZ00153 673 lipoamide dehydrogenase; Provisional 95.05
PRK07502307 cyclohexadienyl dehydrogenase; Validated 92.55
TIGR01317517 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small sub 98.54
TIGR02731454 phytoene_desat phytoene desaturase; InterPro: IPR014102 96.99
TIGR01812 636 sdhA_frdA_Gneg succinate dehydrogenase or fumarate redu 97.99
TIGR01816 615 sdhA_forward succinate dehydrogenase, flavoprotein subu 95.33
TIGR01377401 soxA_mon sarcosine oxidase, monomeric form; InterPro: I 97.89
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine 97.51
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [Energy 94.97
pfam07992277 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreducta 94.92
TIGR00137444 gid gid protein; InterPro: IPR004417 The gid proteins a 97.51
PRK05335434 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 96.89
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in tran 96.51
PRK06116450 glutathione reductase; Validated 96.37
PRK13748561 putative mercuric reductase; Provisional 96.28
PRK05249465 soluble pyridine nucleotide transhydrogenase; Provision 96.1
PTZ00052 541 thioredoxin reductase; Provisional 96.04
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production and c 95.81
PTZ00318514 NADH dehydrogenase; Provisional 93.89
PRK10669558 putative cation:proton antiport protein; Provisional 93.34
TIGR00692341 tdh L-threonine 3-dehydrogenase; InterPro: IPR004627 L- 93.28
COG1063350 Tdh Threonine dehydrogenase and related Zn-dependent de 92.81
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. This enz 90.42
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family; InterPro: IPR010971 This entry represents a family of FAD-dependent hydroxylases (monooxygenases) which are all believed to act in the aerobic ubiquinone biosynthesis pathway Back     alignment and domain information
>PRK07608 hypothetical protein; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK08948 consensus Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK08013 hypothetical protein; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK08774 consensus Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK08132 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase; InterPro: IPR011295 This entry represents the FAD-dependent monooxygenase responsible for the second hydroxylation step in the aerobic ubiquinone biosynthetic pathway Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6; InterPro: IPR000689 Ubiquinone (Q) functions as an electron carrier in the respiratory chain in mitochondria Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>KOG3855 consensus Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase; InterPro: IPR010253 This entry represents a group of geranylgeranyl reductases specific for the biosyntheses of bacteriochlorophyll and chlorophyll Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase; InterPro: IPR011774 This entry represents the reductase which acts reduces the geranylgeranyl group to the phytyl group in the side chain of chlorophyll Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>pfam01494 FAD_binding_3 FAD binding domain Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>KOG2614 consensus Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase; InterPro: IPR012733 4-hydroxybenzoate 3-monooxygenase is a flavoprotein that converts its substrate to 3,4-dihydroxybenzoate, which subsequently enters the beta-ketioadipate pathway of aromatic degradation, using molecular oxygen and NADPH as shown below Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>KOG1298 consensus Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK10015 hypothetical protein; Provisional Back     alignment and domain information
>pfam04820 Trp_halogenase Tryptophan halogenase Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein; InterPro: IPR010108 Carotenoids have important functions in photosynthesis, nutrition, and protection against oxidative damage, and are essential components of the photosynthetic membranes in all plants, algae, and cyanobacteria Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase; InterPro: IPR008461 This family consists of several bacterial Lycopene cyclase (CrtY) proteins Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family; InterPro: IPR011777 This entry includes geranylgeranyl reductases involved in chlorophyll and bacteriochlorophyll biosynthesis as well as other related enzymes which may also act on geranylgeranyl groups or related substrates Back     alignment and domain information
>pfam05834 Lycopene_cycl Lycopene cyclase protein Back     alignment and domain information
>pfam08491 SE Squalene epoxidase Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK01747 mnmC 5-methylaminomethyl-2-thiouridine methyltransferase; Reviewed Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD; InterPro: IPR014104 Members of this family are encoded by slr1293, a carotenoid biosynthesis protein which was shown to be the C-3',4' desaturase (CrtD) of myxoxanthophyll biosynthesis in Synechocystis sp Back     alignment and domain information