254780170

254780170

cationic amino acid ABC transporter, periplasmic binding protein

GeneID in NCBI database:8209147Locus tag:CLIBASIA_00265
Protein GI in NCBI database:254780170Protein Accession:YP_003064583.1
Gene range:+(51506, 52534)Protein Length:342aa
Gene description:cationic amino acid ABC transporter, periplasmic binding protein
COG prediction:[E] [T] ABC-type amino acid transport/signal transduction systems, periplasmic component/domain
KEGG prediction:cationic amino acid ABC transporter, periplasmic binding protein; K09969 general L-amino acid transport system substrate-binding protein
SEED prediction:Glutamate Aspartate periplasmic binding protein precursor GltI (TC 3.A.1.3.4)
Pathway involved in KEGG:ABC transporters [PATH:las02010]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340--
MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR
ccHHHHHHHHHHHHHHHHccccccHHHHHHHHccEEEEEEEccccccEEEcccccEEEEEHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHcccccEEEccccccccHHHHHccccccccccccEEEEEccccccccHHHHcccEEEEEcccHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHcccccEEEEcHHHHHHHHHHccccccEEEcccccccccEEEEEEcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHHcccccccccHHccccHHHHHHHHHHcccHHHHHHHccccccccccccccHHHHHccccccccccc
ccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHcccEEEccccccccccccccccccccccHHHHHHHHHHHccccccEEEEccccHHHcHHHccccEEEEEccccEEEccccccccEEEEEEEEccccEEEccccccccHHHccccEEEEEccccHHHHHHHHHHHccccEEEEEcccHHHHHHHHHccccccccccHHHHHHHHHHcccccccEEccHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHccccccccccccccccHHHHHHHHHHcccHHHHcccccccccccccccHHHHHHccccEEccccc
MYKDFFVSILCLIILFFTSFSTnasilgdikkrgflkcgintGLVGFAEVkangdwkgfDVDFCRALssaifddpskiqylplNAKERFLALQSKQIDILSRNTDWTLLREISLglafrpityfdgqgfimhkkkgissvsqLSGASICVQAGTTTELTLADYFKahnmkyhpiVFERVEEIDAAYRAHrcdaytgdISALYALkltndrpsehvilpdiisksplapaiiqgdtewyNIVSWTHYAMVTAEELGitqkninqvskdttnpdvqrflgidkssnigealgltKDWTYRIIRHMGNygemfdrnlgnqselkiprgynalwskgglmyappir
MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRflgidkssnigealgltkdWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGynalwskgglmyappir
MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR
***DFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR
MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR
MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR
iiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR
MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR
MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target342 cationic amino acid ABC transporter, periplasmic bindin
315122673342 cationic amino acid ABC transporter, periplasmic bindin 1 1e-167
150396327341 cationic amino acid ABC transporter periplasmic binding 1 1e-122
15965231341 general L-amino acid-binding periplasmic ABC transporte 1 1e-121
209549162341 cationic amino acid ABC transporter periplasmic binding 1 1e-121
307309254341 cationic amino acid ABC transporter, periplasmic bindin 1 1e-120
241204488341 cationic amino acid ABC transporter periplasmic-binding 1 1e-120
116251960341 general L-amino acid substrate binding protein [Rhizobi 1 1e-120
86357519348 general L-amino acid ABC transporter, substrate-binding 1 1e-119
327190790341 general L-amino acid ABC transporter, substrate-binding 1 1e-119
190891587341 general L-amino acid ABC transporter, substrate-binding 1 1e-119
>gi|315122673|ref|YP_004063162.1| cationic amino acid ABC transporter, periplasmic binding protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 342 Back     alignment and organism information
 Score =  592 bits (1525), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 274/342 (80%), Positives = 310/342 (90%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           MY++FF+SILCLI L FT+F T ASIL +IKKRGFLKCGINTGL GF+E++ANGDWKGFD
Sbjct: 1   MYRNFFISILCLIGLTFTNFPTYASILQNIKKRGFLKCGINTGLTGFSEIQANGDWKGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           VDFC+ALS+AIFDD SK+QYLPLNAKERF++LQSKQIDILSRNTDWTLLRE  LGLAFRP
Sbjct: 61  VDFCKALSAAIFDDSSKVQYLPLNAKERFISLQSKQIDILSRNTDWTLLRETKLGLAFRP 120

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           ITYFDGQG +M+KK G+SS  QLS ASICVQAGTTTE TLADYFKAHNMKYHPIVFERVE
Sbjct: 121 ITYFDGQGLMMYKKSGVSSALQLSDASICVQAGTTTEKTLADYFKAHNMKYHPIVFERVE 180

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           EIDAAYR+HRCD YTGD SALYAL+L+ D P+EHVIL DIISKSPL PAI+QGD+EW NI
Sbjct: 181 EIDAAYRSHRCDVYTGDKSALYALRLSTDNPNEHVILKDIISKSPLGPAILQGDSEWSNI 240

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           VSWTHYA+V AEELGITQ N++Q    T +PD++RFLGIDKS+NIGE+LGL+KDW Y+II
Sbjct: 241 VSWTHYALVNAEELGITQSNVDQKRLTTNDPDMKRFLGIDKSANIGESLGLSKDWAYQII 300

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           +HMGNYGE+FDRNLG+QS LKIPR YNALWSKGG+MYAPPIR
Sbjct: 301 KHMGNYGEIFDRNLGSQSALKIPREYNALWSKGGIMYAPPIR 342


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150396327|ref|YP_001326794.1| cationic amino acid ABC transporter periplasmic binding protein [Sinorhizobium medicae WSM419] Length = 341 Back     alignment and organism information
>gi|15965231|ref|NP_385584.1| general L-amino acid-binding periplasmic ABC transporter protein [Sinorhizobium meliloti 1021] Length = 341 Back     alignment and organism information
>gi|209549162|ref|YP_002281079.1| cationic amino acid ABC transporter periplasmic binding protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 341 Back     alignment and organism information
>gi|307309254|ref|ZP_07588922.1| cationic amino acid ABC transporter, periplasmic binding protein [Sinorhizobium meliloti BL225C] Length = 341 Back     alignment and organism information
>gi|241204488|ref|YP_002975584.1| cationic amino acid ABC transporter periplasmic-binding protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 341 Back     alignment and organism information
>gi|116251960|ref|YP_767798.1| general L-amino acid substrate binding protein [Rhizobium leguminosarum bv. viciae 3841] Length = 341 Back     alignment and organism information
>gi|86357519|ref|YP_469411.1| general L-amino acid ABC transporter, substrate-binding protein [Rhizobium etli CFN 42] Length = 348 Back     alignment and organism information
>gi|327190790|gb|EGE57858.1| general L-amino acid ABC transporter, substrate-binding protein [Rhizobium etli CNPAF512] Length = 341 Back     alignment and organism information
>gi|190891587|ref|YP_001978129.1| general L-amino acid ABC transporter, substrate-binding protein [Rhizobium etli CIAT 652] Length = 341 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target342 cationic amino acid ABC transporter, periplasmic bindin
TIGR01096250 TIGR01096, 3A0103s03R, lysine-arginine-ornithine-bindin 3e-39
smart00062219 smart00062, PBPb, Bacterial periplasmic substrate-bindi 4e-34
COG0834275 COG0834, HisJ, ABC-type amino acid transport/signal tra 6e-23
pfam00497224 pfam00497, SBP_bac_3, Bacterial extracellular solute-bi 1e-20
cd00134218 cd00134, PBPb, Bacterial periplasmic transport systems 2e-25
PRK11917259 PRK11917, PRK11917, bifunctional adhesin/ABC transporte 6e-14
PRK15007243 PRK15007, PRK15007, putative ABC transporter arginine-b 0.001
>gnl|CDD|162200 TIGR01096, 3A0103s03R, lysine-arginine-ornithine-binding periplasmic protein Back     alignment and domain information
>gnl|CDD|128376 smart00062, PBPb, Bacterial periplasmic substrate-binding proteins Back     alignment and domain information
>gnl|CDD|31176 COG0834, HisJ, ABC-type amino acid transport/signal transduction systems, periplasmic component/domain [Amino acid transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|144186 pfam00497, SBP_bac_3, Bacterial extracellular solute-binding proteins, family 3 Back     alignment and domain information
>gnl|CDD|29040 cd00134, PBPb, Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of substrates, such as, amino acids, peptides, sugars, vitamins and inorganic ions Back     alignment and domain information
>gnl|CDD|183381 PRK11917, PRK11917, bifunctional adhesin/ABC transporter aspartate/glutamate-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|184969 PRK15007, PRK15007, putative ABC transporter arginine-biding protein; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 342 cationic amino acid ABC transporter, periplasmic bindin
TIGR01096333 3A0103s03R lysine-arginine-ornithine-binding periplasmi 100.0
KOG1052656 consensus 99.02
PRK12680327 transcriptional regulator CysB-like protein; Reviewed 96.94
PRK10797302 glutamate and aspartate transporter subunit; Provisiona 100.0
PRK11917259 bifunctional adhesin/ABC transporter aspartate/glutamat 100.0
PRK11260264 cystine transporter subunit; Provisional 100.0
PRK09495247 glnH glutamine ABC transporter periplasmic protein; Rev 100.0
COG0834275 HisJ ABC-type amino acid transport/signal transduction 100.0
cd00134218 PBPb Bacterial periplasmic transport systems use membra 100.0
smart00062219 PBPb Bacterial periplasmic substrate-binding proteins. 100.0
pfam00497224 SBP_bac_3 Bacterial extracellular solute-binding protei 100.0
PRK10859 507 putative transglycosylase; Provisional 99.94
TIGR02995285 ectoine_ehuB ectoine/hydroxyectoine ABC transporter sol 99.94
PRK09959 1197 hybrid sensory histidine kinase in two-component regula 99.9
PRK09959 1197 hybrid sensory histidine kinase in two-component regula 99.84
COG4623 473 Predicted soluble lytic transglycosylase fused to an AB 99.74
TIGR03431288 PhnD phosphonate ABC transporter, periplasmic phosphona 99.5
COG3221299 PhnD ABC-type phosphate/phosphonate transport system, p 99.4
TIGR01098299 3A0109s03R phosphonate ABC transporter, periplasmic pho 99.2
PRK09861272 cytoplasmic membrane lipoprotein-28; Provisional 97.39
PRK12679316 cbl transcriptional regulator Cbl; Reviewed 97.2
PRK12683308 transcriptional regulator CysB-like protein; Reviewed 97.07
pfam03466209 LysR_substrate LysR substrate binding domain. The struc 96.89
PRK11063271 metQ DL-methionine transporter substrate-binding subuni 96.88
PRK12682309 transcriptional regulator CysB-like protein; Reviewed 96.44
PRK11242292 DNA-binding transcriptional regulator CynR; Provisional 96.43
PRK12684313 transcriptional regulator CysB-like protein; Reviewed 96.35
COG1732300 OpuBC Periplasmic glycine betaine/choline-binding (lipo 96.22
COG0725258 ModA ABC-type molybdate transport system, periplasmic c 96.21
PRK09791302 putative DNA-binding transcriptional regulator; Provisi 95.1
CHL00180307 rbcR LysR transcriptional regulator; Provisional 93.97
PRK10682370 putrescine transporter subunit: periplasmic-binding com 93.62
TIGR03339279 phn_lysR aminoethylphosphonate catabolism associated Ly 93.03
TIGR02285293 TIGR02285 conserved hypothetical protein; InterPro: IPR 92.86
PRK09986278 DNA-binding transcriptional activator XapR; Provisional 92.69
PRK11151305 DNA-binding transcriptional regulator OxyR; Provisional 91.64
PRK11233305 nitrogen assimilation transcriptional regulator; Provis 90.84
PRK11553314 alkanesulfonate transporter substrate-binding subunit; 99.66
COG4521334 TauA ABC-type taurine transport system, periplasmic com 98.51
PRK11119332 proX glycine betaine transporter periplasmic subunit; P 97.5
PRK10677257 modA molybdate transporter periplasmic protein; Provisi 95.97
TIGR02122319 TRAP_TAXI TRAP transporter solute receptor, TAXI family 94.34
PRK11480320 tauA taurine transporter substrate binding subunit; Pro 99.32
TIGR03427328 ABC_peri_uca ABC transporter periplasmic binding protei 99.04
COG2358321 Imp TRAP-type uncharacterized transport system, peripla 98.55
TIGR01729304 taurine_ABC_bnd taurine ABC transporter, periplasmic bi 98.19
COG1638332 DctP TRAP-type C4-dicarboxylate transport system, perip 98.05
pfam03480285 SBP_bac_7 Bacterial extracellular solute-binding protei 97.79
COG4663363 FcbT1 TRAP-type mannitol/chloroaromatic compound transp 95.87
pfam09084216 NMT1 NMT1/THI5 like. This family contains the NMT1 and 99.11
pfam04069256 OpuAC Substrate binding domain of ABC-type glycine beta 97.71
COG2113302 ProX ABC-type proline/glycine betaine transport systems 96.9
TIGR03414290 ABC_choline_bnd choline ABC transporter, periplasmic bi 96.27
COG0715335 TauA ABC-type nitrate/sulfonate/bicarbonate transport s 99.05
KOG1053 1258 consensus 98.97
KOG4440 993 consensus 98.5
TIGR01728311 SsuA_fam ABC transporter, substrate-binding protein, al 97.98
COG1910223 Periplasmic molybdate-binding protein/domain [Inorganic 97.0
TIGR00212312 hemC porphobilinogen deaminase; InterPro: IPR000860 Tet 95.98
COG0040290 HisG ATP phosphoribosyltransferase [Amino acid transpor 95.65
pfam03180236 Lipoprotein_9 NLPA lipoprotein. This family of bacteria 95.22
TIGR02424300 TF_pcaQ pca operon transcription factor PcaQ; InterPro: 94.53
pfam01379213 Porphobil_deam Porphobilinogen deaminase, dipyromethane 94.17
PRK00072300 hemC porphobilinogen deaminase; Reviewed 93.92
PRK01066234 porphobilinogen deaminase; Provisional 93.42
TIGR00787267 dctP TRAP transporter solute receptor, DctP family; Int 92.67
PRK10341312 DNA-binding transcriptional activator TdcA; Provisional 92.55
cd00494292 HMBS Hydroxymethylbilane synthase (HMBS), also known as 92.45
COG0181307 HemC Porphobilinogen deaminase [Coenzyme metabolism] 90.05
smart00094332 TR_FER Transferrin. 90.02
COG3181319 Uncharacterized protein conserved in bacteria [Function 98.58
pfam03401274 Bug Tripartite tricarboxylate transporter family recept 98.31
PRK00489287 hisG ATP phosphoribosyltransferase; Reviewed 97.55
KOG1054 897 consensus 98.21
TIGR03427328 ABC_peri_uca ABC transporter periplasmic binding protei 90.85
smart00079134 PBPe Eukaryotic homologues of bacterial periplasmic sub 97.97
pfam03180236 Lipoprotein_9 NLPA lipoprotein. This family of bacteria 91.98
PRK09861272 cytoplasmic membrane lipoprotein-28; Provisional 90.01
pfam00060270 Lig_chan Ligand-gated ion channel. This family includes 97.8
PRK12681324 cysB transcriptional regulator CysB; Reviewed 97.33
COG1464268 NlpA ABC-type metal ion transport system, periplasmic c 97.01
PRK09501348 potD spermidine/putrescine ABC transporter periplasmic 96.95
pfam09084216 NMT1 NMT1/THI5 like. This family contains the NMT1 and 95.74
PRK01686212 hisG ATP phosphoribosyltransferase catalytic subunit; R 95.3
pfam01634161 HisG ATP phosphoribosyltransferase. 94.26
PRK11480320 tauA taurine transporter substrate binding subunit; Pro 93.25
>TIGR01096 3A0103s03R lysine-arginine-ornithine-binding periplasmic protein; InterPro: IPR005768 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane Back     alignment and domain information
>KOG1052 consensus Back     alignment and domain information
>PRK12680 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>PRK10797 glutamate and aspartate transporter subunit; Provisional Back     alignment and domain information
>PRK11917 bifunctional adhesin/ABC transporter aspartate/glutamate-binding protein; Reviewed Back     alignment and domain information
>PRK11260 cystine transporter subunit; Provisional Back     alignment and domain information
>PRK09495 glnH glutamine ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>COG0834 HisJ ABC-type amino acid transport/signal transduction systems, periplasmic component/domain [Amino acid transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>cd00134 PBPb Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of substrates, such as, amino acids, peptides, sugars, vitamins and inorganic ions Back     alignment and domain information
>smart00062 PBPb Bacterial periplasmic substrate-binding proteins Back     alignment and domain information
>pfam00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3 Back     alignment and domain information
>PRK10859 putative transglycosylase; Provisional Back     alignment and domain information
>TIGR02995 ectoine_ehuB ectoine/hydroxyectoine ABC transporter solute-binding protein; InterPro: IPR014337 Members of this entry are the extracellular solute-binding proteins of ABC transporters and they closely resemble amino acid transporters Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>COG4623 Predicted soluble lytic transglycosylase fused to an ABC-type amino acid-binding protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03431 PhnD phosphonate ABC transporter, periplasmic phosphonate binding protein Back     alignment and domain information
>COG3221 PhnD ABC-type phosphate/phosphonate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01098 3A0109s03R phosphonate ABC transporter, periplasmic phosphonate-binding protein; InterPro: IPR005770 Bacterial binding protein-dependent transport systems , are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system Back     alignment and domain information
>PRK09861 cytoplasmic membrane lipoprotein-28; Provisional Back     alignment and domain information
>PRK12679 cbl transcriptional regulator Cbl; Reviewed Back     alignment and domain information
>PRK12683 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>pfam03466 LysR_substrate LysR substrate binding domain Back     alignment and domain information
>PRK11063 metQ DL-methionine transporter substrate-binding subunit; Provisional Back     alignment and domain information
>PRK12682 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>PRK11242 DNA-binding transcriptional regulator CynR; Provisional Back     alignment and domain information
>PRK12684 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>COG1732 OpuBC Periplasmic glycine betaine/choline-binding (lipo)protein of an ABC-type transport system (osmoprotectant binding protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0725 ModA ABC-type molybdate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09791 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>CHL00180 rbcR LysR transcriptional regulator; Provisional Back     alignment and domain information
>PRK10682 putrescine transporter subunit: periplasmic-binding component of ABC superfamily; Provisional Back     alignment and domain information
>TIGR03339 phn_lysR aminoethylphosphonate catabolism associated LysR family transcriptional regulator Back     alignment and domain information
>TIGR02285 TIGR02285 conserved hypothetical protein; InterPro: IPR011972 Members of this family are found in several Proteobacteria, including Pseudomonas putida (strain KT2440), Bdellovibrio bacteriovorus HD100 (three members), Aeromonas hydrophila, and Chromobacterium violaceum ATCC 12472 Back     alignment and domain information
>PRK09986 DNA-binding transcriptional activator XapR; Provisional Back     alignment and domain information
>PRK11151 DNA-binding transcriptional regulator OxyR; Provisional Back     alignment and domain information
>PRK11233 nitrogen assimilation transcriptional regulator; Provisional Back     alignment and domain information
>PRK11553 alkanesulfonate transporter substrate-binding subunit; Provisional Back     alignment and domain information
>COG4521 TauA ABC-type taurine transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11119 proX glycine betaine transporter periplasmic subunit; Provisional Back     alignment and domain information
>PRK10677 modA molybdate transporter periplasmic protein; Provisional Back     alignment and domain information
>TIGR02122 TRAP_TAXI TRAP transporter solute receptor, TAXI family; InterPro: IPR011852 This family is one of at least three major families of extracytoplasmic solute receptor (ESR) for TRAP (Tripartite ATP-independent Periplasmic Transporter) transporters Back     alignment and domain information
>PRK11480 tauA taurine transporter substrate binding subunit; Provisional Back     alignment and domain information
>TIGR03427 ABC_peri_uca ABC transporter periplasmic binding protein, urea carboxylase region Back     alignment and domain information
>COG2358 Imp TRAP-type uncharacterized transport system, periplasmic component [General function prediction only] Back     alignment and domain information
>TIGR01729 taurine_ABC_bnd taurine ABC transporter, periplasmic binding protein; InterPro: IPR010068 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG1638 DctP TRAP-type C4-dicarboxylate transport system, periplasmic component [Carbohydrate transport and metabolism] Back     alignment and domain information
>pfam03480 SBP_bac_7 Bacterial extracellular solute-binding protein, family 7 Back     alignment and domain information
>COG4663 FcbT1 TRAP-type mannitol/chloroaromatic compound transport system, periplasmic component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>pfam09084 NMT1 NMT1/THI5 like Back     alignment and domain information
>pfam04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system Back     alignment and domain information
>COG2113 ProX ABC-type proline/glycine betaine transport systems, periplasmic components [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03414 ABC_choline_bnd choline ABC transporter, periplasmic binding protein Back     alignment and domain information
>COG0715 TauA ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1053 consensus Back     alignment and domain information
>KOG4440 consensus Back     alignment and domain information
>TIGR01728 SsuA_fam ABC transporter, substrate-binding protein, aliphatic sulfonates family; InterPro: IPR010067 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG1910 Periplasmic molybdate-binding protein/domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00212 hemC porphobilinogen deaminase; InterPro: IPR000860 Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway Back     alignment and domain information
>COG0040 HisG ATP phosphoribosyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>pfam03180 Lipoprotein_9 NLPA lipoprotein Back     alignment and domain information
>TIGR02424 TF_pcaQ pca operon transcription factor PcaQ; InterPro: IPR012787 Members of this family are LysR-family transcription factors associated with operons for catabolism of protocatechuate Back     alignment and domain information
>pfam01379 Porphobil_deam Porphobilinogen deaminase, dipyromethane cofactor binding domain Back     alignment and domain information
>PRK00072 hemC porphobilinogen deaminase; Reviewed Back     alignment and domain information
>PRK01066 porphobilinogen deaminase; Provisional Back     alignment and domain information
>TIGR00787 dctP TRAP transporter solute receptor, DctP family; InterPro: IPR004682 TRAP-T family proteins generally consist of three components, and these systems have so far been found in Gram-negative bacteria, Gram-positive bacteria and archaea Back     alignment and domain information
>PRK10341 DNA-binding transcriptional activator TdcA; Provisional Back     alignment and domain information
>cd00494 HMBS Hydroxymethylbilane synthase (HMBS), also known as porphobilinogen deaminase (PBGD), is an intermediate enzyme in the biosynthetic pathway of tetrapyrrolic ring systems, such as heme, chlorophylls, and vitamin B12 Back     alignment and domain information
>COG0181 HemC Porphobilinogen deaminase [Coenzyme metabolism] Back     alignment and domain information
>smart00094 TR_FER Transferrin Back     alignment and domain information
>COG3181 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam03401 Bug Tripartite tricarboxylate transporter family receptor Back     alignment and domain information
>PRK00489 hisG ATP phosphoribosyltransferase; Reviewed Back     alignment and domain information
>KOG1054 consensus Back     alignment and domain information
>TIGR03427 ABC_peri_uca ABC transporter periplasmic binding protein, urea carboxylase region Back     alignment and domain information
>smart00079 PBPe Eukaryotic homologues of bacterial periplasmic substrate binding proteins Back     alignment and domain information
>pfam03180 Lipoprotein_9 NLPA lipoprotein Back     alignment and domain information
>PRK09861 cytoplasmic membrane lipoprotein-28; Provisional Back     alignment and domain information
>pfam00060 Lig_chan Ligand-gated ion channel Back     alignment and domain information
>PRK12681 cysB transcriptional regulator CysB; Reviewed Back     alignment and domain information
>COG1464 NlpA ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09501 potD spermidine/putrescine ABC transporter periplasmic substrate-binding protein; Reviewed Back     alignment and domain information
>pfam09084 NMT1 NMT1/THI5 like Back     alignment and domain information
>PRK01686 hisG ATP phosphoribosyltransferase catalytic subunit; Reviewed Back     alignment and domain information
>pfam01634 HisG ATP phosphoribosyltransferase Back     alignment and domain information
>PRK11480 tauA taurine transporter substrate binding subunit; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target342 cationic amino acid ABC transporter, periplasmic bindin
2vha_A287 Debp Length = 287 2e-37
2ia4_B280 Crystal Structure Of Novel Amino Acid Binding Prote 6e-36
2ia4_A279 Crystal Structure Of Novel Amino Acid Binding Prote 2e-35
1xt8_A292 Crystal Structure Of Cysteine-Binding Protein From 2e-34
2v25_B232 Structure Of The Campylobacter Jejuni Antigen Peb1a 3e-29
2pvu_A239 Crystal Structures Of The Arginine-, Lysine-, Histi 7e-25
2q2a_B243 Crystal Structures Of The Arginine-, Lysine-, Histi 8e-25
2q2c_B234 Crystal Structures Of The Arginine-, Lysine-, Histi 9e-25
2q2c_C233 Crystal Structures Of The Arginine-, Lysine-, Histi 9e-25
3hv1_A268 Crystal Structure Of A Polar Amino Acid Abc Uptake 4e-23
1lst_A239 Three-Dimensional Structures Of The Periplasmic Lys 5e-23
1laf_E238 Structural Bases For Multiple Ligand Specificity Of 6e-23
1hsl_A238 Refined 1.89 Angstroms Structure Of The Histidine-B 8e-23
3k4u_A245 Crystal Structure Of Putative Binding Component Of 1e-22
1ggg_A226 Glutamine Binding Protein Open Ligand-Free Structur 3e-22
3h7m_A234 Crystal Structure Of A Histidine Kinase Sensor Doma 2e-17
3kbr_A239 The Crystal Structure Of Cyclohexadienyl Dehydratas 3e-16
2iee_A271 Crystal Structure Of Yckb_bacsu From Bacillus Subti 3e-16
3del_B242 The Structure Of Ct381, The Arginine Binding Protei 2e-15
3n26_A246 Cpn0482 : The Arginine Binding Protein From The Per 2e-14
3g41_A246 The Structure Of Cpn0482, The Arginine Binding Prot 3e-14
3i6v_A232 Crystal Structure Of A Periplasmic HisGLUGLNARGOPIN 2e-13
1ii5_A233 Crystal Structure Of The Glur0 Ligand Binding Core 1e-12
1iit_A232 Glur0 Ligand Binding Core Complex With L-Serine Len 2e-12
2pyy_A228 Crystal Structure Of The Glur0 Ligand-Binding Core 2e-12
3r39_A255 Crystal Structure Of Periplasmic D-Alanine Abc Tran 1e-11
2pyy_B218 Crystal Structure Of The Glur0 Ligand-Binding Core 5e-11
3kzg_A237 Crystal Structure Of An Arginine 3rd Transport Syst 7e-12
2o1m_A258 Crystal Structure Of The Probable Amino-Acid Abc Tr 1e-09
>gi|193885219|pdb|2VHA|A Chain A, Debp Length = 287 Back     alignment and structure
 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 44/241 (18%), Positives = 88/241 (36%), Gaps = 6/241 (2%)

Query: 19  SFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDD---- 74
           +     S L  I K G +  G     V F+         G+  D+  A+  A+       
Sbjct: 2   AAPAAGSTLDKIAKNGVIVVGHRESSVPFSYYDNQQKVVGYSQDYSNAIVEAVKKKLNKP 61

Query: 75  PSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKK 134
             +++ +P+ ++ R   LQ+   D    +T   + R+      F    +  G   +  K 
Sbjct: 62  DLQVKLIPITSQNRIPLLQNGTFDFECGSTTNNVERQKQAA--FSDTIFVVGTRLLTKKG 119

Query: 135 KGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAY 194
             I   + L G ++ V +GTT+E+ L    +   M    I  +   +      + R  A+
Sbjct: 120 GDIKDFADLKGKAVVVTSGTTSEVLLNKLNEEQKMNMRIISAKDHGDSFRTLESGRAVAF 179

Query: 195 TGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEEL 254
             D + L   +    +P    I+    S+      + + D ++  ++  T   + T+ E 
Sbjct: 180 MMDDALLAGERAKAKKPDNWDIVGKPQSQEAYGCMLRKDDPQFKKLMDDTIAQVQTSGEA 239

Query: 255 G 255
            
Sbjct: 240 E 240


>gi|75765505|pdb|1XT8|A Chain A, Crystal Structure Of Cysteine-Binding Protein From Campylobacter Jejuni At 2.0 A Resolution Length = 292 Back     alignment and structure
>gi|241913538|pdb|3HV1|A Chain A, Crystal Structure Of A Polar Amino Acid Abc Uptake Transporter Substrate Binding Protein From Streptococcus Thermophilus Length = 268 Back     alignment and structure
>gi|157831886|pdb|1LST|A Chain A, Three-Dimensional Structures Of The Periplasmic Lysine-, Arginine-, Ornithine-Binding Protein With And Without A Ligand Length = 239 Back     alignment and structure
>gi|1065303|pdb|1LAF|E Chain E, Structural Bases For Multiple Ligand Specificity Of The Periplasmic Lysine-, Arginine-, Ornithine-Binding Protein Length = 238 Back     alignment and structure
>gi|576158|pdb|1HSL|A Chain A, Refined 1.89 Angstroms Structure Of The Histidine-Binding Protein Complexed With Histidine And Its Relationship With Many Other Active Transport(Slash)chemosensory Receptors Length = 238 Back     alignment and structure
>gi|262368132|pdb|3K4U|A Chain A, Crystal Structure Of Putative Binding Component Of Abc Transporter From Wolinella Succinogenes Dsm 1740 Complexed With Lysine Length = 245 Back     alignment and structure
>gi|1943541|pdb|1GGG|A Chain A, Glutamine Binding Protein Open Ligand-Free Structure Length = 226 Back     alignment and structure
>gi|242556607|pdb|3H7M|A Chain A, Crystal Structure Of A Histidine Kinase Sensor Domain With Similarity To Periplasmic Binding Proteins Length = 234 Back     alignment and structure
>gi|266618825|pdb|3KBR|A Chain A, The Crystal Structure Of Cyclohexadienyl Dehydratase Precursor From Pseudomonas Aeruginosa Pa01 Length = 239 Back     alignment and structure
>gi|116668123|pdb|2IEE|A Chain A, Crystal Structure Of Yckb_bacsu From Bacillus Subtilis. Northeast Structural Genomics Consortium Target Sr574. Length = 271 Back     alignment and structure
>gi|240104308|pdb|3DEL|B Chain B, The Structure Of Ct381, The Arginine Binding Protein From The Periplasm Chlamydia Trachomatis Length = 242 Back     alignment and structure
>gi|298508712|pdb|3N26|A Chain A, Cpn0482 : The Arginine Binding Protein From The Periplasm Of Chlamydia Pneumoniae Length = 246 Back     alignment and structure
>gi|254575078|pdb|3I6V|A Chain A, Crystal Structure Of A Periplasmic HisGLUGLNARGOPINE Family-Binding Protein From Silicibacter Pomeroyi In Complex With Lysine Length = 232 Back     alignment and structure
>gi|15988294|pdb|1II5|A Chain A, Crystal Structure Of The Glur0 Ligand Binding Core Complex With L-Glutamate Length = 233 Back     alignment and structure
>gi|15988295|pdb|1IIT|A Chain A, Glur0 Ligand Binding Core Complex With L-Serine Length = 232 Back     alignment and structure
>gi|166007117|pdb|2PYY|A Chain A, Crystal Structure Of The Glur0 Ligand-Binding Core From Nostoc Punctiforme In Complex With (L)-Glutamate Length = 228 Back     alignment and structure
>gi|327533787|pdb|3R39|A Chain A, Crystal Structure Of Periplasmic D-Alanine Abc Transporter From Salmonella Enterica Length = 255 Back     alignment and structure
>gi|281501012|pdb|3KZG|A Chain A, Crystal Structure Of An Arginine 3rd Transport System Periplasmic Binding Protein From Legionella Pneumophila Length = 237 Back     alignment and structure
>gi|122921285|pdb|2O1M|A Chain A, Crystal Structure Of The Probable Amino-Acid Abc Transporter Extracellular-Binding Protein Ytmk From Bacillus Subtilis. Northeast Structural Genomics Consortium Target Sr572 Length = 258 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target342 cationic amino acid ABC transporter, periplasmic bindin
3hv1_A268 Polar amino acid ABC uptake transporter substrate bindi 2e-24
2vha_A287 Periplasmic binding transport protein; periplasmic bind 2e-20
1lst_A239 Lysine, arginine, ornithine-binding protein; amino-acid 1e-15
3g41_A246 Amino acid ABC transporter, periplasmic amino acid-bind 1e-15
3mpk_A267 Virulence sensor protein BVGS; venus flytrap, sensor do 8e-15
2v25_A259 Major cell-binding factor; antigen, adhesin, aspartate, 2e-14
1ii5_A233 Hypothetical protein SLR1257; membrane protein; HET: GL 4e-14
3kzg_A237 Arginine 3RD transport system periplasmic binding prote 5e-14
3h7m_A234 Sensor protein; histidine kinase sensor domain, kinase, 1e-13
1wdn_A226 GLNBP, glutamine binding protein; closed form, complex, 2e-13
3i6v_A232 Periplasmic His/Glu/Gln/Arg/opine family-binding protei 3e-13
2o1m_A258 Probable amino-acid ABC transporter extracellular-bindi 2e-12
1pb7_A292 N-methyl-D-aspartate receptor subunit 1; ligand binding 2e-12
3k4u_A245 Binding component of ABC transporter; structural genomi 1e-11
3del_B242 Arginine binding protein; alpha and beta protein (A/B), 1e-10
3kbr_A239 Cyclohexadienyl dehydratase; pseudomonas aeruginosa PA0 9e-09
2q88_A257 EHUB, putative ABC transporter amino acid-binding prote 6e-08
2pvu_A272 ARTJ; basic amino acid binding protein, ABC transport s 5e-07
2rc8_A294 Glutamate [NMDA] receptor subunit 3A; membrane protein, 7e-07
1xt8_A292 Putative amino-acid transporter periplasmic solute-bind 2e-18
2iee_A271 ORF2, probable ABC transporter extracellular-binding pr 8e-08
1mqi_A263 Glutamate receptor 2; GLUR2, ligand binding core, S1S2, 5e-06
2a5s_A284 N-methyl-D-aspartate receptor nmdar2A subunit, NMDA rec 4e-05
2pyy_A228 Ionotropic glutamate receptor bacterial homologue; GLUR 2e-04
2v3u_A265 Glutamate receptor delta-2 subunit; postsynaptic membra 7e-04
>3hv1_A Polar amino acid ABC uptake transporter substrate binding protein; protein structure initiative II(PSI II), nysgxrc; 1.90A {Streptococcus thermophilus lmg 18311} Length = 268 Back     alignment and structure
 Score =  108 bits (270), Expect = 2e-24
 Identities = 36/228 (15%), Positives = 76/228 (33%), Gaps = 8/228 (3%)

Query: 17  FTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPS 76
            + F+T         K   +K G +   V     + +G + GFD+D   A+         
Sbjct: 4   RSHFATQKDQWQTYTKEKKIKIGFDATFVPMGYEEKDGSYIGFDIDLANAVFKLY---GI 60

Query: 77  KIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKG 136
            +++  ++   +   L++  ID++      T  R+ S    F      + Q  +  K  G
Sbjct: 61  DVEWQAIDWDMKETELKNGTIDLIWNGYSVTDERKQS--ADFTEPYMVNEQVLVTKKSSG 118

Query: 137 ISSVSQLSGASICVQAGTTTELTLA---DYFKAHNMKYHPIVFERVEEIDAAYRAHRCDA 193
           I SV+ ++G ++  QAG++            K        + +    +      + R D 
Sbjct: 119 IDSVAGMAGKTLGAQAGSSGYDAFNASPKILKDVVANQKVVQYSTFTQALIDLNSGRIDG 178

Query: 194 YTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIV 241
              D          +    ++ ++P        A    + D      +
Sbjct: 179 LLIDRVYANYYLEKSGVLDQYNVMPAGYEGESFAVGARKVDKTLIKKI 226


>2vha_A Periplasmic binding transport protein; periplasmic binding protein, ligand binding, ultrahigh resolution; HET: GLU; 1.0A {Shigella flexneri} PDB: 2ia4_A* Length = 287 Back     alignment and structure
>1lst_A Lysine, arginine, ornithine-binding protein; amino-acid binding protein; HET: LYS; 1.80A {Salmonella typhimurium} SCOP: c.94.1.1 PDB: 2lao_A 1lag_E* 1lah_E 1laf_E 1hsl_A* 1hpb_P* Length = 239 Back     alignment and structure
>3mpk_A Virulence sensor protein BVGS; venus flytrap, sensor domain, signaling protein; 2.04A {Bordetella pertussis} PDB: 3mpl_A Length = 267 Back     alignment and structure
>2v25_A Major cell-binding factor; antigen, adhesin, aspartate, glutamate, transport, ABC transport, virulence factor, receptor; 1.49A {Campylobacter jejuni} Length = 259 Back     alignment and structure
>1ii5_A Hypothetical protein SLR1257; membrane protein; HET: GLU; 1.60A {Synechocystis SP} SCOP: c.94.1.1 PDB: 1iit_A 1iiw_A Length = 233 Back     alignment and structure
>3kzg_A Arginine 3RD transport system periplasmic binding protein; arginine transport system, protein structure initiative II(PSI II); 2.06A {Legionella pneumophila subsp} Length = 237 Back     alignment and structure
>3h7m_A Sensor protein; histidine kinase sensor domain, kinase, phosphoprotein, transferase; 2.40A {Geobacter sulfurreducens} Length = 234 Back     alignment and structure
>1wdn_A GLNBP, glutamine binding protein; closed form, complex, peptide, complex (binding protein/peptide); 1.94A {Escherichia coli} SCOP: c.94.1.1 PDB: 1ggg_A Length = 226 Back     alignment and structure
>3i6v_A Periplasmic His/Glu/Gln/Arg/opine family-binding protein; structural genomics, transporter, PSI-2, protein structure initiative; HET: LYS; 2.00A {Silicibacter pomeroyi} Length = 232 Back     alignment and structure
>2o1m_A Probable amino-acid ABC transporter extracellular-binding protein YTMK; NESG X-RAY O34852 YTMK_bacsu, structural genomics, PSI-2; 2.00A {Bacillus subtilis} Length = 258 Back     alignment and structure
>1pb7_A N-methyl-D-aspartate receptor subunit 1; ligand binding receptor, NR1, ligand binding protein; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1pbq_A* 1y1m_A 1y1z_A 1y20_A 2a5t_A* 1pb8_A 1pb9_A Length = 292 Back     alignment and structure
>3k4u_A Binding component of ABC transporter; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: LYS; 2.62A {Wolinella succinogenes} Length = 245 Back     alignment and structure
>3del_B Arginine binding protein; alpha and beta protein (A/B), periplasmic protein, protein binding, transport protein; 1.92A {Chlamydia trachomatis} Length = 242 Back     alignment and structure
>3kbr_A Cyclohexadienyl dehydratase; pseudomonas aeruginosa PA01,structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Pseudomonas aeruginosa} Length = 239 Back     alignment and structure
>2q88_A EHUB, putative ABC transporter amino acid-binding protein; substrate-binding protein, compatible solues, osmoprotection; HET: 4CS; 1.90A {Sinorhizobium meliloti} PDB: 2q89_A* Length = 257 Back     alignment and structure
>2pvu_A ARTJ; basic amino acid binding protein, ABC transport system, thermophilic bacterium, transport protein; HET: LYS; 1.79A {Geobacillus stearothermophilus} PDB: 2q2a_A* 2q2c_A* Length = 272 Back     alignment and structure
>2rc8_A Glutamate [NMDA] receptor subunit 3A; membrane protein, alternative splicing, calcium, cell junction, coiled coil, glycoprotein, ION transport; 1.45A {Rattus norvegicus} PDB: 2rc7_A 2rc9_A 2rca_A 2rcb_A Length = 294 Back     alignment and structure
>1xt8_A Putative amino-acid transporter periplasmic solute-binding protein; ABC transport, cysteine uptake, spine, structural genomics; 2.00A {Campylobacter jejuni} SCOP: c.94.1.1 Length = 292 Back     alignment and structure
>2iee_A ORF2, probable ABC transporter extracellular-binding protein YCKB; SR574, NESG, X-RAY, structural genomics, PSI-2; 2.20A {Bacillus subtilis} Length = 271 Back     alignment and structure
>1mqi_A Glutamate receptor 2; GLUR2, ligand binding core, S1S2, partial agonist, WILLARDIINES, fluoro-WILLARDIINE, membrane protein; HET: FWD; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1ftj_A* 1ftl_A* 1fto_A 1fw0_A* 1m5b_A* 1ftm_A* 1m5c_A* 1mm6_A* 1mm7_A* 1mqg_A* 1m5e_A* 1mqj_A* 1ms7_A* 1mxu_A* 1mxv_A 1mxw_A 1mxx_A 1mxy_A 1mxz_A 1my0_A ... Length = 263 Back     alignment and structure
>2a5s_A N-methyl-D-aspartate receptor nmdar2A subunit, NMDA receptor nmdar2A; protein-ligand complex, metal transport,membrane protein; HET: GLU; 1.70A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 2a5t_B* Length = 284 Back     alignment and structure
>2pyy_A Ionotropic glutamate receptor bacterial homologue; GLUR0 ligand binding domain, transport protein; HET: GLU; 2.10A {Nostoc punctiforme pcc 73102} Length = 228 Back     alignment and structure
>2v3u_A Glutamate receptor delta-2 subunit; postsynaptic membrane, ionotropic glutamate receptors, transmembrane, membrane protein; 1.74A {Rattus norvegicus} PDB: 2v3t_A Length = 265 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target342 cationic amino acid ABC transporter, periplasmic bindin
2vha_A287 Periplasmic binding transport protein; periplasmic bind 100.0
2v25_A259 Major cell-binding factor; antigen, adhesin, aspartate, 100.0
1xt8_A292 Putative amino-acid transporter periplasmic solute-bind 100.0
3hv1_A268 Polar amino acid ABC uptake transporter substrate bindi 100.0
2o1m_A258 Probable amino-acid ABC transporter extracellular-bindi 100.0
2iee_A271 ORF2, probable ABC transporter extracellular-binding pr 100.0
2pvu_A272 ARTJ; basic amino acid binding protein, ABC transport s 100.0
2q88_A257 EHUB, putative ABC transporter amino acid-binding prote 100.0
1wdn_A226 GLNBP, glutamine binding protein; closed form, complex, 100.0
3h7m_A234 Sensor protein; histidine kinase sensor domain, kinase, 100.0
3mpk_A267 Virulence sensor protein BVGS; venus flytrap, sensor do 100.0
3g41_A246 Amino acid ABC transporter, periplasmic amino acid-bind 100.0
3kzg_A237 Arginine 3RD transport system periplasmic binding prote 100.0
3kbr_A239 Cyclohexadienyl dehydratase; pseudomonas aeruginosa PA0 100.0
3k4u_A245 Binding component of ABC transporter; structural genomi 100.0
3del_B242 Arginine binding protein; alpha and beta protein (A/B), 100.0
1pb7_A292 N-methyl-D-aspartate receptor subunit 1; ligand binding 100.0
1ii5_A233 Hypothetical protein SLR1257; membrane protein; HET: GL 99.97
1lst_A239 Lysine, arginine, ornithine-binding protein; amino-acid 99.97
3i6v_A232 Periplasmic His/Glu/Gln/Arg/opine family-binding protei 99.96
2pyy_A228 Ionotropic glutamate receptor bacterial homologue; GLUR 99.96
1yae_A312 Glutamate receptor, ionotropic kainate 2; kainate recep 99.94
1mqi_A263 Glutamate receptor 2; GLUR2, ligand binding core, S1S2, 99.93
2v3u_A265 Glutamate receptor delta-2 subunit; postsynaptic membra 99.93
3g3k_A259 Glutamate receptor, ionotropic kainate 2; membrane prot 99.88
2ozz_A231 Hypothetical protein YHFZ; alpha-beta structure, struct 99.56
3ksx_A324 Nitrate transport protein; SSUA, alkanesulfonate-bindin 99.46
3kg2_A823 Glutamate receptor 2; ION channel, membrane protein, al 99.22
3n5l_A310 Binding protein component of ABC phosphonate TRAN; stru 99.02
3gxa_A275 Outer membrane lipoprotein GNA1946; periplasmic, L-meth 98.34
1xs5_A241 29 kDa protein, membrane lipoprotein TPN32; periplasmic 98.32
3myu_A344 High affinity transport system protein P37; Mg289, CYPL 98.22
3k2d_A237 ABC-type metal ION transport system, periplasmic; alpha 98.16
2nxo_A291 Hypothetical protein SCO4506; PFAM, DUF178, NYSGXRC, 10 97.9
2ql3_A209 Probable transcriptional regulator, LYSR family protein 97.37
3fxb_A326 Trap dicarboxylate transporter, DCTP subunit; periplasm 97.31
2hpg_A327 ABC transporter, periplasmic substrate-binding protein; 97.26
2i49_A429 Bicarbonate transporter; alpha-beta protein, C-clamp, A 97.17
2hxr_A238 HTH-type transcriptional regulator CYNR; CYNR transcrip 96.37
3fzv_A306 Probable transcriptional regulator; LYSR, structural ge 96.22
3jv9_A219 OXYR, transcriptional regulator, LYSR family; LYSR-type 95.54
3ho7_A232 OXYR; beta-alpha-barrels, DNA-binding, transcription, t 95.46
3ir1_A245 Outer membrane lipoprotein GNA1946; D-methionine cultur 95.17
1ixc_A294 CBNR, LYSR-type regulatory protein; long alpha helix co 94.87
2fyi_A228 HTH-type transcriptional regulator CBL; Lys-R family, c 94.23
3oxn_A241 Putative transcriptional regulator, LYSR family; struct 94.12
3fxq_A305 LYSR type regulator of TSAMBCD; transcriptional regulat 93.46
1i6a_A219 OXYR, hydrogen peroxide-inducible genes activator; OXYR 92.0
2h98_A313 HTH-type transcriptional regulator CATM; BENM, LTTR; 1. 90.96
2a5s_A284 N-methyl-D-aspartate receptor nmdar2A subunit, NMDA rec 99.95
2rc8_A294 Glutamate [NMDA] receptor subunit 3A; membrane protein, 99.93
3b50_A310 Sialic acid-binding periplasmic protein SIAP; periplasm 97.81
2pfy_A301 Putative exported protein; extracytoplasmic solute rece 97.5
2pfz_A301 Putative exported protein; extracytoplasmic solute rece 97.49
2vpn_A316 Periplasmic substrate binding protein; ectoine, hydroxy 97.24
2b6d_A345 Lactotransferrin; complex, drugs, lactoferrin; HET: NAG 95.92
1al3_A324 Cys regulon transcriptional activator CYSB; LYSR family 95.09
1ryo_A327 Serotransferrin; iron transport, metal transport; 1.20A 94.48
1iej_A332 Ovotransferrin; iron, metal binding protein; 1.65A {Gal 91.59
2h9b_A312 HTH-type transcriptional regulator BENM; LTTR, transcri 91.45
2x26_A308 Periplasmic aliphatic sulphonates-binding protein; tran 99.33
3ix1_A302 N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine prote 98.97
2g29_A417 Nitrate transport protein NRTA; solute-binding protein, 98.04
1h3d_A299 ATP-phosphoribosyltransferase; hisitidine biosynthesis, 97.58
1nh8_A304 ATP phosphoribosyltransferase; prtase, de novo His bios 96.68
2vd3_A289 ATP phosphoribosyltransferase; metal-binding, glycosylt 96.47
2esn_A310 Probable transcriptional regulator; PA0477, APC5828,tra 94.27
3ecr_A364 Porphobilinogen deaminase; heme biosynthesis, porphobil 94.09
1gtk_A313 Porphobilinogen deaminase; lyase, biosynthesis of linea 93.38
1us5_A314 Putative GLUR0 ligand binding core; receptor, membrane 99.15
3hn0_A283 Nitrate transport protein; YP_001302749.1, structural g 98.78
1p99_A295 Hypothetical protein PG110; structural genomics, PSI, p 98.19
2zzv_A361 ABC transporter, solute-binding protein; periplasmic su 97.61
2qpq_A301 Protein BUG27; alpha/beta domain, venus flytrap, transp 97.1
2de3_A365 Dibenzothiophene desulfurization enzyme B; alpha-beta, 99.06
2hzl_A365 Trap-T family sorbitol/mannitol transporter, periplasmi 97.94
2dvz_A314 BUGE, putative exported protein; periplamsic binding pr 97.36
2rin_A298 Putative glycine betaine-binding ABC transporter protei 96.53
3l6g_A256 Betaine ABC transporter permease and substrate BI prote 96.11
1twy_A290 ABC transporter, periplasmic substrate-binding protein; 95.74
1o63_A219 ATP phosphoribosyltransferase; structural genomics; 2.0 94.25
2czl_A272 Hypothetical protein TTHA1568; conserved hypothetical p 94.24
2vd2_A214 ATP phosphoribosyltransferase; HISG, cytoplasm, glycosy 92.58
3o66_A282 Glycine betaine/carnitine/choline ABC transporter; stru 91.32
1z7m_E208 ATP phosphoribosyltransferase; ATP-PRT, histidine biosy 90.77
2hxw_A237 Major antigenic peptide PEB3; periplasmic binding prote 90.69
2f5x_A312 BUGD; periplasmic binding protein, transport protein; 1 97.75
1xs5_A241 29 kDa protein, membrane lipoprotein TPN32; periplasmic 97.1
3gxa_A275 Outer membrane lipoprotein GNA1946; periplasmic, L-meth 96.48
1p99_A295 Hypothetical protein PG110; structural genomics, PSI, p 96.31
2b4l_A268 Glycine betaine-binding protein; substrate-binding prot 93.76
3ir1_A245 Outer membrane lipoprotein GNA1946; D-methionine cultur 92.77
1zbm_A280 Hypothetical protein AF1704; alpha-beta protein, struct 95.29
3ix1_A302 N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine prote 94.12
2x26_A308 Periplasmic aliphatic sulphonates-binding protein; tran 93.56
3ksx_A324 Nitrate transport protein; SSUA, alkanesulfonate-bindin 92.57
3k2d_A237 ABC-type metal ION transport system, periplasmic; alpha 93.23
>2vha_A Periplasmic binding transport protein; periplasmic binding protein, ligand binding, ultrahigh resolution; HET: GLU; 1.00A {Shigella flexneri} PDB: 2ia4_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=313.77  Aligned_cols=231  Identities=19%  Similarity=0.267  Sum_probs=214.6

Q ss_pred             HCCCCCHHHHHHHHCCEEEEEEECCCCCCEEECCCCCEEEEHHHHHHHHHHHHCCC----CCEEEEEECCCCCCHHHHHC
Q ss_conf             01244216899985794999871789883068898988015099999999996798----22025998143100267743
Q gi|254780170|r   19 SFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDD----PSKIQYLPLNAKERFLALQS   94 (342)
Q Consensus        19 ~~aa~a~tLd~Vk~rG~L~vGv~~~~ppfs~~d~~G~~~GfDVDl~raiAaal~gd----~~kVe~v~~~~~~rf~aL~s   94 (342)
                      ++++++++|++|+++|+|+||++.++|||+|.|++|+++||+|||+++||+.++.+    ..+|+|++++|..++.+|++
T Consensus         2 ~~~aa~~~l~~i~~~g~l~Vg~~~~~~P~~~~d~~G~~~G~~vDl~~~ia~~l~~~l~~~~~~v~~~~~~~~~~~~~L~~   81 (287)
T 2vha_A            2 AAPAAGSTLDKIAKNGVIVVGHRESSVPFSYYDNQQKVVGYSQDYSNAIVEAVKKKLNKPDLQVKLIPITSQNRIPLLQN   81 (287)
T ss_dssp             -CCCTTSHHHHHHHHTEEEEEECSEETTTEEECSSSCEESHHHHHHHHHHHHHHHHTTCTTCEEEEEECCTTTHHHHHHT
T ss_pred             CCCCCCCHHHHHHHCCEEEEEECCCCCCCEEECCCCCEEEEHHHHHHHHHHHHHHHHCCCCEEEEEEECCHHHHHHHHHC
T ss_conf             86655210999970998999986898893689999988886699999999997477377870699998799999999986


Q ss_pred             CCEEEEEECCCCCCCCHHCCCCCCCCCCCCCCEEEEEECCCCCCCHHHHCCCCEEEEECCCHHHHHHHHHHHCCCCCCEE
Q ss_conf             96279981243253201102784353223440234630211347536417862034313426999999998629985078
Q gi|254780170|r   95 KQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPI  174 (342)
Q Consensus        95 G~vDil~~~~T~T~~Rd~~~~v~Fs~~~~~dgq~~lVrk~~~i~s~~dL~G~~I~v~~GTT~e~~l~~~~~~~~~~~~~v  174 (342)
                      |++|++++++++|.+|+  ..+.|+.||++.++++++|+++++++++||+|++|||..||+++..+.+++...+..++++
T Consensus        82 G~~Di~~~~~~~t~~R~--~~~~fs~p~~~~~~~l~~~k~~~i~~~~dL~g~~v~v~~gs~~~~~l~~~~~~~~~~~~iv  159 (287)
T 2vha_A           82 GTFDFECGSTTNNVERQ--KQAAFSDTIFVVGTRLLTKKGGDIKDFADLKGKAVVVTSGTTSEVLLNKLNEEQKMNMRII  159 (287)
T ss_dssp             TSCSEECSSCBCCHHHH--TTCEEEEEEEEEEEEEEEETTSSCCSGGGGTTCEEEEETTSHHHHHHHHHHHHTTCCCEEE
T ss_pred             CCCCEEECCCCCCHHHH--HHCCCCCCCCCCCCEEEEECCCCCCCHHHCCCCCEEECCCCHHHHHHHHHHHHHCCCCCEE
T ss_conf             99643411344664565--4324554300047257775489878987808981221378669999999888737896346


Q ss_pred             EECCHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCHHHCCCCCCCCCCCEEEECCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             74798999999873960299825047999998367800100256444237101000277757999988774433112
Q gi|254780170|r  175 VFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTA  251 (342)
Q Consensus       175 ~~~~~~~a~~al~~Gr~DA~~~D~s~La~~~~~~~~p~~~~il~e~iskEPlg~avr~gD~~w~d~V~W~~~ali~A  251 (342)
                      .|++..++++++.+||||+++.|.+.+.........++.+.++++.++++|++++|+++|++|.+.++..+..|.+-
T Consensus       160 ~~~~~~~~~~~l~~grvD~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~av~k~~~~L~~~in~~l~~l~~~  236 (287)
T 2vha_A          160 SAKDHGDSFRTLESGRAVAFMMDDALLAGERAKAKKPDNWDIVGKPQSQEAYGCMLRKDDPQFKKLMDDTIAQVQTS  236 (287)
T ss_dssp             EESSHHHHHHHHHTTSCSEEEEEHHHHHHHHTTSSSGGGEEEESCCSCEEEEEEEECTTCHHHHHHHHHHHHHHHHT
T ss_pred             ECCHHHHHHHHHHCCCCEEEEEEHHHHHHHHHHCCCCCCEEEECCCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHC
T ss_conf             52217899999986994099961499999999657888679937877763189999489999999999999999978



>2v25_A Major cell-binding factor; antigen, adhesin, aspartate, glutamate, transport, ABC transport, virulence factor, receptor; 1.49A {Campylobacter jejuni} Back     alignment and structure
>1xt8_A Putative amino-acid transporter periplasmic solute-binding protein; ABC transport, cysteine uptake, spine, structural genomics; 2.00A {Campylobacter jejuni} SCOP: c.94.1.1 Back     alignment and structure
>3hv1_A Polar amino acid ABC uptake transporter substrate binding protein; protein structure initiative II(PSI II), nysgxrc; 1.90A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>2o1m_A Probable amino-acid ABC transporter extracellular-binding protein YTMK; NESG X-RAY O34852 YTMK_bacsu, structural genomics, PSI-2; 2.00A {Bacillus subtilis} Back     alignment and structure
>2iee_A ORF2, probable ABC transporter extracellular-binding protein YCKB; SR574, NESG, X-RAY, structural genomics, PSI-2; 2.20A {Bacillus subtilis} Back     alignment and structure
>2pvu_A ARTJ; basic amino acid binding protein, ABC transport system, thermophilic bacterium, transport protein; HET: LYS; 1.79A {Geobacillus stearothermophilus} PDB: 2q2a_A* 2q2c_A* Back     alignment and structure
>2q88_A EHUB, putative ABC transporter amino acid-binding protein; substrate-binding protein, compatible solues, osmoprotection; HET: 4CS; 1.90A {Sinorhizobium meliloti} PDB: 2q89_A* Back     alignment and structure
>1wdn_A GLNBP, glutamine binding protein; closed form, complex, peptide, complex (binding protein/peptide); 1.94A {Escherichia coli} SCOP: c.94.1.1 PDB: 1ggg_A Back     alignment and structure
>3h7m_A Sensor protein; histidine kinase sensor domain, kinase, phosphoprotein, transferase; 2.40A {Geobacter sulfurreducens} Back     alignment and structure
>3mpk_A Virulence sensor protein BVGS; venus flytrap, sensor domain, signaling protein; 2.04A {Bordetella pertussis} PDB: 3mpl_A Back     alignment and structure
>3kzg_A Arginine 3RD transport system periplasmic binding protein; arginine transport system, protein structure initiative II(PSI II); 2.06A {Legionella pneumophila subsp} Back     alignment and structure
>3kbr_A Cyclohexadienyl dehydratase; pseudomonas aeruginosa PA01,structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Pseudomonas aeruginosa} Back     alignment and structure